[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81382.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ve8A1.bssp"
#ERROR : Can't open dsspfile "1xppA.bssp"
#ERROR : Can't open dsspfile "1sfnA.bssp"
#ERROR : Can't open dsspfile "1mg7A2.bssp"
#ERROR : Can't open dsspfile "1sfuA.bssp"
#ERROR : Can't open dsspfile "2jn6A1.bssp"
#ERROR : Can't open dsspfile "1w44A.bssp"
#ERROR : Can't open dsspfile "1wi9A.bssp"
#ERROR : Can't open dsspfile "2h6bA1.bssp"
#ERROR : Can't open dsspfile "1q1hA.bssp"
#ERROR : Can't open dsspfile "1f48A2.bssp"
#ERROR : Can't open dsspfile "1lvaA4.bssp"
#ERROR : Can't open dsspfile "2a61A1.bssp"
#ERROR : Can't open dsspfile "1z05A1.bssp"
#ERROR : Can't open dsspfile "1qbjA.bssp"
#ERROR : Can't open dsspfile "1jw9B.bssp"
#ERROR : Can't open dsspfile "1p9rA.bssp"
#ERROR : Can't open dsspfile "1tzoA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1fm2.1.bssp"
#ERROR : Can't open dsspfile "2htjA1.bssp"
#ERROR : Can't open dsspfile "2cohA1.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"

## Summary of PDB Search
:796
    1e-25  42%  2ve8A1 [a.4.5.67] DNA TRANSLOCASE FTSK A:745 -- 811
    2e-25  19%  1xppA  [d.74.3.2] DNA-DIRECTED RNA POLYMERASE SUBUNIT L
    1e-24  10%  1sfnA  [b.82.1.11] CONSERVED HYPOTHETICAL PROTEIN
    1e-10  12%  1mg7A2 [d.58.26.6] EARLY SWITCH PROTEIN XOL-1 2.2K SPLICE FORM
    5e-06  15%  1sfuA  [a.4.5.19] 34L PROTEIN
    2e-05  15%  2jn6A1 [a.4.1.19] PROTEIN CGL2762 A:1 -- 89
    3e-05  17%  1w44A  [c.37.1.11] NTPASE P4
    5e-05  15%  1wi9A  [a.4.5.47] PROTEIN C20ORF116 HOMOLOG
    1e-04   8%  2h6bA1 [a.4.5.4] CHLOROPHENOL REDUCTION GENE K A:148 -- 229
    2e-04  18%  1q1hA  [a.4.5.41] TRANSCRIPTION FACTOR E
    2e-04  18%  1f48A2 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:309 -- 586
    2e-04  14%  1lvaA4 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:575
    2e-04  18%  2a61A1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR TM0710 A:5 -- 143
    2e-04  12%  1z05A1 [a.4.5.63] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:10 -- 80
    3e-04  19%  1qbjA  [a.4.5.19] PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSINE
    3e-04  22%  1jw9B  [c.111.1.1] MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
    3e-04  41%  1p9rA  [c.37.1.11] GENERAL SECRETION PATHWAY PROTEIN E
    5e-04  10%  1tzoA  [f.11.1.1] PROTECTIVE ANTIGEN
    7e-04  25%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    7e-04  18%  1fm2.1 [d.153.1.2] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE A:-
    7e-04  15%  2htjA1 [a.4.5.73] P FIMBRIAL REGULATORY PROTEIN KS71A A:1 -- 73
    7e-04  19%  2cohA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR A:118 -- 199
    9e-04  11%  1cl1A  [c.67.1.3] CYSTATHIONINE BETA-LYASE
    0.001   5%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
:796

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ve8A1          ----------------------------------------------------------------------
1xppA           ----------------------------------------------------------------------
1sfnA           ----------------------------------------------------------------------
1mg7A2          ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
1w44A           ----------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2a61A1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1jw9B           ----------------------------------------------------------------------
1p9rA           ----------------------------------------------------------------------
1tzoA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1fm2.1          ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
1cl1A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ve8A1          ----------------------------------------------------------------------
1xppA           ----------------------------------------------------------------------
1sfnA           ----------------------------------------------------------------------
1mg7A2          ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
1w44A           ----------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2a61A1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1jw9B           ----------------------------------------------------------------------
1p9rA           ----------------------------------------------------------------------
1tzoA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1fm2.1          ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
1cl1A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFKEKASKVKFVDKKYEKDDYINL
2ve8A1          ----------------------------------------------------------------------
1xppA           ----------------------------------------------------------------------
1sfnA           ----------------------------------------------------------------------
1mg7A2          ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
1w44A           ----------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2a61A1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1jw9B           ----------------------------------------------------------------------
1p9rA           ----------------------------------------------------------------------
1tzoA           -----------------------------------------------VKEAHREVINSSTEGLLLNIDKD
1e9rA           ----------------------------------------------------------------------
1fm2.1          ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
1cl1A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KKKDGASEGNKESKKDDISEDNNKIKILDFMKNSSLNDIEDNKKEKDNQLKDNIKINDFKQESKMPRDLS
2ve8A1          ----------------------------------------------------------------------
