[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB82028.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1evkA2.bssp"
#ERROR : Can't open dsspfile "1atiA2.bssp"
#ERROR : Can't open dsspfile "1nyqA3.bssp"
#ERROR : Can't open dsspfile "1serA2.bssp"
#ERROR : Can't open dsspfile "1wu7A2.bssp"
#ERROR : Can't open dsspfile "1adjA2.bssp"
#ERROR : Can't open dsspfile "1v4pA.bssp"
#ERROR : Can't open dsspfile "1asyA2.bssp"
#ERROR : Can't open dsspfile "1r8gA.bssp"
#ERROR : Can't open dsspfile "1h4qA2.bssp"
#ERROR : Can't open dsspfile "1b70A.bssp"
#ERROR : Can't open dsspfile "1o6dA.bssp"
#ERROR : Can't open dsspfile "1evkA1.bssp"
#ERROR : Can't open dsspfile "1usyA.bssp"
#ERROR : Can't open dsspfile "1n4kA1.bssp"
#ERROR : Can't open dsspfile "1atiA1.bssp"
#ERROR : Can't open dsspfile "1httA1.bssp"
#ERROR : Can't open dsspfile "1adjA1.bssp"
#ERROR : Can't open dsspfile "1z7mA1.bssp"
#ERROR : Can't open dsspfile "1g5hA1.bssp"
#ERROR : Can't open dsspfile "1h4qA1.bssp"
#ERROR : Can't open dsspfile "1wu7A1.bssp"
#ERROR : Can't open dsspfile "1qe0A1.bssp"
#ERROR : Can't open dsspfile "1gc5A.bssp"
#ERROR : Can't open dsspfile "1c0aA3.bssp"
#ERROR : Can't open dsspfile "1v95A.bssp"
#ERROR : Can't open dsspfile "1nyqA2.bssp"
#ERROR : Can't open dsspfile "1qf6A2.bssp"
#ERROR : Can't open dsspfile "1k8kD1.bssp"
#ERROR : Can't open dsspfile "1rwsA.bssp"
#ERROR : Can't open dsspfile "1gw6A1.bssp"
#ERROR : Can't open dsspfile "1go3F.bssp"
#ERROR : Can't open dsspfile "1vjkA.bssp"

## Summary of PDB Search
:643
    1e-92  37%  1evkA2 [d.104.1.1] THREONYL-TRNA SYNTHETASE A:242 -- 532
    4e-41  19%  1atiA2 [d.104.1.1] GLYCYL-TRNA SYNTHETASE A:1 -- 394
    7e-39  39%  1nyqA3 [d.67.1.1] THREONYL-TRNA SYNTHETASE 1 A:63 -- 241
    5e-37  22%  1serA2 [d.104.1.1] PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))
    4e-34  12%  1wu7A2 [d.104.1.1] HISTIDYL-TRNA SYNTHETASE A:3 -- 329
    4e-30  17%  1adjA2 [d.104.1.1] HISTIDYL-TRNA SYNTHETASE A:2 -- 325
    2e-29  16%  1v4pA  [d.67.1.2] ALANYL-TRNA SYNTHETASE
    2e-28   9%  1asyA2 [d.104.1.1] ASPARTYL-TRNA SYNTHETASE A:205 -- 557
    2e-27   9%  1r8gA  [d.128.1.3] HYPOTHETICAL PROTEIN YBDK
    3e-26  17%  1h4qA2 [d.104.1.1] PROLYL-TRNA SYNTHETASE A:5 -- 276
    6e-26  16%  1b70A  [d.104.1.1] PHENYLALANYL-TRNA SYNTHETASE
    1e-24  10%  1o6dA  [c.116.1.3] HYPOTHETICAL UPF0247 PROTEIN TM0844
    5e-23  38%  1evkA1 [c.51.1.1] THREONYL-TRNA SYNTHETASE A:533 -- 642
    9e-23   8%  1usyA  [d.104.1.1] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    2e-20   7%  1n4kA1 [a.118.22.1] INOSITOL 1,4,5-TRISPHOSPHATE RECEPTOR TYPE 1
    1e-19  19%  1atiA1 [c.51.1.1] GLYCYL-TRNA SYNTHETASE A:395 -- 505
    1e-19  14%  1httA1 [c.51.1.1] HISTIDYL-TRNA SYNTHETASE A:326 -- 424
    2e-19  14%  1adjA1 [c.51.1.1] HISTIDYL-TRNA SYNTHETASE A:326 -- 421
    2e-19  11%  1z7mA1 [d.104.1.1] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    3e-19  12%  1g5hA1 [c.51.1.1] MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT
    5e-18  28%  1h4qA1 [c.51.1.1] PROLYL-TRNA SYNTHETASE A:277 -- 403
    5e-18  12%  1wu7A1 [c.51.1.1] HISTIDYL-TRNA SYNTHETASE A:330 -- 426
    1e-17  18%  1qe0A1 [c.51.1.1] HISTIDYL-TRNA SYNTHETASE A:326 -- 420
    2e-17   6%  1gc5A  [c.72.1.3] ADP-DEPENDENT GLUCOKINASE
    3e-17  13%  1c0aA3 [d.104.1.1] ASPARTYL TRNA SYNTHETASE A:107 -- 287 A:421 --
    1e-16  13%  1v95A  [c.51.1.1] NUCLEAR RECEPTOR COACTIVATOR 5
    2e-14  41%  1nyqA2 [d.15.10.1] THREONYL-TRNA SYNTHETASE 1 A:4 -- 62
    3e-10  34%  1qf6A2 [d.15.10.1] THREONYL-TRNA SYNTHETASE A:2 -- 62
    4e-10   8%  1k8kD1 [d.198.2.1] ARP2/3 COMPLEX 34 KDA SUBUNIT D:1 -- 120
    3e-08  17%  1rwsA  [d.15.3.2] HYPOTHETICAL PROTEIN PF1061
    1e-06  11%  1gw6A1 [a.118.1.7] LEUKOTRIENE A-4 HYDROLASE A:461 -- 610
    6e-06  13%  1go3F  [a.60.8.2] DNA-DIRECTED RNA POLYMERASE SUBUNIT F
    4e-04  14%  1vjkA  [d.15.3.1] MOLYBDOPTERIN CONVERTING FACTOR, SUBUNIT 1
:643

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTFDSKEGQHA
1evkA2          ----------------------------------------------------------------------
1atiA2          ----------------------------------------------------------------------
