[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81882.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1o12A2.bssp"
#ERROR : Can't open dsspfile "1ymyA2.bssp"
#ERROR : Can't open dsspfile "1un7A2.bssp"
#ERROR : Can't open dsspfile "1k6wA2.bssp"
#ERROR : Can't open dsspfile "1gkpA2.bssp"
#ERROR : Can't open dsspfile "2p9bA2.bssp"
#ERROR : Can't open dsspfile "1gkpA1.bssp"
#ERROR : Can't open dsspfile "2oodA2.bssp"
#ERROR : Can't open dsspfile "1m7jA3.bssp"
#ERROR : Can't open dsspfile "1un7A1.bssp"
#ERROR : Can't open dsspfile "2ftyA1.bssp"
#ERROR : Can't open dsspfile "1a5kC1.bssp"
#ERROR : Can't open dsspfile "2p9bA1.bssp"
#ERROR : Can't open dsspfile "3be7A1.bssp"
#ERROR : Can't open dsspfile "1xrfA1.bssp"
#ERROR : Can't open dsspfile "2bb0A1.bssp"
#ERROR : Can't open dsspfile "1a4lA.bssp"
#ERROR : Can't open dsspfile "2pajA2.bssp"
#ERROR : Can't open dsspfile "2oodA1.bssp"
#ERROR : Can't open dsspfile "2i9uA1.bssp"
#ERROR : Can't open dsspfile "1onwA1.bssp"
#ERROR : Can't open dsspfile "1ymyA1.bssp"
#ERROR : Can't open dsspfile "2oofA1.bssp"
#ERROR : Can't open dsspfile "2a3lA1.bssp"
#ERROR : Can't open dsspfile "1k6wA1.bssp"
#ERROR : Can't open dsspfile "2gokA1.bssp"
#ERROR : Can't open dsspfile "1j6pA1.bssp"
#ERROR : Can't open dsspfile "1gkrA1.bssp"
#ERROR : Can't open dsspfile "2r8cA1.bssp"
#ERROR : Can't open dsspfile "2icsA1.bssp"
#ERROR : Can't open dsspfile "2i9uA2.bssp"
#ERROR : Can't open dsspfile "2qs8A1.bssp"
#ERROR : Can't open dsspfile "1m7jA1.bssp"
#ERROR : Can't open dsspfile "1dpmA.bssp"
#ERROR : Can't open dsspfile "2pajA1.bssp"
#ERROR : Can't open dsspfile "1m7jA2.bssp"
#ERROR : Can't open dsspfile "1yixA1.bssp"
#ERROR : Can't open dsspfile "2ftyA2.bssp"
#ERROR : Can't open dsspfile "2uz9A1.bssp"
#ERROR : Can't open dsspfile "1v77A.bssp"
#ERROR : Can't open dsspfile "2qs8A1.bssp"

## Summary of PDB Search
:378
    8e-98  35%  1o12A2 [c.1.9.10] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:44
    9e-49  35%  1ymyA2 [c.1.9.10] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:54
    1e-48  40%  1un7A2 [c.1.9.10] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:58
    8e-26  11%  1k6wA2 [c.1.9.5] CYTOSINE DEAMINASE A:56 -- 375
    3e-25  13%  1gkpA2 [c.1.9.6] HYDANTOINASE A:55 -- 389
    2e-23  11%  2p9bA2 [c.1.9.17] POSSIBLE PROLIDASE A:71 -- 394
    2e-20  22%  1gkpA1 [b.92.1.3] HYDANTOINASE A:2 -- 54 A:390 -- 459
    5e-20  12%  2oodA2 [c.1.9.9] BLR3880 PROTEIN A:73 -- 397
    2e-19  11%  1m7jA3 [c.1.9.11] D-AMINOACYLASE A:62 -- 419
    6e-18  13%  1un7A1 [b.92.1.5] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:3
    8e-18  14%  2ftyA1 [b.92.1.3] DIHYDROPYRIMIDINASE A:2 -- 56 A:441 -- 541
    2e-17  24%  1a5kC1 [b.92.1.1] UREASE (ALPHA SUBUNIT) C:2 -- 129 C:423 -- 475
    6e-17  23%  2p9bA1 [b.92.1.10] POSSIBLE PROLIDASE A:9 -- 70 A:395 -- 450
    2e-16  22%  3be7A1 [b.92.1.9] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE A:3 --
    8e-16  23%  1xrfA1 [b.92.1.3] DIHYDROOROTASE A:1 -- 55 A:366 -- 422
