[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81914.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s1mA1.bssp"
#ERROR : Can't open dsspfile "1s1mA2.bssp"
#ERROR : Can't open dsspfile "1j5sA.bssp"
#ERROR : Can't open dsspfile "1fp4B.bssp"
#ERROR : Can't open dsspfile "2oynA1.bssp"
#ERROR : Can't open dsspfile "1t3tA2.bssp"
#ERROR : Can't open dsspfile "1l9xA.bssp"
#ERROR : Can't open dsspfile "1fy2A.bssp"
#ERROR : Can't open dsspfile "1i1qB.bssp"
#ERROR : Can't open dsspfile "1wl8A1.bssp"
#ERROR : Can't open dsspfile "1gpmA2.bssp"
#ERROR : Can't open dsspfile "1aa7A.bssp"
#ERROR : Can't open dsspfile "1gpwB.bssp"
#ERROR : Can't open dsspfile "1o1yA.bssp"
#ERROR : Can't open dsspfile "1q7rA.bssp"
#ERROR : Can't open dsspfile "1qdlB.bssp"
#ERROR : Can't open dsspfile "1jvnA2.bssp"
#ERROR : Can't open dsspfile "1ei5A2.bssp"
#ERROR : Can't open dsspfile "1ka9H.bssp"
#ERROR : Can't open dsspfile "2ghrA1.bssp"
#ERROR : Can't open dsspfile "1sy7A1.bssp"
#ERROR : Can't open dsspfile "1j42A.bssp"
#ERROR : Can't open dsspfile "1a9xB2.bssp"
#ERROR : Can't open dsspfile "1suwA.bssp"
#ERROR : Can't open dsspfile "1q32A2.bssp"
#ERROR : Can't open dsspfile "2fexA1.bssp"
#ERROR : Can't open dsspfile "1g8mA2.bssp"
#ERROR : Can't open dsspfile "1g2iA.bssp"

## Summary of PDB Search
:535
    e-105  52%  1s1mA1 [c.23.16.1] CTP SYNTHASE A:287 -- 544
    1e-80  58%  1s1mA2 [c.37.1.10] CTP SYNTHASE A:1 -- 266
    9e-62  11%  1j5sA  [c.1.9.8] URONATE ISOMERASE
    5e-44  10%  1fp4B  [c.92.2.3] NITROGENASE MOLYBDENUM-IRON PROTEIN BETA CHAIN
    4e-33  18%  2oynA1 [b.43.5.2] HYPOTHETICAL PROTEIN MJ0056 A:1 -- 136
    2e-30  12%  1t3tA2 [c.23.16.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE
    9e-30  19%  1l9xA  [c.23.16.1] GAMMA-GLUTAMYL HYDROLASE
    4e-28  12%  1fy2A  [c.23.16.4] ASPARTYL DIPEPTIDASE
    4e-27  19%  1i1qB  [c.23.16.1] ANTHRANILATE SYNTHASE COMPONENT II
    4e-26  17%  1wl8A1 [c.23.16.1] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    8e-26  15%  1gpmA2 [c.23.16.1] GMP SYNTHETASE A:3 -- 207
    4e-24   9%  1aa7A  [a.95.1.1] INFLUENZA VIRUS MATRIX PROTEIN
    4e-24  17%  1gpwB  [c.23.16.1] AMIDOTRANSFERASE HISH
    4e-23  15%  1o1yA  [c.23.16.1] CONSERVED HYPOTHETICAL PROTEIN TM1158
    7e-23  21%  1q7rA  [c.23.16.1] PREDICTED AMIDOTRANSFERASE
    6e-22  15%  1qdlB  [c.23.16.1] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
    3e-20  23%  1jvnA2 [c.23.16.1] BIFUNCTIONAL HISTIDINE BIOSYNTHESIS PROTEIN A:-3
    8e-19  11%  1ei5A2 [b.61.3.1] D-AMINOPEPTIDASE A:418 -- 520
    2e-16  19%  1ka9H  [c.23.16.1] IMIDAZOLE GLYCEROL PHOSPHTATE SYNTHASE
    3e-15  15%  2ghrA1 [c.23.16.8] HOMOSERINE O-SUCCINYLTRANSFERASE A:17 -- 297
    5e-15  10%  1sy7A1 [c.23.16.3] CATALASE 1 A:553 -- 736
    3e-14  11%  1j42A  [c.23.16.2] RNA-BINDING PROTEIN REGULATORY SUBUNIT
    5e-09  26%  1a9xB2 [c.23.16.1] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL CHAIN)
    8e-07  25%  1suwA  [e.52.1.1] PROBABLE INORGANIC POLYPHOSPHATE/ATP-NAD KINASE
    1e-04  24%  1q32A2 [d.136.1.3] TYROSYL-DNA PHOSPHODIESTERASE A:302 -- 538
    2e-04  21%  2fexA1 [c.23.16.2] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 188
    4e-04  16%  1g8mA2 [c.97.1.4] AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE A:201 --
    0.001  31%  1g2iA  [c.23.16.2] PROTEASE I
:535

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSKNTKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFVTDDGAE
1s1mA1          ----------------------------------------------------------------------
1s1mA2          ----TNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
1j5sA           ----------------------------------------------------------------------