1nyqA3          ------------------------------------------------------------TPGSEEALEV
1serA2          ----------------------------------------------------------------------
1wu7A2          ----------------------------------------------------------------------
1adjA2          ----------------------------------------------------------------------
1v4pA           ------------------------------------------------------------------SIEV
1asyA2          ----------------------------------------------------------------------
1r8gA           ----------------------------------------------------------------------
1h4qA2          ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
1o6dA           ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1usyA           ----------------------------------------------------------------------
1n4kA1          ----------------------------------------------------------------------
1atiA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1z7mA1          ----------------------------------------------------------------------
1g5hA1          ----------------------------------------------------------------------
1h4qA1          ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1gc5A           ----------------------------------------------------------------------
1c0aA3          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1nyqA2          -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEI-----------
1qf6A2          ---ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIIT---------
1k8kD1          ----------------------------------------------------------------------
1rwsA           VKVIGRNIEKEIEWREGMKVRDILRAVGFNTESAIA--KVNGKVVLEDDEVKDGDFVEVIPV--------
1gw6A1          ----------------------------------------------------------------------
1go3F           ----------------------------------------------------------------------
1vjkA           -EEIELPEGAIEEIKKRHEKFKEEVFGEGYDEDADVNIAVNGRYVSWDEELKDGDVVGV-----------


                         .         .         *         .         .         .         .:140
query           FNHTASHVLAAAVKRLFPQDKLAIGPSIDNGFYYDFDTEKPFSADQLNXXXXXXXXXXXXXXXXXRFELP
1evkA2          ----------------------------------------------------------------------
1atiA2          ----------------------------------------------------------------------
1nyqA3          LRHSTAHLMAHAIKRLYGNVKFGVGPVIEGGFYYDFDIDQNISSDDFEQIEKTMKQIVNENMKIERKVVS
1serA2          ----------------------------------------------------------------------
1wu7A2          ----------------------------------------------------------------------
1adjA2          ----------------------------------------------------------------------
1v4pA           RTHSALHVVKGAVVKVLGSEKWTYSTYVKGNGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELP
1asyA2          ----------------------------------------------------------------------
1r8gA           ----------------------------------------------------------------------
1h4qA2          ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
1o6dA           ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1usyA           ----------------------------------------------------------------------
1n4kA1          ----------------------------------------------------------------------
1atiA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1z7mA1          ----------------------------------------------------------------------
1g5hA1          ----------------------------------------------------------------------
1h4qA1          ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1gc5A           ----------------------------------------------------------------------
1c0aA3          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1nyqA2          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1k8kD1          ------LLEVNIIEETLALKFENAAGNKPEAVEVTFADFDGVL-YHI---SNPNGDKTKVMVSISLKFYK
1rwsA           ----------------------------------------------------------------------
1gw6A1          ----------------------------------------------------------------------