    6e-15  19%  2bb0A1 [b.92.1.10] IMIDAZOLONEPROPIONASE A:3 -- 73 A:374 -- 415
    6e-14  16%  1a4lA  [c.1.9.1] ADENOSINE DEAMINASE
    1e-13  14%  2pajA2 [c.1.9.9] PUTATIVE CYTOSINE/GUANINE DEAMINASE A:70 -- 405
    1e-13  12%  2oodA1 [b.92.1.4] BLR3880 PROTEIN A:3 -- 72 A:398 -- 467
    2e-13  15%  2i9uA1 [b.92.1.4] CYTOSINE/GUANINE DEAMINASE RELATED PROTEIN A:9 --
    5e-13  19%  1onwA1 [b.92.1.7] ISOASPARTYL DIPEPTIDASE A:1 -- 62 A:347 -- 389
    7e-13  18%  1ymyA1 [b.92.1.5] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:1
    1e-12  13%  2oofA1 [b.92.1.10] 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE A:3 --
    2e-12   6%  2a3lA1 [c.1.9.1] AMP DEAMINASE A:212 -- 839
    8e-12  20%  1k6wA1 [b.92.1.2] CYTOSINE DEAMINASE A:4 -- 55 A:376 -- 426
    3e-11  16%  2gokA1 [b.92.1.10] IMIDAZOLONEPROPIONASE A:17 -- 79 A:381 -- 420
    4e-11  17%  1j6pA1 [b.92.1.4] METAL-DEPENDENT HYDROLASE OF A:-1 -- 49 A:331 --
    7e-10  30%  1gkrA1 [b.92.1.3] NON-ATP DEPENDENT L-SELECTIVE HYDANTOINASE A:1
    7e-10  18%  2r8cA1 [b.92.1.9] PUTATIVE AMIDOHYDROLASE A:2 -- 57 A:369 -- 414
    6e-09  22%  2icsA1 [b.92.1.8] ADENINE DEAMINASE A:4 -- 54 A:322 -- 371
    1e-07  11%  2i9uA2 [c.1.9.9] CYTOSINE/GUANINE DEAMINASE RELATED PROTEIN A:67 --
    8e-07  18%  2qs8A1 [b.92.1.9] XAA-PRO DIPEPTIDASE A:7 -- 63 A:374 -- 412
    1e-06  15%  1m7jA1 [b.92.1.6] D-AMINOACYLASE A:7 -- 61
    1e-05  10%  1dpmA  [c.1.9.3] PHOSPHOTRIESTERASE
    2e-05  18%  2pajA1 [b.92.1.4] PUTATIVE CYTOSINE/GUANINE DEAMINASE A:10 -- 69
    1e-04  43%  1m7jA2 [b.92.1.6] D-AMINOACYLASE A:420 -- 480
    3e-04  14%  1yixA1 [c.1.9.12] DEOXYRIBONUCLEASE YCFH A:1 -- 265
    4e-04  12%  2ftyA2 [c.1.9.6] DIHYDROPYRIMIDINASE A:57 -- 440
    6e-04  17%  2uz9A1 [b.92.1.4] GUANINE DEAMINASE A:8 -- 75 A:389 -- 451
    0.001   9%  1v77A  [c.6.3.2] HYPOTHETICAL PROTEIN PH1877
    5e-04  16%  2qs8A1 [b.92.1.9] XAA-PRO DIPEPTIDASE A:7 -- 63 A:374 -- 412(query 1->57)
:378

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAGGHDTMDGTYE
1o12A2          -------------------------------------------------GFVDPHIHGVVGADTXNCDFS
1ymyA2          -------------------------------------------------GFIDVQLNGCGGVQFNDTAVE
1un7A2          -------------------------------------------------GMIDIHIHGGYGADTMDASFS
1k6wA2          -------------------------------------GQPNWNQSGTLFEGIERWAERKALLTHDD-VKQ
1gkpA2          --------------------------------------------------FIDPHVHIYLPFMATFAK-D
2p9bA2          ------------------------------------------------PGLINAHTHL------FSYXAA
1gkpA1          LLIKNGEIITADSRYKADIYAEGETITRIGQNLEAGTEVIDATGKYVFPGADLVVYDPQYRGTISVKTQH
2oodA2          ------------------------------------------------PGFIDGHIHLPQTRVLGAYGEQ
1m7jA3          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2ftyA1          LIIKNGIICTASDIYAAEIAVNNGKVQLIPSLGSEVIDAEGAFITPILPGVSDADLVIWYPDDSKKEYNS
1a5kC1          LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDTEVIAAEGKIVTAGSIEVGKLA----DLVVWSPA
2p9bA1          ----------------------------------------------------------------------
3be7A1          FLIKSKGYLDIQEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPQIKEGFDADIVGVIENPLANI
1xrfA1          LIVKNGYVIDPSLEGEFDILVENGKIKKIDKNILVPAEIIDAKGLIVCPTLKLGSPADITIFDP---NKE
2bb0A1          ----------------------------------------------------------------------
1a4lA           -PAFNKPKVELHAIKPETILYFGKKRGIALPADTVLRNIIGMDKPLSLPGFLAKFDYMPVIAGCREAIKR
2pajA2          ------------------------------------------------PAWVNTHHHLFQSLLDERRFRL
2oodA1          ----------------------------------------------------------------------
2i9uA1          ----------------------------------------------------------------------
1onwA1          -LLQGAHLYAPEDRGICDVLVANGKIIAVPSDIVPNCTVVDLSGQILCPEILPGNDADLLVMTPELRRGK
1ymyA1          -ALTQGRIFTGHELDDHAVVIADGLIKSVCPVAELEIEQRSLNGAILSPTLAAGKVANLTAFTPDFKITK
2oofA1          ----------------------------------------------------------------------
2a3lA1          ----------------------------------------------------------------------
1k6wA1          -TIINARLP--GEEGLWQIHLQDGKISAIDAQSGVMENSLDAEQGLVIPLIILPAENGFDALRRQVPVRY
2gokA1          -LWRNAQLATLNPVENAVIAVRNGRIAFAGPESDLPDETTDCGGRWITLEAGKSADFAIWDIERPAELVY
1j6pA1          ----------------------------------------------------------------------
1gkrA1          VIVKNCRLVSSDGITEADILVKDGKVAAIDTSDVEASRTIDAGGKFVMPTLQVGSDA-------------
2r8cA1          FLFRNGALLDPDLLQGFEILIEDGFIREVSDKPISNAHVIDVKGKTIMPRIVP-GAH---ADVLVVDGNP
2icsA1          ----------------------------------------------------------------------
2i9uA2          ------------------------------------------------PGMNDLHAHAS---QYKNLGIG
2qs8A1          ----------------------------------------------------------------------
1m7jA1          -ILSGGTVIDGTPGRLADVGVRGDRIAAVGDLSASSRRRIDVAGKVVSP---------------------
1dpmA           -------------------------------------NTVRGPITISEAGFTLTHEHFLRAWPEFFGSRK
2pajA1          ----------------------------------------------------------------------
1m7jA2          ----------------------------------------------------------------------
1yixA1          --------------------------------------------------LVDSHCHL----DGLDYESL
2ftyA2          -------------------------------------------------GGIDAHVHVDEPLKLLGDVVD
2uz9A1          ----------------------------------------------------------------------
1v77A           ----------------------------------------------------------------------
2qs8A1          TLIHAGKLIDGKSQSRISIVIDGNIISDIKKSSNDFEDYIDLRDHTVLPSIESGKLA-------------


                         .         .         *         .         .         .         .:140
query           AINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPD
1o12A2          ---EXEEFLYSQGVTTFLATTVSTSLEKXKEILRKARDYILEN-PSTSLLGVHLEGPYISKEKKGAHSEK
1ymyA2          TLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKH--PNQALGLHLEGPWLNLVPNFVRKPD
1un7A2          TLDIMSSRLPEEGTTSFLATTITQEHGNISQALVNAREAEESSLLGAELLGIHLEGPFVSPKRAGAQPKE
1k6wA2          RAWQTLKWQIANGIQHVRTHVDVSDATL--TALKAMLEVKQEVAPWIDLQIVAFPQEGILSYPNGEALLE
1gkpA2          THETGSKAALMGGTTTYIEMCCPSRNDDALEGYQLWKSAEGNSYCDYTFHMAVSKFDEKTEGQLREIVAD
