[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81632.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1mu5A3.bssp"
#ERROR : Can't open dsspfile "1f51A.bssp"
#ERROR : Can't open dsspfile "1b3qA3.bssp"
#ERROR : Can't open dsspfile "1bxdA.bssp"
#ERROR : Can't open dsspfile "1vpkA1.bssp"
#ERROR : Can't open dsspfile "1id0A.bssp"
#ERROR : Can't open dsspfile "2c2aA2.bssp"
#ERROR : Can't open dsspfile "1r62A.bssp"
#ERROR : Can't open dsspfile "1l0oA.bssp"
#ERROR : Can't open dsspfile "1y8nA2.bssp"
#ERROR : Can't open dsspfile "1aj6A.bssp"
#ERROR : Can't open dsspfile "1rktA2.bssp"
#ERROR : Can't open dsspfile "1ys3A1.bssp"
#ERROR : Can't open dsspfile "1qr0A2.bssp"
#ERROR : Can't open dsspfile "1csgA.bssp"
#ERROR : Can't open dsspfile "1ea6A2.bssp"
#ERROR : Can't open dsspfile "2c2aA1.bssp"
#ERROR : Can't open dsspfile "1oanA1.bssp"
#ERROR : Can't open dsspfile "1wj5A.bssp"
#ERROR : Can't open dsspfile "1ya7O1.bssp"
#ERROR : Can't open dsspfile "1joyA.bssp"
#ERROR : Can't open dsspfile "1bknA2.bssp"
#ERROR : Can't open dsspfile "1gjvA2.bssp"
#ERROR : Can't open dsspfile "2aswA1.bssp"
#ERROR : Can't open dsspfile "1pvgA2.bssp"
#ERROR : Can't open dsspfile "1utuA1.bssp"
#ERROR : Can't open dsspfile "1st6A3.bssp"

## Summary of PDB Search
:507
    4e-20  12%  1mu5A3 [d.122.1.2] TYPE II DNA TOPOISOMERASE VI SUBUNIT B A:10 --
    2e-19  13%  1f51A  [d.123.1.1] SPORULATION INITIATION PHOSPHOTRANSFERASE B
    2e-19  17%  1b3qA3 [d.122.1.3] PROTEIN (CHEMOTAXIS PROTEIN CHEA) A:355 -- 539
    3e-19  21%  1bxdA  [d.122.1.3] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
    4e-18  12%  1vpkA1 [d.131.1.1] DNA POLYMERASE III, BETA SUBUNIT A:1 -- 120
    4e-17  17%  1id0A  [d.122.1.3] PHOQ HISTIDINE KINASE
    9e-17  26%  2c2aA2 [d.122.1.3] SENSOR HISTIDINE KINASE A:321 -- 481
    6e-16  26%  1r62A  [d.122.1.3] NITROGEN REGULATION PROTEIN NR(II)
    1e-15  19%  1l0oA  [d.122.1.3] ANTI-SIGMA F FACTOR
    2e-15   9%  1y8nA2 [d.122.1.4] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    5e-15  15%  1aj6A  [d.122.1.2] GYRASE
    2e-14  11%  1rktA2 [a.121.1.1] PROTEIN YFIR A:83 -- 205
    3e-13  15%  1ys3A1 [d.122.1.3] SENSOR-TYPE HISTIDINE KINASE PRRB A:299 -- 446
    3e-13   5%  1qr0A2 [d.150.1.1] 4'-PHOSPHOPANTETHEINYL TRANSFERASE SFP A:102 --
    1e-12   9%  1csgA  [a.26.1.2] GRANULOCYTE COLONY-STIMULATING FACTOR RECEPTOR
    9e-12   6%  1ea6A2 [d.122.1.2] PMS1 PROTEIN HOMOLOG 2 A:27 -- 231
    2e-11  37%  2c2aA1 [a.30.2.1] SENSOR HISTIDINE KINASE A:232 -- 320
    8e-11  13%  1oanA1 [b.1.18.4] ENVELOPE GLYCOPROTEIN A:298 -- 394
    1e-10  12%  1wj5A  [a.4.5.59] HYPOTHETICAL PROTEIN (RIKEN CDNA 0610009H20)
    1e-10   6%  1ya7O1 [a.24.8.1] PROTEASOME ACTIVATOR PROTEIN PA26 O:4 -- 231
    2e-10  25%  1joyA  [a.30.2.1] PROTEIN (ENVZ_ECOLI)
    3e-09  15%  1bknA2 [d.122.1.2] MUTL A:20 -- 216
    4e-09  19%  1gjvA2 [d.122.1.4] [3-METHYL-2-OXOBUTANOATE DEHYDROGENASE A:186 --
    2e-06  30%  2aswA1 [a.274.1.1] HYPOTHETICAL PROTEIN AF1503 A:278 -- 331
    6e-05  17%  1pvgA2 [d.122.1.2] DNA TOPOISOMERASE II A:7 -- 245
    2e-04  14%  1utuA1 [a.283.1.1] EMSY A:11 -- 107
    3e-04  10%  1st6A3 [a.24.9.1] VINCULIN A:253 -- 371
:507

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1mu5A3          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1rktA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
