[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81731.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1qgoA.bssp"
#ERROR : Can't open dsspfile "1iwmA.bssp"
#ERROR : Can't open dsspfile "1xp3A1.bssp"
#ERROR : Can't open dsspfile "1fuiA2.bssp"
#ERROR : Can't open dsspfile "1qtwA.bssp"
#ERROR : Can't open dsspfile "1oltA.bssp"
#ERROR : Can't open dsspfile "1m98A1.bssp"
#ERROR : Can't open dsspfile "2h7aA1.bssp"
#ERROR : Can't open dsspfile "1tv7A.bssp"
#ERROR : Can't open dsspfile "1pmmA.bssp"
#ERROR : Can't open dsspfile "1r30A.bssp"
#ERROR : Can't open dsspfile "1yezA1.bssp"

## Summary of PDB Search
:434
    2e-32  11%  1qgoA  [c.92.1.2] ANAEROBIC COBALAMINE BIOSYNTHETIC COBALT
    3e-27  14%  1iwmA  [b.125.1.2] OUTER MEMBRANE LIPOPROTEIN LOLB
    4e-23   8%  1xp3A1 [c.1.15.1] ENDONUCLEASE IV A:2 -- 298
    6e-23   8%  1fuiA2 [c.85.1.1] L-FUCOSE ISOMERASE A:1 -- 355
    8e-22   7%  1qtwA  [c.1.15.1] ENDONUCLEASE IV
    9e-17  17%  1oltA  [c.1.28.2] OXYGEN-INDEPENDENT COPROPORPHYRINOGEN III
    1e-15  15%  1m98A1 [a.175.1.1] ORANGE CAROTENOID PROTEIN A:2 -- 175
    1e-10   6%  2h7aA1 [d.350.1.1] HYPOTHETICAL PROTEIN YCGL A:2 -- 110
    8e-07  24%  1tv7A  [c.1.28.3] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN A
    1e-05  13%  1pmmA  [c.67.1.6] GLUTAMATE DECARBOXYLASE BETA
    9e-05  15%  1r30A  [c.1.28.1] BIOTIN SYNTHASE
    4e-04  19%  1yezA1 [b.40.4.12] MM1357 A:1 -- 68
:434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEMADVYVVNTCSVTNMGDKKSRQIIGRARRQNPEA
1qgoA           ----------------------------------------------------------------------
1iwmA           ----------------------------------------------------------------------
1xp3A1          ----------------------------------------------------------------------
1fuiA2          -----------------------------------AAVECVISDTCIAG---MAEAAACEEKFSSQNVGL
1qtwA           ----------------------------------------------------------------------
1oltA           ----------------------------------------------------------------------
1m98A1          ----------------------------------------------------------------------
2h7aA1          ----------------------------------------------------------------------
1tv7A           ----------------------------------------------------------------------
1pmmA           ----------------------------------------------------------------------
1r30A           ----------------------------------------------------------------------
1yezA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAVLKNKVFEDLKIEEYNN
1qgoA           -------------------------------------------------------------EKNIVACER
1iwmA           ----------------------------------------------------------------------
1xp3A1          --------------MIYTGAPQNTRRKPIEELNIEAGRKHMEQNGIEEIIIHAPYIINVGNTTKPETFQL
1fuiA2          TITVTPCWCYGSETIDPTRPKAIWGFNGTERPGAVYLAAALAAHSQKGIPAFSIYGHDVQDADDTSIPAD
1qtwA           ---------------------RAAPLTTQTIDEFKAACEKYH------YTSAQILPHDSYLINLGHPVTE
1oltA           ----------------------------------------------------------------------
1m98A1          ----------------------------------------------------------------------
2h7aA1          ----------------------------------------------------------------------
1tv7A           ----------------------------------------------------------------------
1pmmA           ----------------------------------------------------------------------
1r30A           ----------------------------------------------------------------------
1yezA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT
1qgoA           DLAASCPDRDLFRAFTSGMIIRKLRQRDGI-DIDTPLQALQKLAAQGYQDVAIQSLHIINGD-------E
1iwmA           -----------------------------------------SPDSPQWRQHQQDVRNLNQYQTRGA----
1xp3A1          GVDFLRMEIERTSALGVAKQIVAHVGAGADAGIQQIIKGLNEVLTPDQTVNIALETMAGKGTECGRSFEE
1fuiA2          VEEKLLRFARAGLAVASMKGKSYLSLGGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDE
1qtwA           ALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGK
1oltA           -----------CHKLCYFCGCN----KIVTRQQHKADQYLDALQEIVHRAPLFAGVSQLHWGLNKAQISR
1m98A1          ------------------------------------IDTARSIPETLAADVVPATIARFKQL-------S
2h7aA1          -SMPKPGILKSKSMFCVIYRSSKRDQYLYVEKKDDFSRVPEELMKGFGQPQLAMILP--LDGRKKLVNAD