2p9bA2          TVKHNATTLLESGVTTIRTLGDVGYEVVTLRDQIDAGQIL--------GPRILASGPLXAIPEGHGAPLI
1gkpA1          ---VNNDYNGFEGFEIDGRPSVVTVRGKV-------------AVRDGQFVGEKGWGKLLRR---------
2oodA2          LLPWLQKSILAAGTTTCQAF-TSSSPVATEELFEEASRRNXRVIAGLTGIDRNAPAEFIDTPENFYRDSK
1m7jA3          ------------------------------------SGAIGISTGAFYPPAAHASTEEIIEVCRPLITHG
1un7A1          ----------------------------------------------------------------------
2ftyA1          KPKLITNKLMEHNCDYTPFEGIEIKN-----WPRYTIVKGKIVYKEGEILKENADGKYLKRGKSFMCTP-
1a5kC1          FFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHY-----------------------------------
2p9bA1          ----------------------------------------------------------------------
3be7A1          RT--------LEEVAFVMKEGKVYKRE-------------------------------------------
1xrfA1          WILNEETNLSKSRNTPLWGKVLKGKVIYTIKD--------------------------------------
2bb0A1          ----------------------------------------------------------------------
1a4lA           IAYEFVEMKAKEGVVYVEYSPHLLANSKVDPMPWNQTEGDVTPDDVVDLVNQGLQEGFGIKVRSILCCMR
2pajA2          AARIGLIELARSGCATVADHNYVYYPGMPFDSSAILFEEAEKLGLRF----VLLRGGATQTRQLEADLPT
2oodA1          ----------------------------------------------------------------------
2i9uA1          ----------------------------------------------------------------------
1onwA1          LMVKDGKACVKGTFET------------------------------------------------------
1ymyA1          TIVN------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
2a3lA1          ----------------------------------------------------------------------
1k6wA1          S--------VRGGKV-------------------------------------------------------
2gokA1          R-------IGFNPLHARI----------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2r8cA1          LKSVDCLLGQGEHIPLVMKDGRLFVNE-------------------------------------------
2icsA1          ----------------------------------------------------------------------
2i9uA2          MDKELLPWLNNYTFPEEAKFLNVDYAKKT--YGRLIKDLIKNGTTRVALLHKDSTIELFNKSGIGAYVGK
2qs8A1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1dpmA           ALAEKAVRGLRRARAAGVRTIVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWFDPPLSMRLRSVEELT
2pajA1          ----------------------------------------------------------------------
1m7jA2          ----------------------------------------------------------------------
1yixA1          H-KDVDDVLAKAAARDVKFCLA------VATTLPSYLHMRDLVGERDNVVFSCGVHP---LNQNDPYDVE
2ftyA2          TMEHATRSAVAGGTTTVVAFSTQDVSKKGPSALAESVKLDVDEYSEQTLYCDYGLHLILFQIEKPSVEAR
2uz9A1          ----------------------------------------------------------------------
1v77A           ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHA
1o12A2          HIRPPSERELSEI----DSPAKXLTFAPEIESS-ELLLRLVKRDIVLSAGHSIATFEEFXKFYKEGVKRI
1ymyA2          -------AALVDFLCENADVITKVTLAPEMVPA-EVISKLANAGIVVSAGHSNATLKEAKAGFRAGITFA
1un7A2          WIRPSDVELFKKWQQEAGGLIKIVTLAPEEDQHFELIRHLKDESIIASMGHTDADSALLSDAAKAGASHM
1k6wA2          EALRLGADVVGAIPHFEFTREYG------VESLHKTFALAQKYDRLIDVHCDEIDDEQSRFVETVAALAH
