[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB82333.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ooiA1.bssp"
#ERROR : Can't open dsspfile "2ikkA1.bssp"
#ERROR : Can't open dsspfile "3cnvA1.bssp"
#ERROR : Can't open dsspfile "2p19A1.bssp"
#ERROR : Can't open dsspfile "2fa1A1.bssp"
#ERROR : Can't open dsspfile "2nwiA1.bssp"
#ERROR : Can't open dsspfile "2oggA1.bssp"
#ERROR : Can't open dsspfile "3bwgA2.bssp"
#ERROR : Can't open dsspfile "2pkhA1.bssp"
#ERROR : Can't open dsspfile "3ddvA1.bssp"
#ERROR : Can't open dsspfile "1e2xA1.bssp"
#ERROR : Can't open dsspfile "3bwgA1.bssp"
#ERROR : Can't open dsspfile "1v4rA1.bssp"
#ERROR : Can't open dsspfile "1aoyA.bssp"
#ERROR : Can't open dsspfile "1stzA1.bssp"
#ERROR : Can't open dsspfile "2cohA1.bssp"
#ERROR : Can't open dsspfile "2gauA1.bssp"
#ERROR : Can't open dsspfile "1zybA1.bssp"
#ERROR : Can't open dsspfile "2hs5A1.bssp"
#ERROR : Can't open dsspfile "1lvaA3.bssp"
#ERROR : Can't open dsspfile "1ft9A1.bssp"
#ERROR : Can't open dsspfile "2h6bA1.bssp"
#ERROR : Can't open dsspfile "1ucrA.bssp"
#ERROR : Can't open dsspfile "1jhfA1.bssp"
#ERROR : Can't open dsspfile "1xd7A.bssp"
#ERROR : Can't open dsspfile "2b0lA1.bssp"
#ERROR : Can't open dsspfile "1xcbA1.bssp"
#ERROR : Can't open dsspfile "1cgpA1.bssp"
#ERROR : Can't open dsspfile "1oyiA.bssp"
#ERROR : Can't open dsspfile "1qbjA.bssp"
#ERROR : Can't open dsspfile "2fnaA1.bssp"
#ERROR : Can't open dsspfile "1omiA2.bssp"
#ERROR : Can't open dsspfile "1q1hA.bssp"
#ERROR : Can't open dsspfile "1sfuA.bssp"
#ERROR : Can't open dsspfile "2co5A1.bssp"
#ERROR : Can't open dsspfile "2jn6A1.bssp"
#ERROR : Can't open dsspfile "2htjA1.bssp"
#ERROR : Can't open dsspfile "1z05A1.bssp"
#ERROR : Can't open dsspfile "2g9wA1.bssp"
#ERROR : Can't open dsspfile "1lvaA4.bssp"
#ERROR : Can't open dsspfile "1p6rA.bssp"
#ERROR : Can't open dsspfile "1biaA1.bssp"
#ERROR : Can't open dsspfile "1h3dA2.bssp"
#ERROR : Can't open dsspfile "1mkmA1.bssp"
#ERROR : Can't open dsspfile "1mzbA.bssp"
#ERROR : Can't open dsspfile "1wi9A.bssp"

## Summary of PDB Search
:241
    4e-33  14%  2ooiA1 [d.190.1.2] SA0254 PROTEIN A:73 -- 233
    8e-32  24%  2ikkA1 [d.190.1.2] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR YURK A:86
    1e-31  23%  3cnvA1 [d.190.1.2] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    1e-31  30%  2p19A1 [d.190.1.2] TRANSCRIPTIONAL REGULATOR A:2 -- 149
    1e-30  18%  2fa1A1 [d.190.1.2] PROBABLE TRANSCRIPTIONAL REGULATOR PHNF A:84 --
    2e-29  17%  2nwiA1 [d.190.1.3] HYPOTHETICAL PROTEIN A:1 -- 160
    4e-29  18%  2oggA1 [d.190.1.2] TREHALOSE OPERON TRANSCRIPTIONAL REPRESSOR A:95
    1e-28  16%  3bwgA2 [d.190.1.2] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL A:89 --
    5e-28  15%  2pkhA1 [d.190.1.2] HISTIDINE UTILIZATION REPRESSOR A:109 -- 249
    3e-23  23%  3ddvA1 [d.190.1.2] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY) A:3 --
    2e-19  32%  1e2xA1 [a.4.5.6] FATTY ACID METABOLISM REGULATOR PROTEIN A:6 --
    1e-16  33%  3bwgA1 [a.4.5.6] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL A:5 --
    7e-16  28%  1v4rA1 [a.4.5.6] TRANSCRIPTIONAL REPRESSOR A:1 -- 100
    6e-15   4%  1aoyA  [a.4.5.3] ARGININE REPRESSOR
    2e-13  22%  1stzA1 [a.4.5.51] HEAT-INDUCIBLE TRANSCRIPTION REPRESSOR HRCA
    1e-12  22%  2cohA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR A:118 -- 199
    2e-12  12%  2gauA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY A:152
    2e-12   9%  1zybA1 [a.4.5.4] TRANSCRIPTION REGULATOR, CRP FAMILY A:148 -- 220
    6e-11  25%  2hs5A1 [a.4.5.6] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR A:25 --
    8e-11  13%  1lvaA3 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:511
    1e-10  16%  1ft9A1 [a.4.5.4] CARBON MONOXIDE OXIDATION SYSTEM TRANSCRIPTION
    1e-10  16%  2h6bA1 [a.4.5.4] CHLOROPHENOL REDUCTION GENE K A:148 -- 229