1go3F           ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RNEALELMKDEPYKVELINDLPEGEVISFYQIGDFVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEKNK
1evkA2          ----------------------------------------------------------------------
1atiA2          ----------------------------------------------------------------------
1nyqA3          RDEAKELFSNDEYKLELIDAIPEDENVTLYSQGDFTDLCRGVHVPSTAKIKEFKLLSTAGAYWRGDSNNK
1serA2          ----------------------------------------------------------------GEEANR
1wu7A2          ----------------------------------------------------------------------
1adjA2          ----------------------------------------------------------------------
1v4pA           REEAEKMFGEDMYDLFPVPE-DVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKG-----
1asyA2          ----------------------------------------------------------------------
1r8gA           ----------------------------------------------------------------------
1h4qA2          ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
1o6dA           ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1usyA           ----------------------------------------------------------------------
1n4kA1          ----------------------------------------------------------------------
1atiA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1z7mA1          ----------------------------------------------------------------------
1g5hA1          ----------------------------------------------------------------------
1h4qA1          ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1gc5A           ----------------------------------------------------------------------
1c0aA3          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1nyqA2          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1k8kD1          ELQAHGADEKRVYGSYLVNPESGYNVSLLY----DLENLPASKDSIVHQAGMLK----------------
1rwsA           ----------------------------------------------------------------------
1gw6A1          ----------------------------------------------------------------------
1go3F           ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIE
1evkA2          ----------------------------RDHRKIGKQLDLYHMQEE-APGMVFWHNDGWTIFRELEVFVR
1atiA2          ------------------------------------------------QGVYDYGPLGVELKNNLKQAWW
1nyqA3          MLQRIYGTAFFDKKELKAHLQMLEERKER-----------------------------------------
1serA2          EIKRVGGPPEF-------------SFPPLDHVALMEKNGWWEISQVSGSRSYALKGDLALYELALLRFAM
1wu7A2          -------------------------------------------------GFRDFYPEDXDVEKFIFKTAE
1adjA2          -------------------------------------------------GTKDLFGKELRMHQRIVATAR
1v4pA           -LLEIHFELL------------------------------------------------------------
1asyA2          -----------------------------GLPVVNLDTRLDYR---VIDLRTVTNQAIFRIQAGVCELFR
1r8gA           ----------------------------------------------------------------------
1h4qA2          -----------------------------WYLEVIQKAELA--DYGPVRGTIVVRPYGYAIWENIQQVLD
1b70A           -------------------------------------------------GASLFSGGL-HPITLMERELV
1o6dA           ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1usyA           --------------------------------------------------------------------FY
1n4kA1          -----------------------------------------------EVRDLDFANDASKVLGSIAGKLE
1atiA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1z7mA1          ----------------------------------------------LPEESAEMTLNQVKSLRQIEGRLR
1g5hA1          ----------------------------------------------------------------------
1h4qA1          ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1gc5A           ------------------------------------------------------PKDAIAEEEELIHYIY
1c0aA3          ------------------------------------------------------MAQRLKTRAKITSLVR
1v95A           ----------------------------------------------------------------------
1nyqA2          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1gw6A1          ----------------------------------------------------------------------
1go3F           ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYR
1evkA2          SKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTSSENRE---YCIKPMNCPGHVQIFNQGLKSYR