1fp4B           ------------------ACQPLGAVLCALGFEKTMPYVHGSQGCVAYFRSYFNRHFREPVSCVSDSMTE
2oynA1          ----VKLMIIEGEVVSGLGEGRYFLSLPPY---KEIFKKILGFEPYLNLKLDREFDINETEDFEFNGKRF
1t3tA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1fy2A           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1gpmA2          ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1ei5A2          -LDADLLLVSEGGAIYGAFEGFLGKSDMYPLYSVGSDVWLLPVQRSMD-----APSPGEWKLVFRRDDKG
1ka9H           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1sy7A1          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1a9xB2          ----------------------------------------------------------------------
1suwA           ----------------------------------------------------------------------
1q32A2          ----------------------------------------------------------------------
2fexA1          ----------------------------------------------------------------------
1g8mA2          ----------------------------------------------------------------------
1g2iA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TDLDLGHYERFIDENLTQNSNVTSGRVYWSVISKERKGEYLGGTVQVIPHITNAIKDRVHRVGKERDXXX
1s1mA1          ----------------------------------------------------------------------
1s1mA2          TDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKERRGDYLGATVQVIPHITNAIKERVLEGGEGHD--V
1j5sA           ----------------------------------------------------------------------
1fp4B           DAAVFGGQQNMKDGLQNCCMAEVIGDDLNAFINNSKKEGFIPDEFPVPFAHTPSFVGSHVTGSMDDKVVG
2oynA1          FGVKV----------LPIKILIGNKKIDGAIVVPKKTY-HSSEIIEIIAPMKLREQFNLK----------
1t3tA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1fy2A           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1gpmA2          ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1ei5A2          EITGLSVGCWLARGVEYRR---------------------------------------------------
1ka9H           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1sy7A1          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1a9xB2          ----------------------------------------------------------------------
1suwA           ----------------------------------------------------------------------
1q32A2          ----------------------------------------------------------------------
2fexA1          ----------------------------------------------------------------------
1g8mA2          ----------------------------------------------------------------------
1g2iA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXSLPFLEAIRQIKYDVGKENVCFIHVTLVPYLGKAGELKTKPTQHSVKELRSIGIQPD
1s1mA1          ----------------------------------------------------------------------
1s1mA2          VLVEIGGTVGDIESLPFLEAIRQMAVEIGREHTLFMHLTLVPYMAASGEVKTKPTQHSVKELLSIGIQPD
1j5sA           --------------------YVWELMRRCGVSEEYITGSRSNKEKWLALAKVFPRFVGNPTYEWIHLDFN
1fp4B           SNKKINIVPGFETYLGNFRVIKRMLSEMGVGYSLLSDPEEVLDTPADGQFRMYAGGTTQEEMKDAPNALN
2oynA1          ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1fy2A           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1gpmA2          ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1ei5A2          ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1sy7A1          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1a9xB2          ----------------------------------------------------------------------
1suwA           ----------------------------------------------------------------------
1q32A2          ---------------HYLCQTSSIGTSLSRENL-WTHL-MIPLFTGIMSPPILPTNSLINEYSQRKIKPY
2fexA1          ----------------------------------------------------------------------
1g8mA2          ----------------------------------------------------------------------
