[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO48569.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2nx8A.bssp"
#ERROR : Can't open dsspfile "2b3jD.bssp"
#ERROR : Can't open dsspfile "2b3jC.bssp"
#ERROR : Can't open dsspfile "1z3aA.bssp"
#ERROR : Can't open dsspfile "2b3jA.bssp"
#ERROR : Can't open dsspfile "2a8nB.bssp"
#ERROR : Can't open dsspfile "1wwrD.bssp"
#ERROR : Can't open dsspfile "1wwrC.bssp"
#ERROR : Can't open dsspfile "1wwrB.bssp"
#ERROR : Can't open dsspfile "1wwrA.bssp"
#ERROR : Can't open dsspfile "2a8nA.bssp"
#ERROR : Can't open dsspfile "3dh1D.bssp"
#ERROR : Can't open dsspfile "3dh1A.bssp"
#ERROR : Can't open dsspfile "3dh1B.bssp"
#ERROR : Can't open dsspfile "1wkqA.bssp"
#ERROR : Can't open dsspfile "1wkqB.bssp"
#ERROR : Can't open dsspfile "1tiyB.bssp"
#ERROR : Can't open dsspfile "1tiyA.bssp"
#ERROR : Can't open dsspfile "1uaqA.bssp"
#ERROR : Can't open dsspfile "1rb7A.bssp"
#ERROR : Can't open dsspfile "1p6oB.bssp"
#ERROR : Can't open dsspfile "1p6oA.bssp"
#ERROR : Can't open dsspfile "2o3kB.bssp"
#ERROR : Can't open dsspfile "2o3kA.bssp"
#ERROR : Can't open dsspfile "1ysdB.bssp"
#ERROR : Can't open dsspfile "1ysdA.bssp"
#ERROR : Can't open dsspfile "1ysbB.bssp"
#ERROR : Can't open dsspfile "1ysbA.bssp"
#ERROR : Can't open dsspfile "2b3zD.bssp"
#ERROR : Can't open dsspfile "2b3zA.bssp"
#ERROR : Can't open dsspfile "2o7pA.bssp"
#ERROR : Can't open dsspfile "2obcA.bssp"
#ERROR : Can't open dsspfile "2g6vA.bssp"
#ERROR : Can't open dsspfile "1ox7B.bssp"
#ERROR : Can't open dsspfile "1ox7A.bssp"
#ERROR : Can't open dsspfile "2obcB.bssp"
#ERROR : Can't open dsspfile "2o7pB.bssp"
#ERROR : Can't open dsspfile "2g6vB.bssp"
#ERROR : Can't open dsspfile "1vq2A.bssp"
#ERROR : Can't open dsspfile "2hvwB.bssp"
#ERROR : Can't open dsspfile "2hvwA.bssp"
#ERROR : Can't open dsspfile "2hvvA.bssp"
#ERROR : Can't open dsspfile "2g84B.bssp"
#ERROR : Can't open dsspfile "2g84A.bssp"
#ERROR : Can't open dsspfile "2w4lC.bssp"
#ERROR : Can't open dsspfile "2w4lF.bssp"
#ERROR : Can't open dsspfile "2w4lA.bssp"

## Summary of PDB Search
:151
    5e-39  49%  2nx8A  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE
    7e-36  47%  2b3jD  [x.x.x] TRNA ADENOSINE DEAMINASE
    7e-36  47%  2b3jC  [x.x.x] TRNA ADENOSINE DEAMINASE
    9e-36  45%  1z3aA  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE
    3e-35  47%  2b3jA  [x.x.x] TRNA ADENOSINE DEAMINASE
    5e-27  44%  2a8nB  [x.x.x] CYTIDINE AND DEOXYCYTIDYLATE DEAMINASE
    1e-26  39%  1wwrD  [x.x.x] TRNA ADENOSINE DEAMINASE TADA
    1e-26  39%  1wwrC  [x.x.x] TRNA ADENOSINE DEAMINASE TADA
    1e-26  39%  1wwrB  [x.x.x] TRNA ADENOSINE DEAMINASE TADA
    1e-26  39%  1wwrA  [x.x.x] TRNA ADENOSINE DEAMINASE TADA
    4e-25  46%  2a8nA  [x.x.x] CYTIDINE AND DEOXYCYTIDYLATE DEAMINASE
    1e-17  34%  3dh1D  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    1e-17  34%  3dh1A  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    3e-17  34%  3dh1B  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    1e-15  40%  1wkqA  [c.97.1] GUANINE DEAMINASE