1atiA2          RRNERDDMEGLDASVLTHRLVLHYSGHEATFADPMVNWTPPRYFNMMFQLRPETAQGIFVNFNVLDATSR
1nyqA3          ----------------------------------------------------------------------
1serA2          DFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAE-----TDLYLTGTAEVVLNALHSGEILPYE
1wu7A2          EAAEAFGFRRIDFPSLEYLDLYRIKSGEELLQQTYSFV---DKGGREVTLIPEATPSTVRXV--TSRKDL
1adjA2          KVLEAAGALELVTPIFEETQVFGVGAATDIVRKEMFTFQDRGG--RSLTLRPEGTAAMVRAYLEHGMKVW
1v4pA           ----------------------------------------------------------------------
1asyA2          EYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGK-----------AYLAQSPQFNK-------QQLIV
1r8gA           ----------------------------------------------------------------------
1h4qA2          RMFKETGHQNAYFPLFIPMSFLRFSPELAVVTHAGGEELEEP-----LAVRPTSETVIGYMWSKWIRSWR
1b70A           EIFRALGYQAVEGPEVESEFLNIPEHHPARDMWDTFWLTGEEEVEGRLLLRTHTSPMQVRYM-----VAH
1o6dA           ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1usyA           SKATKKGFSPFFVPALEKAEEPAGNFFLDR-------------KGNLFSIREDFTK---TVLNHRKRYSP
1n4kA1          KGTITQNERRSVTKLLEDLVYFVTGGSGQDVLEVVFSKPNRERQ---KLMREQNILKQIFKLLQAPFTHA
1atiA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1z7mA1          KLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFT---LPLVRLYSQIKD
1g5hA1          ----------------------------------------------------------------------
1h4qA1          ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1gc5A           EFPRGFQVFDVQAPRENRFIANADDYNARVYMRREFRE-----GFEEITRNVELAI----------ISGL
1c0aA3          RFMDDHGFLDIETPML--------TKATPEGARDYLVPSRVHKG------KFYALPQSPQLF--KQLLMM
1v95A           ----------------------------------------------------------------------
1nyqA2          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1gw6A1          -------------ACIALSQRWITAKEDDLNSHQLNEFLAQTLQR--APLPLGHIKRMQEVYNFNAINNS
1go3F           ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITY
1evkA2          DLPLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGF-EKIVV
1atiA2          KLGFGIAQIGKAFRNEITPR-NFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGL-SRENL
1nyqA3          ----------------------------------------------------------------------
1serA2          ALPLRYAGYAPAFRSEAGSFGKGLMRVHQFHKVEQYVLTSLEASDRAFQELLENAEEILRLLEL-PYRLV
1wu7A2          QRPLRWYSFPKVWRYEEP----QAGRYREHYQFNADIFGSDS--PEADAEVIALASSILDRLGLQDIYEI
1adjA2          PQPVRLWMAGPMFRAERPQKGR----YRQFHQVNYEALGSEN--PILDAEAVVLLYECLKELGL-RRLKV
1v4pA           ----------------------------------------------------------------------
1asyA2          ADFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIEKQY
1r8gA           ---------------VSEPFTLGIELEXQVNPPGYDLSQDSSXLIDAVKNKITAGEVKHDITESXLELAT
1h4qA2          DLPQLLNQWGNVVRWEMR--TRPFLRTSEFLWQEGHTAATREEAEEEVRRMLSIYARLAREYAAIPVIEG
1b70A           TPPFRIVVPGRVFRFEQTDATH----EAVFHQLEGLVVGEGIAMAHLKGAIYELAQALF-----GPDSKV
1o6dA           ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1usyA           DSQIKVWYADFVYRYSGS-------DLVAEYQLGLEKVPRNSLDDSL--EVLEIIVESASEFFE-GPVIV
1n4kA1          PFRHICRLCYRVLRHSQQ----DYRKNQEYIAKQFGFMQ--KQIGYDVLAEDTITALL------------
1atiA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1z7mA1          STSARYSYFGKIFRKE-----------KENYQIGIELFGESA--DKSELEILSLALQVIEQLGL-NKTVF
1g5hA1          ----------------------------------------------------------------------
1h4qA1          ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1gc5A           QVLKEYYPDGTTYKDVLDRVESHLNINRYNVKSHFEFATANRRVREALV---ELLPKFTSVGLNEVELAS
1c0aA3          SGFDRYYQIVKCFRDEDLRADR----QPEFTQIDVETSMTAPQVREVMEALVRHLWLEVKGVDLGDVMTF
1v95A           ----------------------------------------------------------------------
1nyqA2          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1gw6A1          EIRFRWLRLCIQSKWEDAIPLALKMATEQGRMSHDQAVRTYQEHKASMHPVTA--MLVGKDLKV------
1go3F           ------------------------MIGKKILGERYVTVSEAAEIMYNRAQIGELSYEQGCAL----DYLQ
1vjkA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           RFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQ
