[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81626.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1kt0A1.bssp"
#ERROR : Can't open dsspfile "2cfuA2.bssp"
#ERROR : Can't open dsspfile "1wfdA.bssp"
#ERROR : Can't open dsspfile "1xnfA.bssp"
#ERROR : Can't open dsspfile "1ihgA1.bssp"
#ERROR : Can't open dsspfile "1w3bA.bssp"
#ERROR : Can't open dsspfile "2fbnA1.bssp"
#ERROR : Can't open dsspfile "1zbpA1.bssp"
#ERROR : Can't open dsspfile "2cptA1.bssp"
#ERROR : Can't open dsspfile "1ouvA.bssp"
#ERROR : Can't open dsspfile "1elwA.bssp"
#ERROR : Can't open dsspfile "1q7sA.bssp"
#ERROR : Can't open dsspfile "1elrA.bssp"
#ERROR : Can't open dsspfile "1ya0A1.bssp"
#ERROR : Can't open dsspfile "2pqnA1.bssp"
#ERROR : Can't open dsspfile "1hz4A.bssp"
#ERROR : Can't open dsspfile "1hxiA.bssp"
#ERROR : Can't open dsspfile "1tjcA.bssp"
#ERROR : Can't open dsspfile "1iipA1.bssp"
#ERROR : Can't open dsspfile "1a87A.bssp"
#ERROR : Can't open dsspfile "1qqeA.bssp"
#ERROR : Can't open dsspfile "2crbA1.bssp"
#ERROR : Can't open dsspfile "2fezA2.bssp"
#ERROR : Can't open dsspfile "1qsaA1.bssp"
#ERROR : Can't open dsspfile "1nznA.bssp"
#ERROR : Can't open dsspfile "1d8dA.bssp"
#ERROR : Can't open dsspfile "1klxA.bssp"
#ERROR : Can't open dsspfile "2c2lA1.bssp"

## Summary of PDB Search
:116
    5e-10  23%  1kt0A1 [a.118.8.1] 51 KDA FK506-BINDING PROTEIN A:254 -- 412
    1e-09   4%  2cfuA2 [d.157.1.13] SDSA1 A:20 -- 524
    2e-08  11%  1wfdA  [a.7.14.1] HYPOTHETICAL PROTEIN 1500032H18
    4e-08  15%  1xnfA  [a.118.8.1] LIPOPROTEIN NLPI
    5e-08  16%  1ihgA1 [a.118.8.1] CYCLOPHILIN 40 A:197 -- 365
    1e-07  18%  1w3bA  [a.118.8.1] UDP-N-ACETYLGLUCOSAMINE--PEPTIDE
    2e-07  22%  2fbnA1 [a.118.8.1] 70 KDA PEPTIDYLPROLYL ISOMERASE, PUTATIVE A:22
    3e-07   5%  1zbpA1 [e.61.1.1] HYPOTHETICAL PROTEIN VPA1032 A:2 -- 265
    4e-07  17%  2cptA1 [a.7.14.1] VACUOLAR SORTING PROTEIN 4B A:8 -- 111
    4e-07  13%  1ouvA  [a.118.18.1] CONSERVED HYPOTHETICAL SECRETED PROTEIN
    8e-07  23%  1elwA  [a.118.8.1] TPR1-DOMAIN OF HOP
    2e-06  13%  1q7sA  [c.131.1.1] BIT1
    2e-06  20%  1elrA  [a.118.8.1] TPR2A-DOMAIN OF HOP
    3e-06  13%  1ya0A1 [a.118.8.1] SMG-7 TRANSCRIPT VARIANT 2 A:1 -- 497
    3e-06  10%  2pqnA1 [a.118.8.1] MITOCHONDRIA FISSION 1 PROTEIN A:4 -- 129
    3e-06  10%  1hz4A  [a.118.8.2] MALT REGULATORY PROTEIN
    3e-06  17%  1hxiA  [a.118.8.1] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    7e-06  22%  1tjcA  [a.118.8.1] PROLYL 4-HYDROXYLASE ALPHA-1 SUBUNIT
    9e-06  23%  1iipA1 [a.118.8.1] CYCLOPHILIN 40 A:197 -- 298
    2e-05   9%  1a87A  [f.1.1.1] COLICIN N
    2e-05  22%  1qqeA  [a.118.8.1] VESICULAR TRANSPORT PROTEIN SEC17
    2e-05  11%  2crbA1 [a.7.16.1] NUCLEAR RECEPTOR BINDING FACTOR 2 A:8 -- 90
    3e-05   7%  2fezA2 [a.118.8.3] PROBABLE REGULATORY PROTEIN EMBR A:105 -- 283
    4e-05   5%  1qsaA1 [a.118.5.1] PROTEIN (SOLUBLE LYTIC TRANSGLYCOSYLASE SLT70)
    6e-05  16%  1nznA  [a.118.8.1] FISSION PROTEIN FIS1P
    1e-04   9%  1d8dA  [a.118.6.1] FARNESYLTRANSFERASE (ALPHA SUBUNIT)
    3e-04  20%  1klxA  [a.118.18.1] CYSTEINE RICH PROTEIN B
    8e-04  30%  2c2lA1 [a.118.8.1] CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
:116

