[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81831.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1k4kA.bssp"
#ERROR : Can't open dsspfile "1gzuA.bssp"
#ERROR : Can't open dsspfile "1kamA.bssp"
#ERROR : Can't open dsspfile "1b6tA.bssp"
#ERROR : Can't open dsspfile "1mrzA2.bssp"
#ERROR : Can't open dsspfile "1ihoA.bssp"
#ERROR : Can't open dsspfile "1cozA.bssp"
#ERROR : Can't open dsspfile "1g8fA2.bssp"
#ERROR : Can't open dsspfile "1lw7A1.bssp"
#ERROR : Can't open dsspfile "1ej2A.bssp"

## Summary of PDB Search
:202
    1e-45  29%  1k4kA  [c.26.1.3] NICOTINIC ACID MONONUCLEOTIDE
    6e-41  22%  1gzuA  [c.26.1.3] NICOTINAMIDE MONONUCLEOTIDE ADENYLYL TRANSFERASE
    9e-28  35%  1kamA  [c.26.1.3] NICOTINATE-NUCLEOTIDE ADENYLYLTRANSFERASE
    4e-20  22%  1b6tA  [c.26.1.3] PROTEIN (PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE)
    4e-18  19%  1mrzA2 [c.26.1.3] RIBOFLAVIN KINASE/FMN ADENYLYLTRANSFERASE A:2 --
    2e-17  10%  1ihoA  [c.26.1.4] PANTOATE--BETA-ALANINE LIGASE
    2e-16  17%  1cozA  [c.26.1.2] PROTEIN (GLYCEROL-3-PHOSPHATE
    2e-08  25%  1g8fA2 [c.26.1.5] SULFATE ADENYLYLTRANSFERASE A:169 -- 389
    3e-08  38%  1lw7A1 [c.26.1.3] TRANSCRIPTIONAL REGULATOR NADR A:57 -- 219
    1e-05  22%  1ej2A  [c.26.1.3] NICOTINAMIDE MONONUCLEOTIDE ADENYLYLTRANSFERASE
:202

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKIGVFGGTFDPIHIGHIYIAYEAYKILELDEVIFMPAGNPPHKKWKDITDEIIRYEMVKKAIEPYSFF
1k4kA           -SLQALFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPEANSV-QRKHMLELAIADKPLF
1gzuA           TEVVLLACGSFNPITNXHLRLFELAKDYYTVVKGIISPVGDAYKKK--GLIPAYHRVIXAELATKNSKWV
1kamA           -KKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMPNQIPDSFH---------RVEMLKLAIQSNPSF
1b6tA           --KRAIYPGTFDPITNGHIDIVTRATQ--MFDHVILAIAASPSK---KPMFTLEERVALAQQATAHLGNV
1mrzA2          -----VSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFP-GLLMTVESRVE---ML
1ihoA           -GKRVALVPTMGNLHDGHMKLVDEAKARADVVVVSIFVNPMRPEDLARYPRTLQEDCEKLNKRKVDLVFA
1cozA           --KKVITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILE------TIR
1g8fA2          -DRVVAFQ-TRNPMHRAHRELTVRAA--REANAKVLIPVVGL--TKPGDIDHH-TRVRVYQEIIK-----
1lw7A1          -KKVGVIFGKFYPVHTGHINXIYEAFS--KVDELHVIVCSDTVRD-------------------------
1ej2A           ----GLLVGRMQPFHRGHLQVIKSILE--EVDELIICIGSAQLSHSIRDPFTAGERVMMLTKALSEYYII


                         .         .         *         .         .         .         .:140
query           SINNYEIEKKGLSFTYETLRYLHESFKEVELYFITGADCLVNLNSWKNINEIFKFSNLVVFNRPGFDKND
1k4kA           TLDERELKRNAPSYTAQTLKEWREQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
1gzuA           EVDTWESLQKEWKETLKVLRHHQEKLEAPKVKLLCGADLLESFAVPNLITQIVANYGLICVTRAGNDAQK
1kamA           KLELVEMEREGPSYTFDTVSLLKQRYPNDQLFFIIGADMIEYLPKWYKLDELLNLIQFIGVKRPGFHVET
1b6tA           EV---------VGFSDLMANFARNQHAT---VLIRGLRAVADFEYEMQLAHMNRHLMPELESVFLMPSKE
1mrzA2          SRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGK
1ihoA           PSVKEIYPNGETHTYVDVPGLSTMLEGARPGHFRGVSTIVSKLFNLVQPDIACFGEKDF----QQLALIR
1cozA           YVDEVIP----EKNWEQKKQDIIDHNID---VFVMGDDWEGKFDFLKDQCEVVYLPRTEG----------
1g8fA2          ---RYPNGIAFLSLLPLAMRM--SGDREAVWHAIYGASHFI---VGRDHAGPGKNSKGVDFYGPYDAQEL
1lw7A1          ----------------------------------------------------------------------
1ej2A           PVQDIECNALWVGHIKMLTPPFDRVYSGNPL-----------------VQRLFSEDGYEVTAPPLFYRD-


                         +         .         .         .         .         *         .:210
query           LLKRKEEFDREYCTNIVYLDLLNIEISSTLIRERVRESLEVKFFLPPGVVDIIDKYNLYRRE
1k4kA           LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
1gzuA           FIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSE
1kamA           P------------YPLLFADVPEFEVSSTMIRERFKSKKPTDYLIPDKVKKYVEENGLYE--
1b6tA           WSF----------------------ISSSLVKEVARHQGDVTHFLPENVHQALMAK------
1mrzA2          ------------------------RVSSSLIRNLVQE-------------------------
1ihoA           KMVADMGFDIEIVGVPIMRAKDGLALSSRNGYLTAEQRKIAPGLYK----------------
1cozA           --------------------------------------------------------------
1g8fA2          VESYKHELDIEYLPRYAPIDTRTLNISGTELRRRLRVGGEIEWFSYPEVVKILRESN-----
1lw7A1          --------------------------------------------------------------
1ej2A           ------------------------RYSGTEVRRRMLDDGDWRSLLPESVVEVIDEINGVER-