1evkA2          KLST----RPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQ
1atiA2          VPYQQPPESSAHYAKDILYRFPHG--SLEL-------------EGIAQRTDFDLG-SHTKDQEALGITAR
1nyqA3          ----------------------------------------------------------------------
1serA2          EVATGDMGPGKWRQVDIEVYLPSEGRYRET-----------------------------------HSCSA
1wu7A2          RIN-SRKIXEEIIGGXTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSXIADLCSGTRGIDEXA
1adjA2          KLS--SVGDPEDRARYNAYLREVLSPHREALSEDSSERDQALLKELGVRPMLDFLGEEARAHLKEVERHL
1v4pA           ----------------------------------------------------------------------
1asyA2          PEFKLPKDGKMVRLTYKEGIAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYTMPDP
1r8gA           D-------VCRDINQAAGQFSAXQKVVLQAATDHHLEI------CGGGTHPFQKWNFGYLIQQATVFGQH
1h4qA2          LKTEKEKFAGAVYTTTIEAL-----------------------------------MKDGKALQAG-TSHY
1b70A           RFQPVYFPFVEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYRGVTGFAFGLGVER
1o6dA           ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1usyA           EIGHTGVYEDL----LKEIPKDLHEKVLNLIDTKNAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKT
1n4kA1          ----------------------------------------------------------------------
1atiA1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1z7mA1          EIGSAKFFQRLCQLADGSTELLTELLLKKDLSGL-NAFIEKNNF--------------------------
1g5hA1          ----------------------------------------------------------------------
1h4qA1          ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1gc5A           IMEIIGEELAKEVLEGHIFSVIDAMNVLMDETGIERIHFHTYGYYLA-----------------------
1c0aA3          AEAERRYGSDKPDLRDESKWAPLWVIDFPMFED-DGEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAY
1v95A           ----------------------------------------------------------------------
1nyqA2          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1gw6A1          ----------------------------------------------------------------------
1go3F           KFAKLDKEEAKKLVEELISLGIDEKTAVKIADILPEDLDD------------------------------
1vjkA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           IDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALPTWIAPVQAKVLPLSDKYADY
1evkA2          LDFSLPSRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFAG-----------------------
1atiA2          VLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAF-------------------------
1nyqA3          ----------------------------------------------------------------------
1serA2          LLDWQARRANLRYRDPEGRVRYAYTLNN-TALATPRILAMLLENHQLQDGRVRVPGKEVLEP--------
1wu7A2          RITDLLASYGVKNVRYDFSIVRGLSYYTGIVFEAYDRSGQFRAILGGGRYDNLASLXSGESVPAVGFGXG
1adjA2          ERLSVPYELEPYYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGV------------------
1v4pA           ----------------------------------------------------------------------
1asyA2          ANPKYSEILSGAQRIHDHALLQERMKAHGLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKN
1r8gA           VHVGCASGDDAIYLLHGLSRFVPHFIALS--AASPYXQGTDTRFASSRPNIFSAFPDNGPXPWVSNWQQF
1h4qA2          LGENFARAFDIKFQD---RDLQVKYVHTTSWGLSWRFIGAIIMTHGD-----------------------
1b70A           LAM----------------LRYGIPDIRYFFGGRLKFLEQFKGVL-------------------------
1o6dA           -------------------------VRIAVIGKLDGFIKEGIKHYEKFLRRFCKPEVLEIKRVHRGSIEE
1evkA1          ------------------------------------------------FPTWLAPVQVVIMNITDSQSEY
1usyA           MDLPLSVRLSASSFLQEKFPTVSVEIDLTLARTIEEYCGLIFTIYDTSSSRLVA----------------
1n4kA1          ----------------------------------------------------------------------
1atiA1          ----------------------------------------------------LAPIKVAVIPLVKNITEY
1httA1          ------------------------------------------------------VVDIYLVASGADTQSA
1adjA1          ------------------------------------------------------GPDLYLIPLTEEAVAE
1z7mA1          ----------------------------------------------------------------------
1g5hA1          ------------------------------------------------LHPCLAPIKVALDVGTVELRQV
1h4qA1          ------------------------------------------------LPPRLAPIQVVIVPIYKDELEA
