[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO48556.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2o5vA.bssp"
#ERROR : Can't open dsspfile "1us8A.bssp"
#ERROR : Can't open dsspfile "1f2tA.bssp"
#ERROR : Can't open dsspfile "1xewX.bssp"
#ERROR : Can't open dsspfile "1ii8A.bssp"
#ERROR : Can't open dsspfile "1f2uC.bssp"
#ERROR : Can't open dsspfile "1f2uA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"

## Summary of PDB Search
:371
    9e-34  30%  2o5vA  [x.x.x] DNA REPLICATION AND REPAIR PROTEIN RECF
    3e-07  30%  1us8A  [c.37.1] DNA DOUBLE-STRAND BREAK REPAIR RAD50 ATPASE
    1e-06  30%  1f2tA  [c.37.1] RAD50 ABC-ATPASE
    2e-06  33%  1xewX  [c.37.1] SMC PROTEIN
    3e-05  25%  1ii8A  [c.37.1] RAD50 ABC-ATPASE
    5e-05  30%  1f2uC  [c.37.1] RAD50 ABC-ATPASE
    5e-05  30%  1f2uA  [c.37.1] RAD50 ABC-ATPASE
    1e-04  40%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
:371

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRVKKLSLRNFRNYKEAQFIPHPSINIITGPNAQGKTNLLEAIYYSLRGCSFRAEKDRDVTNWESNHTVI
2o5vA           VRLSALSTLNYRNLAPGTLNFPEGVTGIYGENGAGKTNLLEAAYLALTGQTDAPRIEQLIQAGETE-AYV
1us8A           MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAIYWPLRIDTYDLIFEKDGTKYRITRRFL
1f2tA           MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAIYWPLRIKDIKKDEEKDGTKYRITRRFL
1xewX           --IEKLELKGFKSYGNKKVVIPFSFTAIVGANGSGKSNIGDAILFVLGGLSAKAEVAIYFNNEDRGFPID
1ii8A           MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAIYWPLRIKDIKKDEEKDGTKYRITRRFL
1f2uC           MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAIYWPLRIKDIKKDEEKDGTKYRITRRFL
1f2uA           MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAIYWPLRIKDIKKDEEKDGTKYRITRRFL
1e69A           MRLKKLYLKGFKSFGRPSLIGFSDVTAIVGPNGSGKSNIIDAI---------------------------


                         .         .         *         .         .         .         .:140
query           NTEVNLSSRLIKLQWKIQEGSKKLSLNGVERPRSELDLFGVVLFCPEDLSLIKGSPQERRHFLDYEVGTL
2o5vA           RADLQQGGSLSIQEVGLGRGRRQLKVDGVRARTGDLPRGGAVWIRPEDSELVFGPPSGRRAYLDSLLSRL
1us8A           SGEIHAMKRLVGNEWKVTEPSSK-----------------------------------------------
1f2tA           KGEIHAMKRLVGNEWKVTEPSSK-----------------------------------------------
1xewX           EDEVVIRRRV------YPDGRSSYWLNGRRATRSELDILTAAMISPDGYNIIKMSPLERRLLID------
1ii8A           SGEIHAMKRLVGNEWKVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILES-DEAREKVVREVLNL
1f2uC           SGEIHAMKRLVGNEWKVTEPSSK-----------------------------------------------
1f2uA           SGEIHAMKRLVGNEWKVTEPSSK-----------------------------------------------
1e69A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SPGYSQLWRQYAKILSQRNSLLKEIRDHRSKQEVLEVWDEQLYRYGAKVIYLRLQVLKKLIPIARKTHFG
2o5vA           SARYGEQLSRYERTVSQRNAALRG-----GEEWAMHVWDDVLLKLGTEIMLFRRRALTRLDELAR-----
1us8A           ----------------------------------------------------------------------
1f2tA           ----------------------------------------------------------------------
1xewX           ----------------------------------------------------------------------
1ii8A           DK-FETAYKKLSELKKTINNRIKEYRDILARTE-------------------------------------
1f2uC           ----------------------------------------------------------------------
1f2uA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LTGGTEELQAKYLSSLVLEPGLSEGQIYQVFSSSSKKIRQMELKRCQTLLGPHRDDLSLAINGVEAKTFG
2o5vA           ------EANAQLGSRKTLALTLTESTSPETYAADLRGRRAEELARGSTVTGPHRDDLLLTLGDFPASDYA
1us8A           ----------------------------------------------------------------------
1f2tA           ----------------------------------------------------------------------
1xewX           ----------------------------------------------------------------------
1ii8A           ----------------------------------------------------------------------
1f2uC           ----------------------------------------------------------------------
1f2uA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SQGQQRTVTLSLKLSQLDLWYHEFGEYPXXXXXXXXFELDRSRQNMLIDKILNKVQTFITTSFTGGIEET
2o5vA           SRGEGRTVXXXXXXXXXXXXXXKFGEDPVLLLDDFTAELDPHRRQYLLDLAASVPQAIVTGT------EL
1us8A           ----------------------------------------------------------------------
1f2tA           ----------------------------------------------------------------------
1xewX           ----------------------------------------------------------------------
1ii8A           ----------------------------------------------------------------------
1f2uC           ----------------------------------------------------------------------
1f2uA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IKGAGLLWQVNAGSLTxxxxx
2o5vA           APGAALTLRAQAGRFT-----
1us8A           ---------------------
1f2tA           ---------------------
1xewX           ---------------------
1ii8A           ---------------------
1f2uC           ---------------------
1f2uA           ---------------------
1e69A           ---------------------