[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81560.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b54A.bssp"
#ERROR : Can't open dsspfile "1bd0A2.bssp"
#ERROR : Can't open dsspfile "1rcqA2.bssp"
#ERROR : Can't open dsspfile "2bhrA1.bssp"
#ERROR : Can't open dsspfile "1tufA2.bssp"
#ERROR : Can't open dsspfile "1hkvA2.bssp"

## Summary of PDB Search
:219
    2e-28  29%  1b54A  [c.1.6.2] YEAST HYPOTHETICAL PROTEIN
    2e-25  11%  1bd0A2 [c.1.6.1] ALANINE RACEMASE A:12 -- 244
    2e-20  14%  1rcqA2 [c.1.6.1] CATABOLIC ALANINE RACEMASE DADX A:8 -- 233
    6e-14  11%  2bhrA1 [c.37.1.14] RNA HELICASE A:483 -- 618
    3e-12  13%  1tufA2 [c.1.6.1] DIAMINOPIMELATE DECARBOXYLASE A:50 -- 313
    7e-07  13%  1hkvA2 [c.1.6.1] DIAMINOPIMELATE DECARBOXYLASE A:46 -- 310
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxIKENLTKFTEKIPSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHL
1b54A           --LIAQYESVREVVNSKILLLVVSKLKPASDIQILYDHGVREFGENYVQELIEKAKLLPDDIKWHFIGGL
1bd0A2          --IYDNVENLRRLLPDDTHIMAVVKAGDVQVARTALEAGASRLAVAFLDEALALREKIEAPILVLGASRP
1rcqA2          --LRHNYRLARE--ATGARALAVIKADAYGRCAEALAAEADGFAVACIEEGLELREAGIRQPILLLEGFF
2bhrA1          ----------------------------------------------------------------------
1tufA2          --IKINYNRYIEAFKRETGKEFIVAYAYXANITRLLAKLGCGADVVSGGELYIAKLSVPSKKIVFNGNCK
1hkvA2          --FRSRCRETAAAFGSGANVHYAAKAFLCSEARWISEEGL-CLDVCTGGELAVALHASFPPERITLHGNN


                         .         .         *         .         .         .         .:140
query           QTNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREEQKYGXXXXXXXXXXXXXXXC
1b54A           QTNKCKDLAKVLYSVETIDSLKKAKKLNEKFQPDCNPILCNVQINTSHEDQKSGEAEIFEVIDFFLSEEC
1bd0A2          ADAALAAQQRIALTVFRSDWLEEASALYS----GPFPIHFHLKMDTG-MGRLGVKDEEETKRIVALIERH
1rcqA2          EASELELIVA-HDFWCVVHCAWQLEAIERASLARP----LNVWLXMDSGMHRVGFFPEDFRAAHERLRAS
2bhrA1          --------------------------------------------DCA-HWKEAKMLLDNINTPEGIIPSM
1tufA2          TKEEIIMGIEANIRAFNVDSISELILINETAKELGETANVAFRINPGLKKNKFGLDVESGIAMKAIKMAM
1hkvA2          KSVSLTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRLTVAHEDQKFGVASGAAMAAVRRVFAT


                         +         .         .         .         .         *         .:210
query           NNVNVLGIMTIIPKGTEEECRKYFSKTHXXXXXXXXXXXXNIKMDILSMGMSGDYEIATEEGSNMVRIGQ
1b54A           KYIKLNGLMTIGSWENRDF--------ATLVEWKKKIDAKFGTSLKLSMGMSADFREAIRQGTAEVRIGT
1bd0A2          PHFVLEGLYTHFATADEVNTDYFSYQYTRFLHMLEWLPSRPPLV---HCANSAASLRFPDRTFNMVRFGI
1rcqA2          GKVAKIVMMSHFSRADELDCP-RTEEQLAAFSAAS-----QGLEGEISLRNSPAVLGWPKVPSDWVRPGI
2bhrA1          FEPEREKVDAIDGEYRLGEARKTFVDLMRRGDLPVWLAYRGINYADRRWCFDGVKNNQILEENVEVEIWT
1tufA2          EYVNVVGVHCHIGQLTDISPFIEETRKVMDFVVELKEEGIEIEDVNLGGGLGIPYY-KDKQIPTQKDLAD
1hkvA2          DHLRLVGLHSHIVDGFELAAHRVIGLLRDVVGEFGPEKTAQIATVDLGGGLGISY---------------


                         .         .         .         +         .         .         .:280
query           GIFGKRLYK
1b54A           DIFG-----
1bd0A2          AMYGLAPSP
1rcqA2          LLYGATPFE
2bhrA1          KEGERKKLK
1tufA2          AIIN-----
1hkvA2          ---------