    1e-10  14%  1ucrA  [a.4.5.45] PROTEIN DSVD
    2e-10  23%  1jhfA1 [a.4.5.2] LEXA REPRESSOR A:2 -- 72
    2e-10  18%  1xd7A  [a.4.5.55] YWNA
    2e-10  18%  2b0lA1 [a.4.5.66] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC A:167
    3e-10  12%  1xcbA1 [a.4.5.38] REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX A:4
    4e-10  13%  1cgpA1 [a.4.5.4] PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN (CAP)
    4e-10  14%  1oyiA  [a.4.5.19] DOUBLE-STRANDED RNA-BINDING PROTEIN
    7e-10  15%  1qbjA  [a.4.5.19] PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSINE
    3e-09  19%  2fnaA1 [a.4.5.11] CONSERVED HYPOTHETICAL PROTEIN A:284 -- 356
    4e-09  10%  1omiA2 [a.4.5.4] LISTERIOLYSIN REGULATORY PROTEIN A:1138 -- 1237
    4e-08  16%  1q1hA  [a.4.5.41] TRANSCRIPTION FACTOR E
    1e-07  17%  1sfuA  [a.4.5.19] 34L PROTEIN
    2e-07  18%  2co5A1 [a.4.5.48] VIRAL PROTEIN F93 A:5 -- 93
    4e-07  12%  2jn6A1 [a.4.1.19] PROTEIN CGL2762 A:1 -- 89
    3e-06  15%  2htjA1 [a.4.5.73] P FIMBRIAL REGULATORY PROTEIN KS71A A:1 -- 73
    4e-06   9%  1z05A1 [a.4.5.63] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:10 --
    5e-06  11%  2g9wA1 [a.4.5.39] CONSERVED HYPOTHETICAL PROTEIN A:3 -- 124
    1e-05  17%  1lvaA4 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:575
    1e-05  15%  1p6rA  [a.4.5.39] PENICILLINASE REPRESSOR
    4e-05  16%  1biaA1 [a.4.5.1] BIRA BIFUNCTIONAL PROTEIN A:1 -- 63
    2e-04  14%  1h3dA2 [d.58.5.3] ATP-PHOSPHORIBOSYLTRANSFERASE A:225 -- 299
    4e-04  25%  1mkmA1 [a.4.5.33] ICLR TRANSCRIPTIONAL REGULATOR A:1 -- 75
    6e-04   9%  1mzbA  [a.4.5.42] FERRIC UPTAKE REGULATION PROTEIN
    7e-04  22%  1wi9A  [a.4.5.47] PROTEIN C20ORF116 HOMOLOG
:241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFKRSRGIALYHQLETELIDLINSGELKENDKLPSERELCEQYNVSRTTARQAIGELERKEYVYKVHGKG
2ooiA1          ----------------------------------------------------------------------
2ikkA1          ----------------------------------------------------------------------
3cnvA1          ----------------------------------------------------------------------
2p19A1          ----------------------------------------------------------------------
2fa1A1          ----------------------------------------------------------------------
2nwiA1          ----------------------------------------------------------------------
2oggA1          ----------------------------------------------------------------------
3bwgA2          ----------------------------------------------------------------------
2pkhA1          ----------------------------------------------------------------------
3ddvA1          ----------------------------------------------------------------------
1e2xA1          ---------PAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
3bwgA1          -----------QQIATEIETYIEEHQLQQGDKLPVLETLXAQFEVSKSTITKSLELLEQKGAIFQVRGSG
1v4rA1          MPYKAPEGKGYADVATHFRTLIKSGELAPGDTLPSVADIRAQFGVAAKTVSRALAVLKSEGLVSSRGALG
1aoyA           ---------KQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEMV
1stzA1          ----------LNDRQRKVLYCIVREYIENKKP-VSSQRVLEVSNFSSATIRNDMKKLEYLGYIYQPHTSA
2cohA1          ----------AAALLELSETPLAHEEEGKVVLKATHDELAAAVGSVRETVTKVIGELAREGYIRSGYGKI
2gauA1          ---------LAETLLILKENFGFENDGATLSIYLSREELATLSNMTVSNAIRTLSTFVSERMLALDGKRI
1zybA1          ---------LKSKIIRFFLSHCEKPQGEKTFKV-KXDDLARCLDDTRLNISKTLNELQDNGLIELHRKEI
2hs5A1          ---------RTTRVAGILRDAIIDGTFRPGARLSE-PDICAALDVSRNTVREAFQILIEDRLVAHELNRG
1lvaA3          ------------ETQKKLLKDLEDKYRVSRWQPPSFKEVAGSFNLDPSELEELLHYLVREGVLVKIN-DE
1ft9A1          ---------IKQRIAGFFIDHANTTGRQTGVIVSTVEEIANLIGSSRQTTSTALNSLIKEGYISRQGRGH
2h6bA1          ---TIRILRLFYELCSSQGKRVGDTYEITMP--LSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKI
1ucrA           ------------EAKQKVVDFLNSKSGSKSK--FYFNDFTDLFPMKQREVKKILTALVNDEVEYWSSGST