1gkpA2          GISSFXIFLSYKNFFGVDDGEMYQTLRENAELVGRLQQKLLSEGKTGPEWHEPSRPEAVEAEGTARFATF
2p9bA2          ALTSGTPEEARTAVAQNLKAGVNAIKIAATGGVTDAQEIQXSVEQXRAICDEAHQYGVIVGAHAQSPEGV
1gkpA1          ----------------------------------------------------------------------
2oodA2          RLIAQYHDKGRNLYAITPRFAFGASPELLKACQRLKHEHPDC-WVNTHISENPAECSGVLVEHPDCQDYL
1m7jA3          GVYATHM--RDEGEHIVQALEETFRIGREL-DVPVVISHHKVMGKLNFGKETLALIEAAMASQDVSLDAY
1un7A1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
1a4lA           HQPSWSLEVLELCKKYNQKTVVAMDLA--------------GDETIEGSSLFPGHVEAYEGAVKNGIHRT
2pajA2          ALRPETLDAYV----ADIERLAARYHDASPRAMRRVVMAPTTVLYSISPREMRETAAVARR---LGLRMH
2oodA1          ----------------------------------------------------------------------
2i9uA1          ----------------------------------------------------------------------
1onwA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
2a3lA1          ---------------------------------------------------------------MTTITLR
1k6wA1          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
2i9uA2          VNMDYNCPDYLTENYITSLNDTEEIILKYKDKSNIVKPIITPRVPSCSNELMDGLGKLSYKYRLPVQSHL
2qs8A1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1dpmA           QFFLREIQYGIEDTGGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRVCI
2pajA1          ----------------------------------------------------------------------
1m7jA2          ----------------------------------------------------------------------
1yixA1          DLRRLAAEEGVVALGEYYTPETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDCGGV
2ftyA2          EL---LDVQLQAAYNDY--------------GVSSVXMFMTYPGLQISDYDIMSAMYATRKNGFTTMLHA
2uz9A1          ----------------------------------------------------------------------
1v77A           ---------------EWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSN-------PKPSLVRDTVQ
2qs8A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           THLFNAMTPFTHREPGVVGAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGM
1o12A2          THFPNGLKPLHHREIGITGAGLLDDVKLELICDGVHLSREXVKLVYKVKKANGIVLVTDSISAAGLKDGT
1ymyA2          THLYNAMPYITGREPGLAGAILDEADIYGIIADGLHVDYANIRNAKRLKG-DKLCLVTDATAPAGANIEQ
1un7A2          THLYNAMSPFHHREPGVIGTALAHDFVTELIADGIHSHPLAAKLAFLAKGSSKLILITDSMRAKGLKDGV
1k6wA2          HEGMGARVTASHTTAMHSYNGAYTRLFRLLKMSGINFVANPLVNIHLQGRFDTPKRRGITRVKEMLESGI
1gkpA2          LETTGATGYVVHLSCKMAAKARGVPIYIESVIPHFLLDKTYAERGGVEAMKYIMSPPLWDALAQGFIDTV
2p9bA2          RRSLLAGVDTIEHGSVLDDELIGXFRHNNALRGYSALIPTLSAGLPLTLLGQDVTGITDIQLENSKNVVG
1gkpA1          ----------------------------------------------------------------------
2oodA2          GVYEKFDLVG-PKFSGGHGVYLSNNEFRRXSKKGAAVVFCPCSNLFLGSGLFRLATDPEHRVKXSFGTDG
1m7jA3          PYVA-GSTMLKQDRVLLAGRTLITWKPYPELSGRDLEEIAAERGKSKYDV-VPELQPAGAIYFMMDEPDV
1un7A1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
1a4lA           VHAGEVGSPEVVRE-----AVDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLTGAWDPKTT
2pajA2          SHLSGKSPVAFCGEHDWLGSDVWYAHLVKVDADEIALLAQTGTGVAHCPQSNGRLPVREMADAG------
