[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO48823.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2e54A.bssp"
#ERROR : Can't open dsspfile "2ordA.bssp"
#ERROR : Can't open dsspfile "2eh6A.bssp"
#ERROR : Can't open dsspfile "2pb0B.bssp"
#ERROR : Can't open dsspfile "2pb2A.bssp"
#ERROR : Can't open dsspfile "2pb0A.bssp"
#ERROR : Can't open dsspfile "2pb2B.bssp"
#ERROR : Can't open dsspfile "1vefA.bssp"
#ERROR : Can't open dsspfile "2byjA.bssp"
#ERROR : Can't open dsspfile "2oatA.bssp"
#ERROR : Can't open dsspfile "1gbnA.bssp"
#ERROR : Can't open dsspfile "2bylA.bssp"
#ERROR : Can't open dsspfile "1z7dB.bssp"
#ERROR : Can't open dsspfile "1z7dE.bssp"
#ERROR : Can't open dsspfile "1z7dA.bssp"
#ERROR : Can't open dsspfile "1z7dD.bssp"
#ERROR : Can't open dsspfile "1z7dC.bssp"
#ERROR : Can't open dsspfile "1sffA.bssp"
#ERROR : Can't open dsspfile "1szuA.bssp"
#ERROR : Can't open dsspfile "1szkA.bssp"
#ERROR : Can't open dsspfile "1szsA.bssp"
#ERROR : Can't open dsspfile "2eo5A.bssp"
#ERROR : Can't open dsspfile "1z3zA.bssp"
#ERROR : Can't open dsspfile "1zodA.bssp"
#ERROR : Can't open dsspfile "1dgdA.bssp"
#ERROR : Can't open dsspfile "1d7uA.bssp"
#ERROR : Can't open dsspfile "3gjuA.bssp"
#ERROR : Can't open dsspfile "3i5tB.bssp"
#ERROR : Can't open dsspfile "3hmuB.bssp"
#ERROR : Can't open dsspfile "3hmuA.bssp"
#ERROR : Can't open dsspfile "3i5tA.bssp"
#ERROR : Can't open dsspfile "3fcrA.bssp"
#ERROR : Can't open dsspfile "2cfbA.bssp"
#ERROR : Can't open dsspfile "3bs8A.bssp"
#ERROR : Can't open dsspfile "3du4A.bssp"
#ERROR : Can't open dsspfile "2zsmB.bssp"
#ERROR : Can't open dsspfile "2zsmA.bssp"
#ERROR : Can't open dsspfile "2epjA.bssp"
#ERROR : Can't open dsspfile "3bv0B.bssp"
#ERROR : Can't open dsspfile "3bv0A.bssp"
#ERROR : Can't open dsspfile "3drdB.bssp"
#ERROR : Can't open dsspfile "3drdA.bssp"
#ERROR : Can't open dsspfile "3dodB.bssp"
#ERROR : Can't open dsspfile "3dodA.bssp"
#ERROR : Can't open dsspfile "2zukB.bssp"
#ERROR : Can't open dsspfile "3dxvA.bssp"
#ERROR : Can't open dsspfile "2gsaA.bssp"
#ERROR : Can't open dsspfile "2hozA.bssp"
#ERROR : Can't open dsspfile "2zukA.bssp"
#ERROR : Can't open dsspfile "3dxvB.bssp"
#ERROR : Can't open dsspfile "2hozB.bssp"
#ERROR : Can't open dsspfile "1qj3B.bssp"
#ERROR : Can't open dsspfile "2jjfA.bssp"
#ERROR : Can't open dsspfile "2hoyA.bssp"
#ERROR : Can't open dsspfile "2hp1B.bssp"
#ERROR : Can't open dsspfile "2cinA.bssp"
#ERROR : Can't open dsspfile "1qj3A.bssp"
#ERROR : Can't open dsspfile "2hoyB.bssp"
#ERROR : Can't open dsspfile "2jjeA.bssp"
#ERROR : Can't open dsspfile "2jjhA.bssp"
#ERROR : Can't open dsspfile "1qj5A.bssp"
#ERROR : Can't open dsspfile "1mlyA.bssp"
#ERROR : Can't open dsspfile "1s09A.bssp"
#ERROR : Can't open dsspfile "1qj5B.bssp"
#ERROR : Can't open dsspfile "1mlyB.bssp"
#ERROR : Can't open dsspfile "1mgvA.bssp"
#ERROR : Can't open dsspfile "1s09B.bssp"
#ERROR : Can't open dsspfile "1s08A.bssp"
#ERROR : Can't open dsspfile "1s07B.bssp"
#ERROR : Can't open dsspfile "1s07A.bssp"
#ERROR : Can't open dsspfile "1s06A.bssp"
#ERROR : Can't open dsspfile "1s0aA.bssp"
#ERROR : Can't open dsspfile "1s06B.bssp"
#ERROR : Can't open dsspfile "1s0aB.bssp"
#ERROR : Can't open dsspfile "1s08B.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "2e7uA.bssp"
#ERROR : Can't open dsspfile "3i4jB.bssp"
#ERROR : Can't open dsspfile "3i4jA.bssp"
#ERROR : Can't open dsspfile "1ohvA.bssp"
#ERROR : Can't open dsspfile "1gtxA.bssp"
#ERROR : Can't open dsspfile "2cy8A.bssp"
#ERROR : Can't open dsspfile "1wyuB.bssp"
#ERROR : Can't open dsspfile "1wytB.bssp"
#ERROR : Can't open dsspfile "1o4sB.bssp"
#ERROR : Can't open dsspfile "1o4sA.bssp"

## Summary of PDB Search
:396