1jhfA1          ------------ARQQEVFDLIRDHISQ-TGMPPTRAEIAQRLGFSPNAAEEHLKALARKGVIEIVSGAS
1xd7A           ---------------SRLAVAIHILSLISMDEKTSSEIIADSVNTNPVVVRRMISLLKKADILTSRAGVP
2b0lA1          --VQMAISSLSYSELEAIEHIF--EELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLKG
1xcbA1          ---------EAAISRLITYLRILEELEAQGVHRTSSEQLGELAQVTAFQVRKDLSYFGSYGTR----GVG
1cgpA1          ---------RIAQTLLNLAKQPDAMTHPDGMQIKTRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTI
1oyiA           ----------------SNAEIVCEAIKTIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIP
1qbjA           ---------IYQDQEQRILKFL---EELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTP
2fnaA1          ----------------LNIXRTLSKCGKW-SDVKRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEKY
1omiA2          --------------------LILTYVYGKETPDGIKITLDNLTMQELSAVSRIISKLKQEKVIVYKNSCF
1q1hA           --------NLAKSLLGDDVIDVLRILLDKGTEM-TDEEIANQLNIKVNDVRKKLNLLEEQGFVSYRKTRS
1sfuA           ------------------------LSLNTNDYTT-AISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNP
2co5A1          -----------------LKVLVINGSRLEKKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPD
2jn6A1          --------TYSEEFKRDAVAL-----YENSDGA-SLQQIANDLGINRVTLKNWIIKYGSNHNVQGTTPSA
2htjA1          --------------------------LNRHNGG-KTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLRR
1z05A1          --------HIKQINAGRVYKL-----IDQKGPI-SRIDLSKESELAPASITKITRELIDAHLIHETTVQE
2g9wA1          --------------------------LWSRTEPQTHEALSARRDLAYTTVXAVLQRLAKKNLVLQIRAHR
1lvaA4          --------------------------LASTGPF-GLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGDK-
1p6rA           -------------------------KHSSINTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGR
1biaA1          ------------------------------GEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGK
1h3dA2          -------------------------ALLPGAERPTILPLAMHMVSSETLFWETMEKLKALGASSILV---
1mkmA1          --------------------------IVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKR
1mzbA           --------LKVTLPRVKILQMLDSAQRHMSAEDVYKALMEAGEDVGLATVYRVLTQFEAAGLVVRHNFDG
1wi9A           ----------------------------------LLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVDDRG


                         .         .         *         .         .         .         .:140
query           TFISPKVYKQQLLKFYSFTEEMKKLGKNPSSKILSFDLIRADNKISEKLKVEENSLVYKIVRLRIADEVP
2ooiA1          -------------RINVFKTNGFSKSRMTSKVLVFKEMATPPKSVQDELQLNADDTVYYLERLRFVDDDV
2ikkA1          --------------------------LYFQHHVLSHDIIPASKPIAEKLQIQPESPVVELKRILYNDDQP
3cnvA1          ------------------YRFLRLAPDEAESRILECRRLRAPAEIARALELRAGETVVTIRRQLSXNHXP
2p19A1          ----------------------KNANLDPKTRVLEHRLLAASSAIAEKLGVSAGDEVLLIRRLRSTGDIP
2fa1A1          -----------MNAQARFSQNLLDQGSHPTSEKLLSVLRPASGHVADALGITEGENVIHLRTLRRVNGVA
2nwiA1          --LNAIH-RILMTTDGSITAIIEAVQKKVEVETLEQKIIRADRELAELLEIDEGDEVNYRVVYLRANGEI
2oggA1          -----------------------------KTTVHKFGLEPPSELIQKQLRANLDDDIWEVIRSRKIDGEH
3bwgA2          --------------------------FNVTSKVIELDVRKPTPEAAENLNIGXDEDIYYVKRVRYINGQT
2pkhA1          ----------------------------HTCKVXVLKEEAAGSERALALDXREGQRVFHSLIVHFENDIP
3ddvA1          --------------------------RVPSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
1e2xA1          TKVNN-----------------------------------------------------------------
3bwgA1          IFVRK-----------------------------------------------------------------
1v4rA1          TVVEK-----------------------------------------------------------------
1aoyA           YCLPAE----------------------------------------------------------------
1stzA1          GRIPTRFYYEEMLKISKETSE-------------------------------------------------
2cohA1          QLLDL-----------------------------------------------------------------
2gauA1          KIIDCD----------------------------------------------------------------