    4e-15  39%  1wkqB  [c.97.1] GUANINE DEAMINASE
    4e-13  39%  1tiyB  [c.97.1] GUANINE DEAMINASE
    4e-13  39%  1tiyA  [c.97.1] GUANINE DEAMINASE
    3e-12  35%  1uaqA  [c.97.1] CYTOSINE DEAMINASE
    3e-12  35%  1rb7A  [c.97.1] CYTOSINE DEAMINASE
    3e-12  35%  1p6oB  [c.97.1] CYTOSINE DEAMINASE
    3e-12  35%  1p6oA  [c.97.1] CYTOSINE DEAMINASE
    5e-12  34%  2o3kB  [x.x.x] CYTOSINE DEAMINASE
    5e-12  34%  2o3kA  [x.x.x] CYTOSINE DEAMINASE
    7e-12  34%  1ysdB  [x.x.x] CYTOSINE DEAMINASE
    7e-12  34%  1ysdA  [x.x.x] CYTOSINE DEAMINASE
    7e-12  34%  1ysbB  [x.x.x] CYTOSINE DEAMINASE
    7e-12  34%  1ysbA  [x.x.x] CYTOSINE DEAMINASE
    1e-08  34%  2b3zD  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    1e-08  34%  2b3zA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    1e-08  41%  2o7pA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    2e-07  42%  2obcA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    3e-07  43%  2g6vA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    2e-06  32%  1ox7B  [c.97.1] CYTOSINE DEAMINASE
    2e-06  32%  1ox7A  [c.97.1] CYTOSINE DEAMINASE
    2e-06  41%  2obcB  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    3e-06  44%  2o7pB  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    3e-06  47%  2g6vB  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    6e-06  48%  1vq2A  [c.97.1] DEOXYCYTIDYLATE DEAMINASE
    6e-06  33%  2hvwB  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    6e-06  33%  2hvwA  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    6e-06  33%  2hvvA  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    1e-04  36%  2g84B  [x.x.x] CYTIDINE AND DEOXYCYTIDYLATE DEAMINASE ZINC-
    1e-04  36%  2g84A  [x.x.x] CYTIDINE AND DEOXYCYTIDYLATE DEAMINASE ZINC-
    2e-04  28%  2w4lC  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    7e-04  28%  2w4lF  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    7e-04  28%  2w4lA  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
:151

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSHALFMREALIEAQKAAVKGEVPIGAVVVWKDEVIGRGYDLRESLCDASAHAEILAMRKAAKHLGDWRL
2nx8A           -----FMQEALKESEKSLQKAEIPIGCVIVKDGEIIGRGHNAREESNQAIMHAEMMAINEANAHEGNWRL
2b3jD           -----FMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTXXXXXXXXXXXXKVLGSWRL
2b3jC           -----FMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTXXXXXXXXXXXXKVLGSWRL
1z3aA           -SHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVMQNYRL
2b3jA           -----FMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTXXXXXXXXXXXXKVLGSWRL
2a8nB           -----FMELALVEARSAGERDEVPIGAVLVLDGRVIARSGNRTRELNDVTAHAEIAVIRMACEALGQERL
1wwrD           MGKEYFLKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRLNTKYL
1wwrC           MGKEYFLKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRLNTKYL
1wwrB           MGKEYFLKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRLNTKYL
1wwrA           MGKEYFLKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRLNTKYL
2a8nA           -----FMELALVEARSAGERDEVPIGAVLVLDGRVIARSGNRTRELNDVTAHAEIAVIRMACEALGQERL
3dh1D           -----WMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIRQSGKSPSEV-F
3dh1A           -----WMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIRQSGKSPSEV-F
3dh1B           -----WMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIRQSGKSPSEV-F
1wkqA           MNHETFLKRAVTEGVNAGIGG--PFGAVIVKDGAIIAEGQNNVTTSNDPTAHAEVTAIRKACKVLGAYQL
1wkqB           -NHETFLKRAVTEGVNAGIGG--PFGAVIVKDGAIIAEGQNNVTTSNDPTAHAEVTAIRKACKVLGAYQL
1tiyB           -NHETFLKRAVTEGVNAGIGG--PFGAVIVKDGAIIAEGQNNVTTSNDPTAHAEVTAIRKACKVLGAYQL
1tiyA           -NHETFLKRAVTEGVNAGIGG--PFGAVIVKDGAIIAEGQNNVTTSNDPTAHAEVTAIRKACKVLGAYQL
1uaqA           ------------EAALGYKEGGVPIGGCLINNKDVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKV-Y
1rb7A           ------------EAALGYKEGGVPIGGCLINNKDVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKV-Y
1p6oB           ------------EAALGYKEGGVPIGGCLINNKDVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKV-Y
1p6oA           ------------EAALGYKEGGVPIGGCLINNKDVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKV-Y
2o3kB           ------------EALLGYKEGGVPIGGCLINNKDVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKV-Y
2o3kA           ------------EALLGYKEGGVPIGGCLINNKDVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKV-Y
1ysdB           ------------EALLGYKEGGVPIGGCLINNKDVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKV-Y
1ysdA           ------------EALLGYKEGGVPIGGCLINNKDVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKV-Y
1ysbB           ------------EALLGYKEGGVPIGGCLINNKDVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKV-Y
1ysbA           ------------EALLGYKEGGVPIGGCLINNKDVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKV-Y
2b3zD           ------------------------VGAVVVKDGQIVGMGAHLKY----GEAHAEVHAIHMAGAH-----A
2b3zA           ------------------------VGAVVVKDGQIVGMGAHLKY----GEAHAEVHAIHMAGAH-----A
2o7pA           ------------------------VGCVIVKDGEIVGEGYHQRAG----EPHAEVHALRAGEKAKG----
2obcA           ------------------------VGCVIVKDGEIVGEGYHQRA----GEPHAEVHALRAGEKAKG----
2g6vA           ------------------------VGCVIVKDGEIVGEGYHQRA----GEPHAEVHALRAGEKAKG----
1ox7B           ------------EAALGYKEGGVPIGGCLINNKDVLGRGHN-RFQKGSATLHGEISTLENCGRLEGKV-Y
1ox7A           ------------EAALGYKEGGVPIGGCLINNKDVLGRGHN-RFQKGSATLHGEISTLENCGRLEGKV-Y
2obcB           ------------------------VGCVIVKDGEIVGEGYHQRA----GEPHAEVHALRAGEKAKG----
2o7pB           ------------------------VGCVIVKDGEIVGEGYHQRA----GEPHAEVHALRAGEKAKG----
2g6vB           ------------------------VGCVIVKDGEIVGEGYHQRA----GEPHAEVHALRAGEKAKG----
1vq2A           ---------------------------------------------------HAELNAILFAAENGSS--I
2hvwB           ------------------------VGAVLVKNNRIIATGYEMEDGHCIRTVHAEMNALIQCAKE--GISA
2hvwA           ------------------------VGAVLVKNNRIIATGYEMEDGHCIRTVHAEMNALIQCAKE--GISA
2hvvA           ------------------------VGAVLVKNNRIIATGYEMEDGHCIRTVHAEMNALIQCAKE--GISA
2g84B           ----------LVRANIAADGG--PFAAAVFERDSLIAAGTNRVVPGRCSAAHAEILALSLAQAKLDTHDL