2oodA1          ----------------------------------------------------------------------
2i9uA1          ----------------------------------------------------------------------
1onwA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
2a3lA1          PHSGEAGDIDHLAATFLTCH-------SIAHGINLRKSPVLQYLYYLAQIGLAMSPLSNNSLFLDYHRNP
1k6wA1          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
2i9uA2          SENLDEIAVVKSLHKKSNFYGEVYDKFGLFGNTPTLMAHCIHSSKE----EINLIKRNNVTIVHCPTSNF
2qs8A1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1dpmA           GHSDDTDDLSYLTALAARGYLLDHIPHSAIGLEDNASASALIKALIDQGYMKQILVSNDWLFGFSSYVTN
2pajA1          ----------------------------------------------------------------------
1m7jA2          ----------------------------------------------------------------------
1yixA1          LHCFT----------------EDRETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSP
2ftyA2          ----------------------------------------------------------------------
2uz9A1          ----------------------------------------------------------------------
1v77A           KFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYER
2qs8A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKE
1o12A2          TTLGDLVVKVKDGVPRLEDGTLAGSTLFFSQAVKNFRKFTGCSITELAKVSSYNSCVELGLDDR------
1ymyA2          FIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLG----
1un7A2          YEFGGQSVTVRGRTALLSDGTLAGSILKMNEGARHMREFTNCSWTDIANITSENAAKQLGIFDRKG----
1k6wA2          NVCFGHDDVFDPWYPLGTANMLQVLHMGLHVCQ----LMGYGQINDGLNLITHHSARTLNLQ--DYGIAA
1gkpA2          CPFDTEQKLLGKEAFTAIPNGIPAIEDRVNLLYTYGVSRGRLDIHRFVDAASTKAAKLFGLFPRKGTIAV
2p9bA2          GXVSGARQAHEAGLXIGVGGXTFVPQYATWRELELLVAYAGFSPAEALHAATAVNASILGVDAETG----
1gkpA1          ----------------------------------------------------------------------
2oodA2          NRFSXISVLDDAYKVGXCNNTLLDGSIDPSRKDLAEAERNKLSPYRGFWSVTLGGAEGLYIDDKLG----
1m7jA3          QRILAFGPTMIDGLPHDERPHPRLWGTFPRVLGHYSRDLGLFPLETAVWKMTGLTAAKFGLAER------
1un7A1          -----ESLLIKDIAIVTENEVIKNGYVGINDGKISTVST--ERPKEPYSKEIQAPADSVL----LPSVTV
2ftyA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
2p9bA1          -------EPFALAHATIVTGDKAGTILRNXTIV---VGADGRIEQVAPSIETSIPAEYHYLDGKIVXLEV
3be7A1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
2bb0A1          ------------------AGKSMQDLHVIEDAVVGIHEQKIVFAGQKGAEAGYEADEIIDCSGRLVTLKA
1a4lA           HAV--VRFKNDKANYSLNTDDPLIFKSTLDTDYQMTKKDMGFTE-EEFKRLNINAAKSSFLEEKKELLER
2pajA2          -------VPVSIGVDGAASNE-AADMISEVHMTWLAQRARLASIAEVIHWGTAGGARVMGLDE-------
2oodA1          ----FDFVDDPWK----HIGNEQAAARFHQDGLXVVTDGVIKFGPYEKIAAAHPGVEITHIKDRIIVFEP
2i9uA1          -------------------TKTSDKFTIMKDSYIV-VIDGKIASVSSNLPDKYKGNPIIDFRNNIIIFEE
1onwA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
2oofA1          ------------------TLRSDLADYGLLEPHALGVHE-GRIHALVPXQDLKYPAHWQDXKGKLVTLRV
2a3lA1          FPVFFLR-GLNVSLSTDDPLQIHLTKEPLVEEYSIAASVWKLSA-CDLCEIARNSVYQSGFSHALKSHWI
1k6wA1          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