1g2iA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IIVCRSEKELSEDIKKKIGLFCNIDASEVIQNLDAEHLYAVPLMLHKEGLDRLVCEKLGLGCRDIDNAEW
1s1mA1          ----------------------------------------------------------------------
1s1mA2          ILICRSDRAVPANERAKIALFCNVPEKAVISLKDVDSIYKIPGLLKSQGLDDYICKRFSL----------
1j5sA           IKKVISEEEIWEETKKKQKLLRDMKVEILCTTDDPVSTLEHHRKAKEAVEGVTILPTWRPRAMNVDKEGW
1fp4B           TVLQPWHLEKTKKFVEGTWKHEVPKLNIPMGLDWTDEFLMKVSEISGQPIPASLTKERGRLVDMMT--DS
2oynA1          ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1fy2A           -------------------------------------------------------ELLLLSNSTLPGKAW
1i1qB           ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1gpmA2          ----------------------------------------------------------------------
1aa7A           --------------------------------------------------------------VETYVLSI
1gpwB           ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1ei5A2          ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1sy7A1          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1a9xB2          ----------------------------------------------------------------------
1suwA           ----------------------------------------------------------------------
1q32A2          II--------------------------------------------------------------------
2fexA1          ----------------------------------------------------------------------
1g8mA2          ------------------------------------------------SXKFKAGVKRAEVSNAIDQYVT
1g2iA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IDMVHRITHLTHTTKIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVD
1s1mA1          --------------TIGMVGKYIELPDAYKSVIEALKHGGLKNRVSVNIKLIDSQDVETRGV-EILKGLD
1s1mA2          ----------------------------------------------------------------------
1j5sA           REYVEKMGERY----GEDTSTLDGFLNALWKSHEHFKEHGC-VASDHALLEPSVYYVDENRARAVHEKAF
1fp4B           HTWLHGKRFALWGDPDFVMGLVKFLLELGCEPVHILCHNGNKRWKKAVDAILAAIGKDLWHLRSLVFTDK
2oynA1          ----------------------------------------------------------------------
1t3tA2          ----------GARPKVAVLREQGV--NSHVEMAAAFHRAG------FDAIDVHMSDLLGG--RIGLGNFH
1l9xA           -----IIGILMQKCRNKVMKNYGRYYIAA-SYVKYLESAGA----RVVPVRL---DLTEKDYEILFKSIN
1fy2A           LEIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGV----NVTGIHRVADP------LAAIEKAE
1i1qB           ----------------------ILLLDNIDSFTWNLADQLRTNGHNVVIYRNHIPAQTLID-RLATMKNP
1wl8A1          ----------------------IVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMN-----PK
1gpmA2          -----------HKHRILIL-------DFGSQYTQLVARRVRELGVYCELWAWDVTEAQIR-----DFNPS
1aa7A           IPSGPLKAEIAQRLEDVFAGKNTDL-----EVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQR--R
1gpwB           --------------RIGIISVGP---GNIMNLYRGVKRASE----NFEDVSIELVE------SPRNDLYD
1o1yA           -----------HHVRVLAIRHVEI--EDLGXXEDIFREKNW----SFDYLDTPKGEKLERPLEELLGGYX
1q7rA           --------YFQSNXKIGVLG----LQGAVREHVRAIEACG------AEAVIVKK--------SEQLEGLD
1qdlB           --------------------DLTLIIDNYDSFVYNIAQIVGEL--GSYPIVIRNDEISIKGIERI--DPD
1jvnA2          ----------SHMPVVHVISGNLQ------SLTNAIEHLG------YEVQLVKSPK------DFNISGTS
1ei5A2          ----------------------------------------------------------------------
1ka9H           ---------------------------------------GSGNLRSAALEAAGFSVAVAQDPKAHE-EAD
2ghrA1          --------------KIAILNLXPTKQETEAQLLRLIGNTPL----QLDVHLLHXESSFYKTFRDIENKFD
1sy7A1          ----------------------------------GPRRSKVTAANGSTVQPHHHLE------GFRSTMVD
1j42A           ------------SKRALILAKGAEEME-TVIPVDVMRRAGIKVTVDPVQCSRDVVICPDASLEDAKGPYD
1a9xB2          ---------------------------------------------------TSAEDVLKMNPD-------