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSNFSKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYF
1kt0A1          -----KGTVYFKGGKYMQAVIQYGKIVSSESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDANEKGL
2cfuA2          ---YLGYYDGNPATLDPLSPEDSAGRYVEYMGGAERLLEQARASYARGEYRWVVEVVNRLVFAEDNRAAR
1wfdA           ---LKRAVELDAESRYQQALVCYQEGIDMLLQVLKGTKESSKRCVLRTKISGYMDRAENIKKYLDQEK--
1xnfA           ---YERGVLYDSLGLRALARNDFSQALAIRPDXPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDTYNYAH
1ihgA1          --------KVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIPSNTKAL
1w3bA           ---SDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDNFLDAY
2fbnA1          --------------KYKEALDFFIHTEEWDDQILLCNLNLATCYNKNKDYPKAIDHASKVLKIDNNVKAL
1zbpA1          ---SSFIELLCIDGDFERADEQLXQSIKLFPEYLPGASQLRHLVKAAQARKDFAGAATAKVLGEEELTKS
2cptA1          ------------------------SSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFHVVKYE
1ouvA           ---VGLGAKSYKEKDFTQAKKYFEKACDLKENSGCFNLGVLYYQGQGVEKNLKKAASFYAKACLNYSNGC
1elwA           -----KGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWKGY
1q7sA           -------------QCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKDEETLIALLAHAKMLGLTVSLI
1elrA           ---KELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENKAY
1ya0A1          ---VHLGDIARYRNQTSQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKPFPAAS
2pqnA1          VDFWPTLKDAYEPLYPQQLEILRQQVVTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRECL
1hz4A           VATSVLGEVLHCKGELTRSLALMQQTEQMARQHDVSLIQQSEILFAQGFLQTAWETQEKAFQLINHEFLV
1hxiA           --------------NLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARXLDKDIAVH
1tjcA           ---FELGKVAYTEADYYHTELWMEQALRQLDEKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEQRAN
1iipA1          ---KNIGNTFFKSQNWEMAIKKYTKVLRLQPVALSCVLNIGACKLKMSDWQGAVDSCLE-----------
1a87A           ------KDMANKIGNLGKAFKVADLAIREKSIEGYNTGNWGPLLLEVESWIIGGVVAGVAISLFGAVSFL
1qqeA           -------------KELNLAGDSFLKAAGNEDEAGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTH----
2crbA1          --------------------------MEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKL
2fezA2          ------AEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDGID
1qsaA1          ---AFASVARQDAENARLMIPSLAQAQQLNEDQIQELRDIVAWRLMGNDVTDEQAKWRDDAIMRQSTSLI
1nznA           ----AVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRTRYNDDIRKGIVLLEELLPQRDYV
1d8dA           -----RAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTV
1klxA           -------------KDLKKAIQYYVKACELN----EMFGCLSLVSNSQINKQKLFQYLSKACELNSGNGCR
2c2lA1          -----QGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDQSVKAH


                         .         .         *         .         .         .         .:140
query           FNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK
1kt0A1          YRRGEAQLLMNEFESAKGDFEKVLEVNAARLQISMCQKKA------
2cfuA2          ELQADALEQLGYQAENAGWRNSYLSA--------------------
1wfdA           ----------------------------------------------
1xnfA           LNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQKL--
1ihgA1          YRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAEL---------
1w3bA           INLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVY-----
2fbnA1          YKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVNKL--
1zbpA1          LVSFNLSXVSQDYEQVSELALQIEELR-------------------
2cptA1          AQGDKAKQSIRA--KCTEYLD-------------------------
1ouvA           HLLGNLYYSGQGVSQNTNKALQYYSKACDLKYA-------------
1elwA           SRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR---
1q7sA           QDAGRTQIAPGSQTVLGIGPGPADLID----KVTGHLKL-------
1elrA           ARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEK-----
1ya0A1          TNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSK-----
2pqnA1          YYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQK
1hz4A           RIRAQLLWAWARLDEAEASARSGIEVLSSYQPQQQLQCLA------
1hxiA           AALAVSHTNEHNANAALASLR-------------------------
1tjcA           GNLKYFE---------------------------------------
1iipA1          ----------------------------------------------
1a87A           PISGLAVTALGVIGIMT-----------------------------
1qqeA           --------RGQFRRGANFKFELGEILENDLHDYAKAI---------
2crbA1          TESEQAHLSLELQRDSHMKQLLLIQER-------------------
2fezA2          PGPTLRA---------------------------------------
1qsaA1          ERRVRMALGTGDRRGLNTWLARLPMEAKEKDEW-------------
1nznA           FYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAXKK
1d8dA           WHFRRVLLRSLQK---------------------------------
1klxA           FLGDFYENGKKDLRKAAQYYSKACGLNDQDGCLILGY---------
2c2lA1          FFLGQCQLEMESYDEAIANLQRAY----------------------