1j6pA1          -------------------GNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLV-XPKIEE
1gkrA1          ----------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
2icsA1          -----------------------------DLLIKNGQTVNGXPVEIAIKEISGSAKETIHLEPGSATLEI
2i9uA2          NLGSGMMPYLNLGINVVLSDISAGHTCSLFKVIAYAIQNSKKWQESGKKDMFLSTSEAFYMATKKG----
2qs8A1          ------KTLIHAG--KLIDGKSDQVQSRISIVIDG--NIISDIKKGFISSNDFEDYIDLRDHTVLPSIES
1m7jA1          ----------------------------------------------------------------------
1dpmA           IMDVMD----RVNPD---------GMAFIPLRVIPFLREKGVPQETLAGITVTNPAR-------------
2pajA1          ---------IRNAAAIMTGG--RGTADDPSRVPGPDIRIVGDTIDAIGALAPRPGETIVDATDCVIYVAV
1m7jA2          -------------------------------------------------------------------VQP
1yixA1          YLAPVPHRGKENQPAMVRD------------VAEYMAVLKGVAVEELAQVTTDNFARLFHIDSRLQSIR-
2ftyA2          ----------------------------------------------------------------------
2uz9A1          -----------------------------------EWCFKPCEIREL--SHHEFFMFEVGKEFDAILINP
1v77A           ANLLRFMMKAWKLVERRFLTSEKWDVRYPRDLIS-LGVVIGMEIPQAKASISMYPEIILK----------
2qs8A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GYDADLILFDDNIDIKYVIVNGKLVHKA
1o12A2          ----------------------------
1ymyA2          ----------------------------
1un7A2          ----------------------------
1k6wA2          GNSAN-----------------------
1gkpA2          GSD-------------------------
2p9bA2          ----------------------------
1gkpA1          ----------------------------
2oodA2          ----------------------------
1m7jA3          ----------------------------
1un7A1          GKDADLVIVSSDCEVILTICRGNIAFIS
2ftyA1          ----------------------------
1a5kC1          ----------------------------
2p9bA1          GKSADLLVLNANPHPALVIAAGHPVWRP
3be7A1          ----------------------------
1xrfA1          ----------------------------
2bb0A1          GRSADLVIWQAPNHVHQVMKNGTIVVN-
1a4lA           LY--------------------------
2pajA2          ----------------------------
2oodA1          GKEADFVALDPNGGQLAQPWHQSLIG--
2i9uA1          GYDFDALVINDSNNIMKRYVCGNEI---
1onwA1          ----------------------------
1ymyA1          ----------------------------
2oofA1          GXLADFLVWNCGDQLVSRVVNGEET---
2a3lA1          GKDYYKRGPDGNPHIRVEFRDTIW----
1k6wA1          ----------------------------
2gokA1          ----------------------------
1j6pA1          GWNADLVVIDLDGEVFATXVAGKWIYF-
1gkrA1          ----------------------------
2r8cA1          ----------------------------
2icsA1          GKDADLTIFTIQIRPIKTIIGGQIYD--
2i9uA2          ----------------------------
2qs8A1          GKLADLIAVKGNENVDVVIKDGLLY---
1m7jA1          ----------------------------
1dpmA           ----------------------------
2pajA1          GYAADIAVYRLDDSVMALFSAGKRV---
1m7jA2          GYYADLVVFDPAAGIHSVYVNGAAVWE-
1yixA1          ----------------------------
2ftyA2          ----------------------------
2uz9A1          KASDSPIDLFYGDNIEEVYVGGKQVV--
1v77A           ----------------------------
2qs8A1          ----------------------------