1suwA           --------------RAAVVYKT----DGHVRIEEALKR-------------LEVEVELFNQPSEELENFD
1q32A2          ----------------------------------------------------------------------
2fexA1          --------------------------------------GGLKVTPDTSYDALDPVDI------------D
1g8mA2          GTIGEDEDLVKWQAXFEEVPA--QLTEAEKKQWIAKLTA-------VSLSSDA-FFPFRDNVDRAKIGVQ
1g2iA           -------------------------------------------------------DLTFDKVN--PEEFD


                         .         .         .         .         *         .         .:420
query           GVLVPGGFGDRGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDL
1s1mA1          AILVPGGFGYRGVEGMITTARFARENNIPYLGICLGMQVALIDYARHVANMENANSTEFVPDCKYPVVAL
1s1mA2          ----------------------------------------------------------------------
1j5sA           SGEKLTQDEINDYKAFMMGKMNQETNWVTQLHIGALRDYRDSLFKTLGPDS-GGDISTNFLRIAEGLRYF
1fp4B           PDFMIGNSYGKFIQRDTLH--KGKEFEVPLIRIGFPIFDRHHLHRSTTLGYEGAMQILTTLVN--SILER
2oynA1          ----------------------------------------------------------------------
1t3tA2          ALVACGGFSYGDVLGAGEGETFFHRPQTLALGVXNGCQMMSNLRELIPGSELWPRFVRNHSDRFEARFSL
1l9xA           GILFPGGSVDAKIFYNLSIQSFDDGDYFPVWGTCLGFEELSLLISGEC-----------LLTATDTVDVA
1fy2A           IIIVGGGNTFQLLKGLLAPMADRVKRGALYIGWSAGANLACPTIR-------TTNDMPIVDPNGFDALDL
1i1qB           VLMLSPGPGVPSEAGCMPELLTRLRGKLPIIGICLGHQAIVEAYGGYVGQILHGKATSIEHDGQAMFAGL
1wl8A1          GIIFSGGPSLENTGNCEKVLEHYDEFNVPILGICLGHQLIAKFFGGKV----------------------
1gpmA2          GIILSGGPESTTEENSPRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEASN-------EREFGYAQVEV
1aa7A           RFVQNALNGNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVT-------------
1gpwB           LLFIPGVGHFLRENDLIDFVRKHVEDERYVVGVCLGMQLLFEESEEAP----------------------
1o1yA           GAYEEEK--YPFLKYEFQLIEEILKKEIPFLGIXLGSQXLAKVLGAS-----------------------
1q7rA           GLVLPGGESTIDRYGLXEPLKQFAAAGKPXFGTCAGLILLAKRIVGYD----------------EPHLGL
1qdlB           RLIISPGPEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNI--------
1jvnA2          RLILPGVGNYGHFRGFEKPIREYIESGKPIMGIXVGLQALFAG------SVESPKSTGLN-YIDFKLSRF
1ei5A2          ----------------------------------------------------------------------
1ka9H           LLVLPGQGHFGQVSGFVERVRRHLERGLPFLGICVGMQ-VLYEGSEEAPGVRGLG--------LVPGEVR
2ghrA1          GLIITGAFEEVDYWEELKRIEYSKTNVTSTLHICWGAQAGLYHHYGVQKYPLKEKXFGV-----FEHEVR
1sy7A1          AIFIPGGAKASKNGRALHWIREAFGHLKAIGATGEAVDLVAKAIALPQSSEAEVHESYGVVTLKKVKPES
1j42A           VVVLPGGNLGSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGCGSKVTTHPLAKDKMMNGGHYT--
1a9xB2          GIFLSNGPGDPAPCDYITAIQKFLETDIPVFGIXLGHQLLALASGAKTVKMKFGHHGGNHP---------
1suwA           FIVSVGGDG-----TILRILQKLK-RCPPIFGINTGRV--------------------------------
1q32A2          ----------------------------------------------------------------------
2fexA1          ALVIPGGLSKGTAADLGGLVKRFRDRDRLVAGICAAAS--------------------------------
1g8mA2          FIVAPSG----SAADE-VVIEACNELGITLI---------------------------------------
1g2iA           ALVLPGGRAVRLNEKAVSIARKXFSEGKPVASICHGPQ--------------------------------


                         .         .         +         .         .         .         .:490
query           MPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDG
1s1mA1          ITEWRDENGNVETMRLGAQQCQLVDDSLVRQLYNAPTIVERHRHRYEVNNMLLKQIEDAGLRVAGRSGDD
1s1mA2          ----------------------------------------------------------------------
1j5sA           LNEFDGKLKIVLYVPTISTIARAFPNVY----VGAPWWFNDSPFGMEMHLKYLASVDLLYNLA-GMVTDS
1fp4B           LDEETRGM--QATDY-------------------------------------------------------
2oynA1          ----------------------------------------------------------------------