2aswA1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1st6A3          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1mu5A3          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1rktA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
2aswA1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1st6A3          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNLISKPLVKLN
1mu5A3          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1rktA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
2aswA1          -----------------------------------------------------------STITRPIIELS
1pvgA2          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1st6A3          -------------------------------------------------------------NAPPGDAGE


                         .         .         .         +         .         .         .:280
query           KSAKKMSAMDFSEKCDIEREDEIGNLAKTLNFLSKNLSNALDDLKIKNXXXXXXXXXXXXXXXXXXXFIA
1mu5A3          ----------------------------------------------------------------------
1f51A           -------------------------------------------------------------------LLG
1b3qA3          ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1rktA2          -------------------------------------------------------------------VWA
1ys3A1          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1csgA           -------------------------------------------------------------------GLR
1ea6A2          ----------------------------------------------------------------------
2c2aA1          -------------------------------------------------------------------FIA
1oanA1          ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1joyA           -------------------------------------------------------------------LMA
1bknA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
2aswA1          NTADKIAEGNLEAEPHQNRADEIGILAKSIERLRRSLKVAME----------------------------
1pvgA2          ----------------------------------------------------------------------
1utuA1          -------------------------------------------------------------------RLT
1st6A3          QAIRQILDEAGKAGELCAGKREILGTCKTLGQMTDQLADLRARGQGATP------------------MAM


                         .         *         .         .         .         .         +:350
query           GASHELKTPIGIISGYAEGIKDGIVDHKDQGVYLDIIIDEAEKMNKLVMDMLELSKLEAGKIDLHIIDFS
1mu5A3          ----------------------------------------------------------------------
1f51A           HSRHDWMNKLQLIKGNL-------------------SLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLA
1b3qA3          -----------------------------------------------------------------MVP--
1bxdA           --------------------------------------------------------------EMPMEMAD
1vpkA1          ---------------------------------------VTVTTLELKDKITIASKALAKKSVKPILAGF
1id0A           --------------------------------------------------------------------HP
2c2aA2          ---------------------------------------------------------------INREKVD
1r62A           --------------------------------------------------------------------ES
1l0oA           ----------------------------------------------------------------------
1y8nA2          ---------------------------------------VHPKHIGSIDPTCNVADVVKD----------
1aj6A           ----------------------------------------------------------------------
1rktA2          SISSYLDELTEGLRDVADTLAPVQFEYLVTAYLEKRYDLFVERFSRLLQKGIDQGEFQPVQPLATIAKFF