2g84A           ----------LVRANIAADGG--PFAAAVFERDSLIAAGTNRVVPGRCSAAHAEILALSLAQAKLDTHDL
2w4lC           -----FMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVHAELNAIMNKVK-------
2w4lF           -----FMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSD----DVLPWRRTAENKLDTKM
2w4lA           -----FMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSD----DVLPWRRTAENKLDTKM


                         .         .         *         .         .         .         .:140
query           NDATLYVTVEPCAMCAGAIVQFRINRLVYGAPNAKSGSVDTILNIVQEARFNHRVEVIAGILEDQCKEII
2nx8A           LDTTLFVTIEPCVMCSGAIGLARIPHVIYGASNQKFGGVDSLYQILTDERLNHRVQVERGLLAADCANIM
2b3jD           EGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLL
2b3jC           EGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLL
1z3aA           IDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLHHPGMNHRVEITEGILADECAALL
2b3jA           EGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLL
2a8nB           PGADLYVTLEPCTMCAAAISFARIRRLYYGAQDPKGGAVESGVRFFSQPTCHHAPDVYSGLAESESAEIL
1wwrD           EGCELYVTLEPCIMCSYALVLSRIEKVIFSALDKKHGGVVSVFNILDEPTLNHRVK-WXXXXXXXXXXXX
1wwrC           EGCELYVTLEPCIMCSYALVLSRIEKVIFSALDKKHGGVVSVFNILDEPTLNHRVK-WXXXXXXXXXXXX
1wwrB           EGCELYVTLEPCIMCSYALVLSRIEKVIFSALDKKHGGVVSVFNILDEPTLNHRVK-WXXXXXXXXXXXX
1wwrA           EGCELYVTLEPCIMCSYALVLSRIEKVIFSALDKKHGGVVSVFNILDEPTLNHRVK-WXXXXXXXXXXXX
2a8nA           PGADLYVTLEPCTMCAAAISFARIRRLYYGAQDPKGGAVESGVRFFSQPTCHHAPDVYSG----------
3dh1D           EHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNRPFQCIPGYRAEEAVEML
3dh1A           EHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNRPFQCIPGYRAEEAVEML
3dh1B           EHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNRPFQCIPGYRAEEAVEML
1wkqA           DDCILYTSCEPCPMCLGAIYWARPKAVFYAAEHAEAGFDDSFI---------------------------
1wkqB           DDCILYTSCEPCPMCLGAIYWARPKAVFYAAEHAEAGFDDSFI---------------------------
1tiyB           DDCILYTSCEPCP-CLGAIYWARPKAVFYAAEHAEAGFDDSFI---------------------------
1tiyA           DDCILYTSCEPCP-CLGAIYWARPKAVFYAAEHAEAGFDDSFI---------------------------
1uaqA           KDTTLYTTLSPCDMCTGAIIMYGIPRCVVGEVNFKSKG---------EKYLQTRGHEVVVVDDERCKKIM
1rb7A           KDTTLYTTLSPCDMCTGAIIMYGIPRCVVGEVNFKSKG---------EKYLQTRGHEVVVVDDERCKKIM
1p6oB           KDTTLYTTLSPCDMCTGAIIMYGIPRCVVGEVNFKSKG---------EKYLQTRGHEVVVVDDERCKKIM
1p6oA           KDTTLYTTLSPCDMCTGAIIMYGIPRCVVGEVNFKSKG---------EKYLQTRGHEVVVVDDERCKKIM
2o3kB           KDTTLYTTLSPCEMCTGAIIMYGIPRCVIGEVNFKSKG---------EKYLQTRGHEVVVVDDERCKKLM
2o3kA           KDTTLYTTLSPCEMCTGAIIMYGIPRCVIGEVNFKSKG---------EKYLQTRGHEVVVVDDERCKKLM
1ysdB           KDTTLYTTLSPCDMCTGAIIMYGIPRCVVGEVNFKSKG---------EKYLQTRGHEVVVVDDERCKKLM
1ysdA           KDTTLYTTLSPCDMCTGAIIMYGIPRCVVGEVNFKSKG---------EKYLQTRGHEVVVVDDERCKKLM
1ysbB           KDTTLYTTLSPCDMCTGAIIMYGIPRCVIGEVNFKSKG---------EKYLQTRGHEVVVVDDERCKKLM
1ysbA           KDTTLYTTLSPCDMCTGAIIMYGIPRCVIGEVNFKSKG---------EKYLQTRGHEVVVVDDERCKKLM
2b3zD           EGADIYVTLEPCSPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEA----GIEVREGILADQAERLN
2b3zA           EGADIYVTLEPCSPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEA----GIEVREGILADQAERLN
2o7pA           --ATAYVTLEPCPPCCDALIAAGVARVVASQPNQVAG---------------------------------
2obcA           --ATAYVTLEPCP-CCDALIAAGVARVVASQPNQVAG---------------------------------
2g6vA           --ATAYVTLEPCP-CCDALIAAGVARVV------------------------------------------
1ox7B           KDTTLYTTLSPCD-CTGAI--------IYGIPRCVVGE-NVNFKSKGEKYLQTRGHEVVVVDDERCKKIK
1ox7A           KDTTLYTTLSPCD-CTGAI--------IYGIPRCVVGE-NVNFKSKGEKYLQTRGHEVVVVDDERCKKIK
2obcB           --ATAYVTLEP---CSDALIAAGVARVVASQPNQVAG---------------------------------
2o7pB           --ATAYVTLEPCALIAAGVAR-------------------------------------------------
2g6vB           --ATAYVTLEPCS---------------------------------------------------------
1vq2A           EGATMYVTLSPCPDCAKAIAQSGIKKLVY-----------------------------------------
2hvwB           NNTEIYVTHFPCINCTKALLQAGVKKITY-----------------------------------------
2hvwA           NNTEIYVTHFPCINCTKALLQAGVKKITY-----------------------------------------
2hvvA           NNTEIYVTHFPCINCTKALLQAGVKKITY-----------------------------------------
2g84B           SACELVTSAEPCVMCFGAVIWSGVRSLVCA---ARSDDVEAI----------------------------
2g84A           SACELVTSAEPCVMCFGAVIWSGVRSLVCA---ARSDDVEAI----------------------------
2w4lC           -GCSMYVALFPCNECAKLIIQAGIKEVIF-----------------------------------------
2w4lF           NDVSMYVALFPCNECAKLIIQAGIKEVIF-----------------------------------------
2w4lA           NDVSMYVALFPCNECAKLIIQAGIKEVIF-----------------------------------------


                         +         .         .         .         .         *         .:210
query           QNFFRELRKNK
2nx8A           QTFFRQGRERK
2b3jD           TTFFKNLRANK
2b3jC           TTFFKNLRANK
1z3aA           SDFFRMRRQ--
2b3jA           TTFFKNLRAN-
2a8nB           -----------
1wwrD           XXFFKKLRNN-
1wwrC           XXFFKKLRNN-
1wwrB           XXFFKKLRNN-
1wwrA           XXFFKKLRNN-
2a8nA           -----------
3dh1D           KTFYKQ-----
3dh1A           KTFYKQ-----
3dh1B           KTFYK------
1wkqA           -----------
1wkqB           -----------
1tiyB           -----------
1tiyA           -----------
1uaqA           KQFIDE-----
1rb7A           KQFIDE-----
1p6oB           KQFIDE-----
1p6oA           KQFIDE-----
2o3kB           KQFIDE-----
2o3kA           KQFIDE-----
1ysdB           KQFIDE-----
1ysdA           KQFIDE-----
1ysbB           KQFIDE-----
1ysbA           KQFIDE-----
2b3zD           EKFLHFMR---
2b3zA           EKFLHFMR---
2o7pA           -----------
2obcA           -----------
2g6vA           -----------
1ox7B           Q----------
1ox7A           Q----------
2obcB           -----------
2o7pB           -----------
2g6vB           -----------
1vq2A           -----------
2hvwB           -----------
2hvwA           -----------
2hvvA           -----------
2g84B           -----------
2g84A           -----------
2w4lC           -----------
2w4lF           -----------
2w4lA           -----------