    e-105  47%  2e54A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    7e-99  48%  2ordA  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    8e-92  49%  2eh6A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    8e-89  43%  2pb0B  [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE
    1e-86  43%  2pb2A  [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE
    7e-86  42%  2pb0A  [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE
    2e-85  43%  2pb2B  [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE
    2e-65  38%  1vefA  [x.x.x] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE
    9e-64  35%  2byjA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    4e-63  35%  2oatA  [c.67.1] ORNITHINE AMINOTRANSFERASE
    4e-63  35%  1gbnA  [c.67.1] ORNITHINE AMINOTRANSFERASE
    2e-62  35%  2bylA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    1e-58  35%  1z7dB  [x.x.x] ORNITHINE AMINOTRANSFERASE
    2e-58  35%  1z7dE  [x.x.x] ORNITHINE AMINOTRANSFERASE
    2e-58  35%  1z7dA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    8e-58  35%  1z7dD  [x.x.x] ORNITHINE AMINOTRANSFERASE
    5e-57  35%  1z7dC  [x.x.x] ORNITHINE AMINOTRANSFERASE
    1e-56  36%  1sffA  [c.67.1] 4-AMINOBUTYRATE AMINOTRANSFERASE
    4e-56  36%  1szuA  [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE
    6e-56  36%  1szkA  [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE
    9e-56  36%  1szsA  [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE
    1e-52  38%  2eo5A  [x.x.x] 419AA LONG HYPOTHETICAL AMINOTRANSFERASE
    4e-40  33%  1z3zA  [x.x.x] DIALKYLGLYCINE DECARBOXYLASE
    7e-40  33%  1zodA  [c.67.1 (1m0nA)] 2,2-DIALKYLGLYCINE DECARBOXYLASE
    9e-40  33%  1dgdA  [x.x.x] DIALKYLGLYCINE DECARBOXYLASE
    9e-40  33%  1d7uA  [c.67.1] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE
    1e-39  32%  3gjuA  [x.x.x] PUTATIVE AMINOTRANSFERASE
    3e-37  32%  3i5tB  [x.x.x] AMINOTRANSFERASE
    6e-37  29%  3hmuB  [x.x.x] AMINOTRANSFERASE, CLASS III
    6e-37  29%  3hmuA  [x.x.x] AMINOTRANSFERASE, CLASS III
    1e-36  32%  3i5tA  [x.x.x] AMINOTRANSFERASE
    8e-36  31%  3fcrA  [x.x.x] PUTATIVE AMINOTRANSFERASE
    2e-35  40%  2cfbA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    2e-35  34%  3bs8A  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    3e-35  31%  3du4A  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-33  36%  2zsmB  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    1e-33  36%  2zsmA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    1e-33  36%  2epjA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    2e-30  36%  3bv0B  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-30  36%  3bv0A  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-30  29%  3drdB  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-30  29%  3drdA  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-30  29%  3dodB  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-30  29%  3dodA  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    5e-30  29%  2zukB  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    9e-30  31%  3dxvA  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    2e-29  32%  2gsaA  [c.67.1] GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE
    3e-29  32%  2hozA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
    6e-29  31%  2zukA  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    8e-29  31%  3dxvB  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    1e-28  31%  2hozB  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
    2e-28  32%  1qj3B  [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE
    2e-28  30%  2jjfA  [x.x.x] L-LYSINE EPSILON AMINOTRANSFERASE
    2e-28  33%  2hoyA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
    4e-28  34%  2hp1B  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