1ys3A1          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1csgA           GSLTKLKGPLTMMASHYKQHCPPT-PETSCATQIITFESFKENLKDFLLVIPFDC---------------
1ea6A2          ----------------------------------------------------------------------
2c2aA1          NISHELRTPLTAIKAYAETIYNSLGDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSL--------
1oanA1          ----------------------------------------------------------------------
1wj5A           ------------------------------------------------LTSLLSEKIKEFLQEKKMQSFY
1ya7O1          ---------------------------------STYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIR
1joyA           GVSHDLRTPLTRIRLATEMMSE------QDGYLAESINKDIEECNAIIEQFIDYLR--------------
1bknA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
2aswA1          ----------------------------------------------------------------------
1pvgA2          -----------------------------------------------------ISQLEHILKRPDTYIGS
1utuA1          TIAHNMSGPNSSSEWSIEGRRLVPLM--------------------------------------------
1st6A3          QKAQQVSQGLDLLTAKVENA--------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LTELTEEVLVKNSVDINKNNLTVIKNYSPNEDLYVQGDDFKIEQVLTNFVTNAIKYSEPNNQIIIDIKPV
1mu5A3          ----------------------------NPELAGFPNPARALYQTVRELIENSLDATDVHGILPNIKITI
1f51A           FDFLTFNWKTHYM------TLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDH
1b3qA3          ISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGRH
1bxdA           LNAVLGEVIA----AESGYEREIETALYP-GSIEVKMHPLSIKRAVANMVVNAARYGNGW---IKVSSGT
1vpkA1          LFEVKDGNFYICATDLETGVKATVNAAEISGEARFVVPGDVIQKMVKVLPDEITELSLEGDALVISSG-S
1id0A           VAPLLDNLTSALNKVYQRKGVNIS--LDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISA---RQ
2c2aA2          LCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKAPDKYVKVILDE
1r62A           IHKVAERVVTLVSMELPDN-VRLIRDYDP-SLPELAHDPDQIEQVLLNIVRNALQALGPEGGEII-----
1l0oA           MRNEMHLQFSARSENESFARVTVA--AFVAQLDPTMDELTEIKTVVSEAVTNAIIHGYNNDPNGIVSISV
1y8nA2          AYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDRKEGYPL
1aj6A           -----------------LKGLDAVRKR-PGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVT--
1rktA2          LNXNDGIIQ-------------------------------------------------------------
1ys3A1          --------------------------LVPSPTCIIVGLPAGLRLAVDNAIANAVKHGGAT--LVQLSAVS
1qr0A2          --------------------------------------------------IDIEKTKPISLEI-------
1csgA           ----------------------------------------------------------------------
1ea6A2          ------------------------------------QVVLSLSTAVKELVENSLDAGATNIDLKLKDYG-
2c2aA1          ----------------------------------------------------------------------
1oanA1          -------------------------------------------------------YSMCTGKFKVVKEIA
1wj5A           QQELETVESLQSLASRPVTHSTG--------SDQVELKDSGTSGVAQRVFKNALQLLQEKGLVFQRDSG-
1ya7O1          TVIAIRIPEHKE-------EDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLS--
1joyA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------RPASVVKELVENSLDAGATR----IDIDIE
1gjvA2          -----------------------------------------LDYILPELLKNAMRATMESHDVVITIANN
2aswA1          ----------------------------------------------------------------------
1pvgA2          VETQEQLQWIYDEETDCXIEKNVT---------IVPGLFKIFDEILVNAADNKVRDPSXKR---IDVN-I