1zybA1          LIPDAQ----------------------------------------------------------------
2hs5A1          VFVRV-----------------------------------------------------------------
1lvaA3          FYWH------------------------------------------------------------------
1ft9A1          YTIPNLVRLKAA----------------------------------------------------------
2h6bA1          IVYNL-----------------------------------------------------------------
1ucrA           TMYGLKGAGKQAA---------------------------------------------------------
1jhfA1          RGIRL-----------------------------------------------------------------
1xd7A           GASLKKD---------------------------------------------------------------
2b0lA1          TYIKV-----------------------------------------------------------------
1xcbA1          YTVPVLKRERHILGL-------------------------------------------------------
1cgpA1          V---------------------------------------------------------------------
1oyiA           PRWF------------------------------------------------------------------
1qbjA           PLWK------------------------------------------------------------------
2fnaA1          CPSEP-----------------------------------------------------------------
1omiA2          YVQNLDYLKRYAPKLDEWFYL-------------------------------------------------
1q1hA           GWF-------------------------------------------------------------------
1sfuA           P---------------------------------------------------------------------
2co5A1          GKV-------------------------------------------------------------------
2jn6A1          AVSE-AEQIRQLKKENALQRARTRHPA-------------------------------------------
2htjA1          GMATYWFL-------KGEKQAGQSC---------------------------------------------
1z05A1          AI--------------------------------------------------------------------
2g9wA1          YAPVHGRDELVAGLXVDALAQA------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
1p6rA           VFV-------------------------------------------------------------------
1biaA1          GYS-------------------------------------------------------------------
1h3dA2          ----------------------------------------------------------------------
1mkmA1          YVPGYKLI--------------------------------------------------------------
1mzbA           GH--------------------------------------------------------------------
1wi9A           KFIY------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MMVECTYLPEYRFIDLKEKMLKEKPMYDIFREVYNVSLTKAKESFKPILISKSDSKLLNVEDGTAAMRIE
2ooiA1          LCIEYSYYHKEIVKYLNDDIAKG-SIFDYLESNMKLRIGFSDIFFNVDKLTSSEASLLQLSTGEPCLRYH
2ikkA1          LTFEVTHYPLDLFPGIDTFIADGVSXHDILKQQYKVVPTHNTKLLNVVYAQQEESKYLDCDIGDALFEID
3cnvA1          TVIDDLWLPGTHFRGLTLELLTAAPLYGLFESEFGVSXVRADEKLRAVAASPEIAPLLGVEPGRPLLQVD
2p19A1          VAILENYLP-PAFNDVSLDELEKGGLYDALRS-RGVVLKIANQKIGARRAVGEESTLLDIEDGGPLLTVE
2fa1A1          LCLIDHYFADLTLWPTLQRFD-SGSLHDFLREQTGIALRRSQTRISARRAQAKECQRLEIPNMSPLLCVR
2nwiA1          YAKAISFTPLKRLENSFREDLMRIPIGKIM-RKHNIEARREIRWSRVEEADLALAKELGIADRRVISRNY
2oggA1          VILDKDYFFRKHVPHLTKEIC-ENSIYEYIEGELGLSISYAQKEIVAEPCTDEDRELLDLRGYDHXVVVR
3bwgA2          LCYEESYYTKSIVTYLNNEIV-SHSIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIE
2pkhA1          VQIEDRFVNAQVAPDYLKQDFTLQTPYAYLSQ--VAPLTEGEHVVEAILAEADECKLLQIDAGEPCLLIR
3ddvA1          ICFEVASIPYSLV-----------------------KIGHSNQTISAVQASEQIAEYLEIKRGDAILRVR
1e2xA1          ----------------------------------------------------------------------
3bwgA1          ----------------------------------------------------------------------
1v4rA1          ----------------------------------------------------------------------
1aoyA           ----------------------------------------------------------------------
1stzA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