    8e-28  29%  2cinA  [x.x.x] L-LYSINE-EPSILON AMINOTRANSFERASE
    1e-27  32%  1qj3A  [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE
    1e-27  35%  2hoyB  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
    2e-27  29%  2jjeA  [x.x.x] L-LYSINE EPSILON AMINOTRANSFERASE
    4e-27  29%  2jjhA  [x.x.x] L-LYSINE EPSILON AMINOTRANSFERASE
    5e-27  32%  1qj5A  [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE
    5e-27  32%  1mlyA  [c.67.1] 7,8-DIAMINO-PELARGONIC ACID AMINOTRANSFERASE
    7e-27  32%  1s09A  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    7e-27  32%  1qj5B  [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE
    7e-27  32%  1mlyB  [c.67.1] 7,8-DIAMINO-PELARGONIC ACID AMINOTRANSFERASE
    7e-27  32%  1mgvA  [c.67.1] 7,8-DIAMINO-PELARGONIC ACID AMINOTRANSFERASE
    9e-27  32%  1s09B  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    9e-27  30%  1s08A  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    3e-26  32%  1s07B  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    3e-26  32%  1s07A  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    3e-26  31%  1s06A  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    5e-26  31%  1s0aA  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    5e-26  31%  1s06B  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    6e-26  31%  1s0aB  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    6e-26  30%  1s08B  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-25  32%  1dtyA  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-24  33%  2e7uA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    1e-22  32%  3i4jB  [x.x.x] AMINOTRANSFERASE, CLASS III
    1e-21  32%  3i4jA  [x.x.x] AMINOTRANSFERASE, CLASS III
    2e-15  25%  1ohvA  [c.67.1] 4-AMINOBUTYRATE AMINOTRANSFERASE
    2e-15  25%  1gtxA  [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE
    3e-10  26%  2cy8A  [x.x.x] D-PHENYLGLYCINE AMINOTRANSFERASE
    3e-06  31%  1wyuB  [x.x.x] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN)
    3e-06  31%  1wytB  [x.x.x] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN)
    5e-04  26%  1o4sB  [c.67.1] ASPARTATE AMINOTRANSFERASE
    5e-04  26%  1o4sA  [c.67.1] ASPARTATE AMINOTRANSFERASE
:396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT
2e54A           ------------YLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEK
2ordA           --------------LNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEK
2eh6A           ------------YLMNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEK
2pb0B           -------------------------VKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGET
2pb2A           -------------------------VKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGET
2pb0A           -----------EVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGET
2pb2B           -------------------------VKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGET
1vefA           -----------------YNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAET
2byjA           --SDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSISAVNQGHCHPKIVNALKSQVDK
2oatA           --SDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDK
1gbnA           --SDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDK
2bylA           --SDDIFEREYKYGAHNAHPLPVALERGKGIYLWDVEGRKYFDFLSSISAVNQGHCHPKIVNALKSQVDK
1z7dB           -----------KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKN
1z7dE           -----------KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKN
1z7dA           -----------KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKN
1z7dD           -----------KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKN
1z7dC           -----------KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKN
1sffA           -SNKELMQRRSQAIPRGVGQIPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKK
1szuA           -SNKELMQRRSQAIPRGVGQIPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKK
1szkA           -SNKELMQRRSQAIPRGVGQIPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKK
1szsA           -SNKELMQRRSQAIPRGVGQIPIFADRAENCRVWDVEGREYLDFAGGQAVLNTGHLHPKVVAAVEAQLKK
2eo5A           ---------------------PLVIDHGEGVWIYDVDGNKYLDFTSGIGVNNLGWSHPEVIKIGIEQMQK
1z3zA           ---------------------PMIIERAKGSFVYDADGRAILDFTSGAMSAVLGHCHPEIVSVIGEYAGK
1zodA           ---------------------PMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGK
1dgdA           ---------------------PMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGK
1d7uA           ---------------------PMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGK
3gjuA           ------------------GESPTRIAGGEGVTVWDNNGRKSIDAFAGLYCVNVGYGRQKIADAIATQAKN
3i5tB           ------------------------LTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMV
3hmuB           ------------------------ITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRE
3hmuA           ------------------------ITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRE
3i5tA           ------------------------LTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMV
3fcrA           -----------------------------GVFIEDRDGTKLLDAFAGLYCVNVGYGRQEIAEAIADQARE
2cfbA           ---------------------PIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVGHAHPEVIDA-------
3bs8A           ---------------------PIFMERGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAE-
3du4A           --------------MKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLST
2zsmB           ---------------------PFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAV----EE
2zsmA           ---------------------PFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAV----EE
2epjA           ---------------------PFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAV----EE
3bv0B           ---------------------PVVAVAAHGAWIRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRV
3bv0A           ---------------------PVVAVAAHGAWIRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRV
3drdB           --------------MKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLST
3drdA           --------------MKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLST
3dodB           --------------MKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLST
3dodA           --------------MKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLST
2zukB           ---------------------PLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPXXXXXXXXXXXT
3dxvA           ---------------------PLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPXXXXXXXXXXXT
2gsaA           ------------------GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKV
2hozA           ------------------GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKV
2zukA           ---------------------PLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPXXXXXXXXXXXT
3dxvB           ---------------------PLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPXXXXXXXXXXXT
2hozB           ------------------GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKV
1qj3B           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
2jjfA           ------------------------LTRSGGSYLVDATGRRYLDMFTFVASSALGEFHAELMQAALNKPSN
2hoyA           ------------------GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKV
2hp1B           ------------------GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKV
2cinA           ------------------------LTRSGGSYLVDATGRRYLDMFTFVASSALGEFHAELMQAALNKPSN
1qj3A           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
2hoyB           ------------------GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKV
2jjeA           ------------------------LTRSGGSYLVDATGRRYLDMFTFVASSALGEFHAELMQAALNKPSN
2jjhA           ------------------------LTRSGGSYLVDATGRRYLDMFTFVASSALGEFHAELMQAALNKPSN
1qj5A           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1mlyA           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1s09A           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1qj5B           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1mlyB           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1mgvA           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1s09B           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1s08A           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1s07B           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1s07A           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1s06A           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1s0aA           ------LAFDQRHILHPFTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1s06B           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1s0aB           ------LAFDQRHILHPFTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1s08B           ------LAFDQRHILHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
1dtyA           ------LAFDERHIWHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
2e7uA           ------------------GGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILGHAHPKVLARVRETLER
3i4jB           -------------------------VRGEGVFLYDDAGRRYLDGSSGALVANIGHGRAEVGERMAAQAAR
3i4jA           -------------------------VRGEGVFLYDDAGRRYLDGSSGALVANIGHGRAEVGERMAAQAAR
1ohvA           --------------------------ESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPALVKLVQQNVST
1gtxA           --------------------------ESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPALVKLVQQNVST
2cy8A           ----------------------------QGVHKTDVDGNVYLDFFXXXXXXXXXXXXPRVNAAIAEALSA
1wyuB           ----------------------------------------------------------------------
1wytB           ----------------------------------------------------------------------
1o4sB           ----------------------------------------------------------------------
1o4sA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG
2e54A           LIHCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARXXXXXXXXXX-YRILSAHNSFHG
2ordA           LIHCSNLFWNRPQ-ELAELLSKNTFGGKVFFANTGTEANEAAIKIAR-XXXXXXXXXXYRILSAHNSFHG
2eh6A           LLHVSNLYENPWQEELAHKLVKHFWTEKVFFANSGTESVEAAIKLARKYWRDK-GKNKWKFISFENSFHG
2pb0B           LWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHG
2pb2A           LWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHG
2pb0A           LWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHG
2pb2B           LWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHG
1vefA           LMAMPQTLPTPMRGEFYRTLILPPELNRVFPVNSGTEANEAALKFARA----HTGRKKF--VAAMRGFSG
2byjA           LTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKIVFAAGNFWG
2oatA           LTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKIVFAAGNFWG
1gbnA           LTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKIVFAAGNFWG
2bylA           LTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKIVFAAGNFWG
1z7dB           LTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKYEVKKIPENMAKIVVCKNNF--
1z7dE           LTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWG--------YEV---------
1z7dA           LTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKYEVKKIPENMAKIVVCKNN---
1z7dD           LTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWG--------YEVKKIPEN---
1z7dC           LTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWG--------YEV---------
1sffA           LSHCFQVLAYEPYLELCEIMVPGDFAKKTLLVTTGSEAVENAVKIARAATKRS------GTIAFSGAYHG