1xppA           ----------------------------------------------------------------------
1sfnA           ----------------------------------------------------------------------
1mg7A2          ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
1w44A           ----------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2a61A1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1jw9B           ----------------------------------------------------------------------
1p9rA           ----------------------------------------------------------------------
1tzoA           IRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKE
1e9rA           ----------------------------------------------------------------------
1fm2.1          ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
1cl1A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LDNTIIEQRGFNSEKAKEEESIDKEISNNIAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ve8A1          ----------------------------------------------------------------------
1xppA           ----------------------------------------------------------------------
1sfnA           ----------------------------------------------------------------------
1mg7A2          ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
1w44A           ----------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2a61A1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1jw9B           ----------------------------------------------------------------------
1p9rA           ----------------------------------------------------------------------
1tzoA           NTIINPSENGDTSTNGIKKILIFSKKGYEIG---------------------------------------
1e9rA           ----------------------------------------------------------------------
1fm2.1          ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
1cl1A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxSFGVEAKILQVTKGPSVTRFELQPKAGIKVSKIVNLADDIALGLAAKGVRIEAPIPGKSAIGI
2ve8A1          ----------------------------------------------------------------------
1xppA           ----------------------------------------------------------------------
1sfnA           ----------------------------------------------------------------------
1mg7A2          -------GFEVQQGGILLKKDSFFDDELIEKIAIAIA-------TESRQSVSSVSFDLLKLGPGASLVTL
1sfuA           ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
1w44A           ----------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2a61A1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1jw9B           ----------------------------------------------------------------------
1p9rA           ----------------------------------------------------------------------
1tzoA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1fm2.1          ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
1cl1A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EVPNKEQTPVFFREIVESKEFLDNKFKVACALGKDITGKAVVTDLSKMPHVLIAGATGSGKSVCINTLIV
2ve8A1          ----------------------------------------------------------------------
1xppA           ---------------------------------------------------------AESSLRVISKEKN
1sfnA           ----------------------------------------------------------------------
1mg7A2          --ANSRRFEPECRVVLQIEVK-------------------------------------------------
1sfuA           ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
1w44A           -----EDGSVSVVQVENGFMKQGHRGWLVDLTGELVGCSPVVAEFGGHRYVIVTGKGNSGKTPLVHALGE
1wi9A           ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1f48A2          --------------------------------------SALVDDIARNEHGLIMGKGGVGKTTMAAAIAV
1lvaA4          ----------------------------------------------------------------------
2a61A1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1jw9B           -------------------------------------------------RVLIVGLGGLGCAASQYL---
1p9rA           -------------------------------------------RLIKRPHILVTGPTGSGKS----TTLY
1tzoA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1fm2.1          ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
1cl1A           ----------------------------------------------------------------------
1pgsA2          --------------------------------------------------TTISGWGHAKPY----DAGS


                         *         .         .         .         .         +         .:560
query           SILYKYSPDEVKLLMIDPKVVELNVYNGIPHLLIPVVTDPKKAAAALNWAVNEMTRRYKLFADNGVRNIE
2ve8A1          ----------------------------------------------------------------------
1xppA           SITVEMINYDNTLEILKDDQVDEARYY-IKHPVIDVRVKSGKPQSAIKRAVRKLSKLYEDLGTQFQKEFQ
1sfnA           ----------------------------------------------------------------------
1mg7A2          ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
1w44A           ALGGKDKYATVR----------------------------------------------------------
1wi9A           ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1f48A2          RLADMGFD--VHLTTSDPA-AHLNNLQVSRIDPHEETERYRQHVLETKGKELDEAGKRLLEEDLRSPCTE
1lvaA4          ----------------------------------------------------------------------
2a61A1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1jw9B           ---ASAGVGNLTL--LDFDTVSLSNLQRQTLHSDATVGQPKVESAR---------DALTRI--NPHIAIT
1p9rA           AGLQELNSSERNILTVDP--IEFDI---------------------------------------------
1tzoA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1fm2.1          ---------RLRQADGSTVDKPLEIRHG------PVFERADGTAVAVRVAGLDRPGXLEYFDXITAHSFD
2htjA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
1cl1A           -----------------------------------------------NARCWEQLRENAYLMGQMVDADT