1t3tA2          VEVTQSPSLLLQGMVGSQMPIAVSHGEGRVEVRDDAHLAALESKGLVALRYVDNFGKVTETYPANPNGSP
1l9xA           MPLNFTGGQLHSRM------FQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKKFFNVLTTNTDG
1fy2A           FP----------------LQINPHFTNTREQRIRELLVVAPELTVIGLPE------------GNWIQVSN
1i1qB           ANP----------------------------------LPVARYHSSNVPAGLTINAHFNG----------
1wl8A1          --------GRGEKAEYSLVEIEIIDEEIFKGLPKRLKVWESHMDEVKELPPKFKIL---------ARSET
1gpmA2          VNDSALVRGIEDALTADGKPL----------------LDVWMSHGDKVTA------IPSDFITVASTESC
1aa7A           ----------------------------------------------------------------------
1gpwB           --------GVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDG
1o1yA           ------VYRGKNGEEIGWYFVEVSDNKFFREFPDRLRVFQWHGDTFDLPRRATRVFTSEKYENQGF----
1q7rA           XDITVERNSFGRQRESFEAELSIKGVGDGFVGV--------------FIRAPHIVEAGDGVDVLATYNDR
1qdlB           ----ILVNNSPLSLYYGIAKE----------------FKATRYHSLVVDEV------HRPLIVDAISAED
1jvnA2          DDSEKPVPEIGWNSC-------IPSENLFFGLDPYKRYYFVHSFAAILNSEKKKNLENDGWKIAKAKYGS
1ei5A2          ----------------------------------------------------------------------
1ka9H           RFRAGRVPQMGWNALEFGGAFAPLTGRHF---------YFANSYYGPLTPYSLGKGEYEGTPFTALLAKE
2ghrA1          EQHVKLLQGFD------------------------ELFFAPHSRHTEVRESDIREV--KELTLLANSEEA
1sy7A1          FTDAVKIAAAGFLGEFFYAIAQHRNWDRELDGLH-----SMIAY--------------------------
1j42A           ----------------------------------------------------------------------
1a9xB2          ------VKDVE------------KNVVMITAQNHGFAVDEAT--------------LPANLRVTHKSLFD
1suwA           ----------------------------------------------------------------------
1q32A2          ----------------------------------------------------------------------
2fexA1          ----------------------------------------------------------------------
1g8mA2          ----------------------------------------------------------------------
1g2iA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFVGAALNNK
1s1mA1          QLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAASEFQ
1s1mA2          ---------------------------------------------
1j5sA           RKLL-SFGSRTEMFVLSNVVGEMVEKGQIPIKEARELVKHVS---
1fp4B           ---------------------------------------------
2oynA1          ---------------------------------------------
1t3tA2          NGITAVTTENGRVT-IMMPHPERVFRTVANSWHPENWGEDS----
1l9xA           KIISTMEGYKYPVY-GVQWHPEKAPYEWKNLDGISHAPNA-----
1fy2A           GQAVLGGPNTTWVF-KAGEEAVALEAGHR----------------
1i1qB           -MVMAVRHDADRVC-GFQFHPESILTTQG-ARLLEQTLAWA----
1wl8A1          XPIEAMKHEELPIY-GVQFHPEVAHTEKG-EEILRNFAKLC----
1gpmA2          P-FAIMANEEKRFY-GVQFHPEVTHTRQG-MRMLERFVRDICQCE
1aa7A           ---------------------------------------------
1gpwB           E-IFPSAVRKGRIL-GFQFHPEKSSKI--GRKLLEKVIECSLS--
1o1yA           ---------VYGKAVGLQFHIEVGART--XKRWIEAYKDELEKKK
1q7rA           ----IVAARQGQFL-GCSFHPELTDDH-RLXQYFLNXVKEA----
1qdlB           NEIMAIHHEEYPIY-GVQFHPESVGTSL-GYKILYNFL-------
1jvnA2          EEFIAAVNKNN--IFATQFHPEK----------------------
1ei5A2          ---------------------------------------------
1ka9H           N------------LLAPQFHPEKSGKAG--LAFLALAR-------
2ghrA1          G-VHLVIGQEGRQV-FALGHSE-----------------------
1sy7A1          ---------------------------------------------
1j42A           ---------------------------------------------
1a9xB2          GTLQGIHRTDKPAF-SFQGNPEASPGPHDAAPLFDHFI-------
1suwA           ---------------------------------------------
1q32A2          ---------------------------------------------
2fexA1          ---------------------------------------------
1g8mA2          ---------------------------------------------
1g2iA           ---------------------------------------------