1szuA           LSHCFQVLAYEPYLELCEIMVPGDFAKKTLLVTTGSEAVENAVKIARAATKRS------GTIAFSGAYHG
1szkA           LSHCFQVLAYEPYLELCEIMVPGDFAKKTLLVTTGSEAVENAVKIARAATKRS------GTIAFSGAYHG
1szsA           LSHCFQVLAYEPYLELCEIMVPGDFAKKTLLVTTGSEAVENAVKIARAATKRS------GTIAFSGAYHG
2eo5A           LAHAANDFYNIPQLELAKKLVTYSPGNKVFFSNSGTEAIEASIKVVKNTGRKY-------IIAFLGGFHG
1z3zA           LDHLFSEMLSRPVVDLATRLITPPGLDRALLLSTGAESNEAAIRMAK------LVTGKYEIVGFAQSWHG
1zodA           LDHLFSEMLSRPVVDLATRLITPPGLDRALLLSTGAESNEAAIRMAK------LVTGKYEIVGFAQSWHG
1dgdA           LDHLFSGMLSRPVVDLATRLITPPGLDRALLLSTGAESNEAAIRMAK------LVTGKYEIVGFAQSWHG
1d7uA           LDHLFSGMLSRPVVDLATRLITPPGLDRALLLSTGAESNEAAIRMAK------LVTGKYEIVGFAQSWHG
3gjuA           LAHAYVGHGTEASITLAKIIDRAPKGSRVYFGLSGSDANETNIKLIWYYNNVLGRPEKKKIISRWRGYHG
3i5tB           LPYASPWYMASPAARLAEKIATLTPGDRIFFTTGGSTAVDSALRFSEFYNNVLGRPQKKRIIVRYDGYHG
3hmuB           LPYYNTFFKTTPAIALAQKLAELAPGDHVFFAGGGSEANDTNIRMVRTYWQNKGQPEKTVIISRKNAYHG
3hmuA           LPYYNTFFKTTPAIALAQKLAELAPGDHVFFAGGGSEANDTNIRMVRTYWQNKGQPEKTVIISRKNAYHG
3i5tA           LPYASPWYMASPAARLAEKIATLTPGDRIFFTTGGSTAVDSALRFSEFYNNVLGRPQKKRIIVRYDGYHG
3fcrA           LAYYHSYHGTEASITLAKILDRAPKNSKVYFGLGGSDANETNVKLIWYYNNILGRPEKKKIISRWRGYHX
2cfbA           -LHAA----LEKGTSFAPCLLENILAEMVIFVNSGTEACMAVLRLMRAYTQRE------KVIKFEGCYHG
3bs8A           -YGTSFGAPTEVENELAKLVIDRPSVEIVRMVSSGTEATMSALRLARGYTGRN------KILKFEGCYHG
3du4A           LLGMTNV----PATQLAETLIDISPKKRVFYSDSGAEAMEIALKMAFQYWKNIGKPEKQKFIAMKNGYHG
2zsmB           ALARGWLYGAEAEVLLAKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDL------ILKFDGCYHG
2zsmA           ALARGWLYGAEAEVLLAKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDL------ILKFDGCYHG
2epjA           ALARGWLYGAEAEVLLAKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDL------ILKFDGCYHG
3bv0B           MNHVMGGLTHEPAARLAKLLVDITPADTVFFSDSGSVSVEVAAKMALQYWRGRGLPGKRRLMTWRGGYHG
3bv0A           MNHVMGGLTHEPAARLAKLLVDITPADTVFFSDSGSVSVEVAAKMALQYWRGRGLPGKRRLMTWRGGYHG
3drdB           LLGMTNV----PATQLAETLIDISPKKRVFYSDSGAEAMEIALKMAFQYWKNIGKPEKQKFIA-------
3drdA           LLGMTNV----PATQLAETLIDISPKKRVFYSDSGAEAMEIALKMAFQYWKNIGKPEKQKFIA-------
3dodB           LLGMTNV----PATQLAETLIDISPKKRVFYSDSGAEAMEIALKMAFQYWKNIGKPEKQKFIA-------
3dodA           LLGMTNV----PATQLAETLIDISPKKRVFYSDSGAEAMEIALKMAFQYWKNIGKPEKQKFIA-------
2zukB           ILSASN----APAVTLAERLLASFPGEKIWFGHSGSDANEAAYRAIVK------ATGRSGVIAFAGAYHG
3dxvA           ILSASNA----PAVTLAERLLASFPGEKIWFGHSGSDANEAAYRAIVK------ATGRSGVIAFAGAYHG
2gsaA           AMEKGTSFGAPCALENVLAEMVNDAVEMVRFVNSGTEACMAVLRLMRAYT----GRDK--IIKFEGCYHG
2hozA           AMEKGTSFGAPCALENVLAEMVNDAVEMVRFVNSGTEACMAVLRIMRAYT----GRDK--IIKFEGCYHG
2zukA           ILSASNA----PAVTLAERLLASFPGEKIWFGHSGSDANEAAYRAIVK------ATGRSGVIAFAGAYHG
3dxvB           ILSASNA----PAVTLAERLLASFPGEKIWFGHSGSDANEAAYRAIVK------ATGRSGVIAFAGAYHG
2hozB           AMEKGTSFGAPCALENVLAEMVNDAVEMVRFVNSGTEACMAVLRIMRAYT----GRDK--IIKFEGCYHG
1qj3B           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
2jjfA           ----SDVYSVAMAVETFARVLGDPALPHLFFVEGGALAVENALKAAFDWKSRHNGIDPAQVLHLRGAFHG
2hoyA           AMEKGTSFGAPCALENVLAEMVNDAVEMVRFVNSGTEACMAVLRIMRAYT----GRDK--IIKFEGCYHG
2hp1B           AMEKGTSFGAPCALENVLAEMVNDAVEMVRFVNSGTEACMAVLRIMRAYT----GRDK--IIKFEGCYHG
2cinA           ----SDVYSVAMAVETFARVLGDPALPHLFFVEGGALAVENALKAAFDWKSRHNGIDPAQVLHLRGAFHG
1qj3A           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
2hoyB           AMEKGTSFGAPCALENVLAEMVNDAVEMVRFVNSGTEACMAVLRIMRAYT----GRDK--II----KFEG
2jjeA           ----SDVYSVAMAVETFARVLGDPALPHLFFVEGGALAVENALKAAFDWKSRHNGIDPAQVLHLRGAFHG
2jjhA           ----SDVYSVAMAVETFARVLGDPALPHLFFVEGGALAVENALKAAFDWKSRHNGIDPAQVLHLRGAFHG
1qj5A           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