2gauA1          ----------------------------------------------------------------------
1zybA1          ----------------------------------------------------------------------
2hs5A1          ----------------------------------------------------------------------
1lvaA3          ----------------------------------------------------------------------
1ft9A1          ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1ucrA           ----------------------------------------------------------------------
1jhfA1          ----------------------------------------------------------------------
1xd7A           ----------------------------------------------------------------------
2b0lA1          ----------------------------------------------------------------------
1xcbA1          ----------------------------------------------------------------------
1cgpA1          ----------------------------------------------------------------------
1oyiA           ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
2fnaA1          ----------------------------------------------------------------------
1omiA2          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
2co5A1          ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
2g9wA1          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1biaA1          ----------------------------------------------------------------------
1h3dA2          ----------------------------------------------------------------------
1mkmA1          ----------------------------------------------------------------------
1mzbA           ----------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RVTFENERVIEYTVSVSRGDKFEYTVVLExx
2ooiA1          QTFYMTGKPFDSSDIVFHYRHAQFYIPS---
2ikkA1          KTAFSNDQPIYCSLFLXHTNRVTFTI-----
3cnvA1          RISYYGDRPXEVRRGLYLTDHYHYRNSL---
2p19A1          RVALNSGQVIELGSHCYRPDMYNFETTL---
2fa1A1          TLNHGESSPAEYSVSLTRADMIEFTM-----
2nwiA1          NII-HRGKVLINITEFFPMERF---------
2oggA1          NYVFEDTSLFQYTESRHRLDKFRFVDFA---
3bwgA2          SIFHTNGQPFDYSKISYNYEQSQFVVQA---
2pkhA1          RRTWSGRQPVTAARLIHPGSRHRLEGRFT--
3ddvA1          QVSYENGLPFEYVRTQYAGSRFEFYL-----
1e2xA1          -------------------------------
3bwgA1          -------------------------------
1v4rA1          -------------------------------
1aoyA           -------------------------------
1stzA1          -------------------------------
2cohA1          -------------------------------
2gauA1          -------------------------------
1zybA1          -------------------------------
2hs5A1          -------------------------------
1lvaA3          -------------------------------
1ft9A1          -------------------------------
2h6bA1          -------------------------------
1ucrA           -------------------------------
1jhfA1          -------------------------------
1xd7A           -------------------------------
2b0lA1          -------------------------------
1xcbA1          -------------------------------
1cgpA1          -------------------------------
1oyiA           -------------------------------
1qbjA           -------------------------------
2fnaA1          -------------------------------
1omiA2          -------------------------------
1q1hA           -------------------------------
1sfuA           -------------------------------
2co5A1          -------------------------------
2jn6A1          -------------------------------
2htjA1          -------------------------------
1z05A1          -------------------------------
2g9wA1          -------------------------------
1lvaA4          -------------------------------
1p6rA           -------------------------------
1biaA1          -------------------------------
1h3dA2          -------------------------------
1mkmA1          -------------------------------
1mzbA           -------------------------------
1wi9A           -------------------------------