1pgsA2          RGCAEWCFRTHTIAINNANTFQHQ-LGALGCSANPINNQSPGNWTPDR----------------------


                         .         .         .         *         .         .         .:630
query           SYNALYNKGEVPEKLPYIVIIVDELADLMMACPHDVEDYICRLAQMARAAGMHLVIATQRPSVDVITGVI
2ve8A1          ----------------------------------------------------------------------
1xppA           RYES------------------------------------------------------------------
1sfnA           ------------KHLGQTRSALHGSHAVITPETFVRTALAEWPGSAIVLHIAPVVGLGARFVQFTAEMPA
1mg7A2          ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
1w44A           ----------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1f48A2          EIAVFQAFSRVIREAGKRFVVMD-----------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2a61A1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1jw9B           PVNALLDDAELAALIAEHDLVLDCT---------DNVAVRNQLNAGCFAAKVPLVSG-------------
1p9rA           ----------------------------------------------------------------------
1tzoA           ----------------------------------------------------------------------
1e9rA           -----------EEPKRRLWLFIDELASL---------EKLASLADAGRKAGLRVVAGLQSTSGVKEAQTL
1fm2.1          DYEAAXARXQVP----------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
1cl1A           AYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSK---GHEFWKRDFTGSSGLFSFVL
1pgsA2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           KANIPSRISFAVSSQIDSRTILDSAGAEKLLGRGDMLFYPVGESKPQRVQGAFISEEEVEHVVSFIKESQ
2ve8A1          ----------------------------------------------------------------------
1xppA           ----------------------------------------------------------------------
1sfnA           GAQATESVYQRFAFVLSGEVDVAVGGETRTLREYDYVYLPAGEKHMLTAKTDEKPYQTVEGVQAP----G
1mg7A2          ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
1w44A           ----------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2a61A1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1jw9B           ----------------------------------------------------------------------
1p9rA           ----------------------------------------------------------------------
1tzoA           ----------------------------------------------------------------------
1e9rA           RASFRSLVVLGGSRTDP-----------------------------------------------------
1fm2.1          ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
1cl1A           KKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEIDGLEDVDDLIADLDAGFAR--
1pgsA2          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           RDAQYEEDILEHINSATIASEGNGDGDRDELLDEAIEIVVESGQASASYLQRRLRIGFNRAARIIEELEE
2ve8A1          --------------------------EDDPLYDEAVRFVTESRRASISAVQRKLKIGYNRAARMIEAMEM
1xppA           ----------------------------------------------------------------------
1sfnA           VYWGNERENPGYPFEGDDHLIARKLLPDEPAFDFMVSTMSFAPGASLPYAEVHY----------------
1mg7A2          ----------------------------------------------------------------------
1sfuA           -----------------------------SLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQK
2jn6A1          ----------------------------EEFKRDAVALYENSDGASLQQIANDLGINRVTLKNWIIKYGS
1w44A           ----------------------------------------------------------------------
1wi9A           ----------------------------SGFLTEFINYIKKSKVVLLEDLAFQMGLRTQDAINRIQDLLT
2h6bA1          ----------------------------SSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKR
1q1hA           ----------------------------DDVIDVLRILLDKGTEMTDEEIANQLNIKVNDVRKKLNLLEE
1f48A2          ----------------------------------------------------------------------
1lvaA4          -----------------------------GEAREVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQ
2a61A1          ---------------------------------DILQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEA
1z05A1          ----------------------------QINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELID
1qbjA           --------------------------DQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAK
1jw9B           ----------------------------------------------------------------------
1p9rA           ----------------------------------------------------------------------
1tzoA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1fm2.1          ----------------------------------------------------------------------
2htjA1          -----------------------------------LEFLNRHNGGKTAEIAEALAVTDYQARYYLLLLEK
2cohA1          --------------------------ELSETPLAHEEEGKVVLKATHDELAAAVGSVRETVTKVIGELAR
1cl1A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           CGVISRRDGSKPRQVLLSKDELENMx
2ve8A1          AGVVTPMNTNGSREVIAPAPVRD---
1xppA           --------------------------
1sfnA           --------------------------
1mg7A2          --------------------------
1sfuA           EDTVKMVPSNPPK-------------
2jn6A1          NHNVQGTTPSAAVSEAEQIRQLKKE-
1w44A           --------------------------
1wi9A           EGTLTGVIDDRGKFIYIT--------
2h6bA1          ENILDKKKNKIIVYNLGELKHLS---
1q1hA           QGFVSYRKTRSGWFIYYWKPNIDQI-
1f48A2          --------------------------
1lvaA4          VKFTRRVGD-----------------
2a61A1          DGYLTRPDPADRRAYFLV--------
1z05A1          AHLIHETTVQEAISRGRPAVGLQ---
1qbjA           KGKLQKEAGT----------------
1jw9B           --------------------------
1p9rA           --------------------------
1tzoA           --------------------------
1e9rA           --------------------------
1fm2.1          --------------------------
2htjA1          AGMVQRSPLRRGM-------------
2cohA1          EGYIRSGYGKIQLLDLKGLKELAES-
1cl1A           --------------------------
1pgsA2          --------------------------