1tv7A           -----LSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELDEMKVYAELGVKKIRITG------GEPLMRR-D
1pmmA           ---------------------------------KQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDD
1r30A           ----------ACPEDCKYCSSRYKTGLEAEREVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPY---
1yezA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LVDLLEEIEKIDGIERVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYE
1qgoA           YEKIVREVQLLRP-LFTRLTLGVPLLSSHNDYVQL--MQALRQQMPSLRQTEKVVFMGHGASHHAFAAYA
1iwmA           ---FAYISDQQKVYARFFWQQTGQDRYRLLLTN-----PLGSTELELNAQPGNVQLVDNKGQRYTADDAE
1xp3A1          IAKIIDGVKYNEKL-SVCFDTCHTHDAGYDIVNNFDGVLNEFDKIV-----GIDRLQVLHINDSKNVRGA
1fuiA2          MALAWADKNFRYGEDENNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYN----A
1qtwA           FEHLAAIIDGVEDKSRVGVCTCHAFAAGYDLRTPAECEKTFADFARTVGFKYL----RGMHLNDAKSTFG
1oltA           LMKLLRENFQFNADAEISI-EVDPREIELD---VLDHLRAEFNRLSMGVQDFNKEVQRLVNREQDEEFIF
1m98A1          AEDQLALIWFAYLEMGKTITIAAPGAANMQFAENTLQ-----EIRQMTPLQQTQAMCDLANRTDTPICR-
2h7aA1          IEKVKQALTEQG--YYLQLPPP-PEDLLKQHLSVMGQ---------------------------------
1tv7A           LDVLIAKLNQIDGIEDIGLTT--NGLLLKKHGQKL--YDAGLRRINVSLDAIDDTLFQSINNRIKATTIL
1pmmA           AFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEESAAIDLRCVNMVADLWHAP---
1r30A           LEQMVQGVKAMGLEACMTLGTLSES-----------QAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQ
1yezA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DIVNLLRDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK
1qgoA           CLDHMMTAQRFPA-------RVGAVESYPEVDILIDSLRDEGVTGVHLMPLMLVAGDHAINMASDDGDSW
1iwmA           EMIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRLSEITNGKNWKVVYGGYDTKTQPAMPANMELTD
1xp3A1          ----------------GKDRHENIGFGHIGYKALHHIVHHPQLTHVPKILETPYVGEDKKDKKPPYKLEI
1fuiA2          IAAGFQGQRHWTDQYPN--GDTAEA---------------------------------------------
1qtwA           SR---------------VDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQT
1oltA           ALLNHAR-EIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSVFNYAHLPTIFA--AQRKIKDAD
1m98A1          ------TYASWSPNIKLGFWYELGR---------------------------------------------
2h7aA1          ----------------------------------------------------------------------
1tv7A           EQIDYATSIGLNVKVNVVIQKGI-----------------------------------------------
1pmmA           ----------------------------------------------------------------------
1r30A           ERLDTLEKRDAGIKVCSGGIVGL-GETVKDRAGLLLQLANLPTPPESINMLVKVKGTPLADND-------
1yezA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI
1qgoA           KMRFNAAGIPATPWLSGLGEN---PAIRAMFVA-------------------------------------
1iwmA           GGQRIKLKMD------------------------------------------------------------
1xp3A1          EMLK--NGTFDEGLLEKIKAQ-------------------------------------------------
1fuiA2          ----------------------------------------------------------------------
1qtwA           EKAV------------------------------------------------------------------
1oltA           LPSPQQKLDILQETIAFLTQSGY-----------------------------------------------
1m98A1          ----------------------------------------------------------------------
2h7aA1          ----------------------------------------------------------------------
1tv7A           ----------------------------------------------------------------------
1pmmA           ----------------------------------------------------------------------
1r30A           ----------------------------------------------------------------------
1yezA1          ---------------ESRSVPVEEGEVYDVTIQDIARQGDGI--ARIEGFVIFVPGT---KVGDEVRIKV


                         .         .         +         .         .         .         .:490
query           NSFEGEVAEGEIVx
1qgoA           --------------
1iwmA           --------------
1xp3A1          --------------
1fuiA2          --------------
1qtwA           --------------
1oltA           --------------
1m98A1          --------------
2h7aA1          --------------
1tv7A           --------------
1pmmA           --------------
1r30A           --------------
1yezA1          ERVLPKFAFASVV-