1wu7A1          ------------------------------------------------------KKSVYICRVGKINSSI
1qe0A1          ----------------------------------------------------EENLDLFIVTMGDQADRY
1gc5A           ----------------------------------------------------------------------
1c0aA3          DMVINGYEVGGGSVNGDMQQTVFGILGINEEEQREKFGFLLDALKYGTPPHA------------------
1v95A           -------------------------------------------------SGSSGPVDCSVIVVNKQTKDY
1nyqA2          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1gw6A1          ----------------------------------------------------------------------
1go3F           ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ANXXXXXXXXXXXXXXADHRAEKIGYKIREARLERTPYILVVGEKEAENKEVSVRSRKNGEEGAMPLADF
1evkA2          ----------------------------------------------------------------------
1atiA2          ----------------------------------------------------------------------
1nyqA3          ----------------------------------------------------------------------
1serA2          ----------------------------------------------------------------------
1wu7A2          D---------------------------------------------------------------------
1adjA2          ----------------------------------------------------------------------
1v4pA           ----------------------------------------------------------------------
1asyA2          I---------------------------------------------------------------------
1r8gA           E---------------------------------------------------------------------
1h4qA2          ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
1o6dA           IVRKETEDLTNRILPGSDKRGEEFADFLKDLEMKGKDITILIGGPYGLNEEIFAKAHRVFSLSKMTFTHG
1evkA1          VNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEV
1usyA           ----------------------------------------------------------------------
1n4kA1          ----------------------------------------------------------------------
1atiA1          AKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKVTVRDRDTMEQIRLHVDEL
1httA1          AMALAERLRDELPGVKLNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSV
1adjA1          AFYLAEALRPRLRAEY-ALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEV
1z7mA1          ----------------------------------------------------------------------
1g5hA1          CQGLLNELLENGISVWSETVHSSLEQLHSKYDEXSVLFSVLVTETTLENGLIQLRSRDTTXKEXXHISKL
1h4qA1          AQGLRQALLAQGLRVHLDDRDQHPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE-TLPLA--
1wu7A1          XNEYSRKLRERGXNVTVEIXERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNXYTGSQENVGLDSV
1qe0A1          AVKLLNHLRHNGIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDAL
1gc5A           ----------------------------------------------------------------------
1c0aA3          ----------------------------------------------------------------------
1v95A           AESVGRKVRDLGMVVDLIFLNTELSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQRNMPQADA
1nyqA2          ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1gw6A1          ----------------------------------------------------------------------
1go3F           ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           VNRIVLEIANREN
1evkA2          -------------
1atiA2          -------------
1nyqA3          -------------
1serA2          -------------
1wu7A2          -------------
1adjA2          -------------
1v4pA           -------------
1asyA2          -------------
1r8gA           -------------
1h4qA2          -------------
1b70A           -------------
1o6dA           MTVLIVLEQI---
1evkA1          IEKLQQEIRSRSL
1usyA           -------------
1n4kA1          -------------
1atiA1          EGFLRERL-----
1httA1          AAHLRTLLG----
1adjA1          PGYLLQALG----
1z7mA1          -------------
1g5hA1          RDFLVKYLASASN
1h4qA1          -------------
1wu7A1          VEHLISQA-----
1qe0A1          VEYF---------
1gc5A           -------------
1c0aA3          -------------
1v95A           MVLVARNYERYKN
1nyqA2          -------------
1qf6A2          -------------
1k8kD1          -------------
1rwsA           -------------
1gw6A1          -------------
1go3F           -------------
1vjkA           -------------