1utuA1          ----------------------------------------------------------------------
1st6A3          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EEDKIYFSIENTGAHIPDSDINKIWTQFYRGDTSRNRGSRSTGLGLSIVKNLLQAHESEFGVMNTENGVK
1mu5A3          DLQIYKVNVVDNGIGIPPQEVPNAFGRVLYSKYVNRQTRGMYGLGVKAAVLYSQMHQDKPIEIETSSKRI
1f51A           PDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSIEIGL------------------------
1b3qA3          EGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESFLFVPGFSGVGMDVVKNVVESLNGSMGIESEKDGTK
1bxdA           EPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTI--SGTGLGLAIVQRIVDNHNGMLELGTSERGLS
1vpkA1          TVFRITTMPADEFPEIT-----------------------------------------------------
1id0A           TDEHLYIVVEDDGPGIPLSKREVIFDRGQRVDTLRPGQGV----GLAVAREITEQYEGKIVAGESMLGAR
2c2aA2          KDGGVLIIVEDNGIGIPDHAKDRIFEQFYR---------VDTGLGLAITKEIVELHGGRIWVESEVGGSR
1r62A           ------LRTRTAFQLTLHGERYRLAARIDVEDNGPG-----IGLGLSIARNLIDQHSGKIEFTSWPGHTE
1l0oA           IIEDVHLTVRDEGVGIPDIEEARQPLFTT------KPELERSGMGFTIME----NFMDEVIVESEVNGTT
1y8nA2          GKEDLSIKISDLGGGVPLRKIDRLF---------------------------------------------
1aj6A           IHADNSVSVQDDGRGIPTGIVSAAEVIMTVLHAGGKFSGGLHGVGVSVV----NALSQKLELVIQHEGKI
1rktA2          ----------------------------------------------------------------------
1ys3A1          SRAGVEIAIDDNGSGVPEGERQVVFERFSLGLALVAQQAQLHGGTASLENSPLG-------------GAR
1qr0A2          AKRFFSKTEYSDLLAKDKDEQTDYFYHLWSMKESFIKQEGKGLSLPLDSFSVRLHQDGQVSIELPDSSPC
1csgA           ----------------------------------------------------------------------
1ea6A2          ---VDLIEVSDNGCGVEEENFEGLTLEALSSLCALSDVTSTCHASAKVGTRLMFDHNGKIIQKTPYPPRG
2c2aA1          ----------------------------------------------------------------------
1oanA1          ETGTIVIRVQYEGDGSPCKIPFEIMDLEKRH----------VLGRLITVNPIVTEKDSPVNIEAEPPGDS
1wj5A           SDKLYYVTTKDKDLQSG-----------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1bknA2          RGGAKLIRIRDNGCGIKKDELALALAIASLDDLEAIISLGFRGEALASISSVSRTAEQQEAWQAYAVTVK
1gjvA2          DVD-LIIRISDRGGGIAHKDLDRVMDYHF--------TTAGFGFGLPTSRAYAEYLGGSLQLQSLQGGTD
2aswA1          ----------------------------------------------------------------------
1pvgA2          HAEEHTIEVKNDGKGIPIEIHNKLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILE--TADLNVGQK
1utuA1          ----------------------------------------------------------------------
1st6A3          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           FYFTLKKSKEIDEVEEI
1mu5A3          YTFKLKIDINKNEPII-
1f51A           -----------------
1b3qA3          VTIRL------------
1bxdA           IRAWLPVPVTRAQGTT-
1vpkA1          -----------------
1id0A           MEVIF------------
2c2aA2          FFVWIPKDR--------
1r62A           FSVYL------------
1l0oA           VYLKK------------
1y8nA2          -----------------
1aj6A           HRQ--------------
1rktA2          -----------------
1ys3A1          LVLRL------------
1qr0A2          YIKTY------------
1csgA           -----------------
1ea6A2          TTVSV------------
2c2aA1          -----------------
1oanA1          YIIIGVEPGQLKLNWF-
1wj5A           -----------------
1ya7O1          -----------------
1joyA           -----------------
1bknA2          PAA--------------
1gjvA2          VYLRLRH---IDGREE-
2aswA1          -----------------
1pvgA2          YVQKWENNXSICHPPKI
1utuA1          -----------------
1st6A3          -----------------