1mlyA           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
1s09A           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGFHG
1qj5B           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
1mlyB           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
1mgvA           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
1s09B           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGFHG
1s08A           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
1s07B           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
1s07A           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
1s06A           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
1s0aA           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
1s06B           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
1s0aB           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
1s08B           MSHVMGGITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYW-QAKGEARQRFLTFRNGYHG
1dtyA           MSHVMGEITHAPAIELCRKLVAMTPQECVFLADSGSVAVEVAMKMALQYWDAK-GEARDRFLTFRNGYHG
2e7uA           GLTFGAPSPLE--VALAKKVKRYPFVDLVRFVNSGTEATMSALRLARGYT------GRPYIVKFRGNYHG
3i4jB           LVHGSQFVLEEYAGRLARFV--GLPTFRFWAVSGGSEATESAVKLARQYHVERGEPGRFKVITRVPS---
3i4jA           LVHGSQFVLEEYAGRLARFV--GLPTFRFWAVSGGSEATESAVKLARQYHVERGEPGRFKVITRVPS---
1ohvA           FINRPALGILPPENFVEKLRVAPKGMSQLITMACGSCSNENAFKTISAFSKEELGCPDYSILSFMGAFHG
1gtxA           FINRPALGILPPENFVEKLRVAPKGMSQLITMACGSCSNENAFKTISAFSKEELGCPDYSILSFMGAFHG
2cy8A           ASHPLEVRWAE------RIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRM----------ILRFEG
1wyuB           ---------------------------------AGAHGELTGILIIRAYHEDRGEGRTRRVVLVPDSAHG
1wytB           ---------------------------------AGAHGELTGILIIRAYHEDRGEGRTRRVVLVPDSAHG
1o4sB           ----------------------------------------------------------------------
1o4sA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVK
2e54A           RTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRKMSEDVCAVFLEPIQGESGIVPATKEFLEEAR
2ordA           RTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRK-SEDVCAVFLEPIQGESGIVPATKEFLEEAR
2eh6A           RTYGSLSATGQPKFHKGFEPLVPGFSYAKLNDIDSVYKLLDEETAXXXXXXXXXXXXXNEASEDFLSKLQ
2pb0B           RSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEPIQGEGGVQAATPEFLKGLR
2pb2A           RSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEPIQGEGGVQAATPEFLKGLR
2pb0A           RSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEPIQGEGGVQAATPEFLKGLR
2pb2B           RSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEPIQGEGGVQAATPEFLKGLR
1vefA           RTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEPVQGEGGVRPATPEFLRAAR
2byjA           RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALDPNVAAFMVEPIQGEAGVVVPDPGYLMGVR
2oatA           RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALDPNVAAFMVEPIQGEAGVVVPDPGYLMGVR
1gbnA           RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALDPNVAAFMVEPIQGEAGVVVPDPGYLMGVR
2bylA           RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALDPNVAAFMVEPIQGEAGVVVPDPGYLMGVR
1z7dB           -------------------------SKVPYXXXXXXXXXXXPNVCAFIVEPIQGEAGVIVPSDNYLQGVY
1z7dE           -----------KKIPENMAKIVVCFSKVPYXXXXXXXXXXXPNVCAFIVEPIQGEAGVIVPSDNYLQGVY
1z7dA           -----------------------QFSKVPYXXXXXXXXXXXPNVCAFIVEPIQGEAGVIVPSDNYLQGVY
1z7dD           --MAKIVVCK--------------FSKVPYXXXXXXXXXXXPNVCAFIVEPIQGEAGVIVPSDNYLQGVY
1z7dC           ------------------KKIPENMAKIVVXXXXXXXXXXXPNVCAFIVEPIQGEAGVIVPSDNYLQGVY
1sffA           RTHYTLALTGKVNYSAGMGLMP-GHVYCPLHGISEFKNDAAPEDAAIVIEPVQGEGGFYASSPAFMQRLR
1szuA           RTHYTLALTGKVNYSAGMGLMP-GHVYCPLHGISEFKNDAAPEDAAIVIEPVQGEGGFYASSPAFMQRLR
1szkA           RTHYTLALTGKVNYSAGMGLMP-GHVYCPLHGISEFKNDAAPEDAAIVIEPVQGSGGFYASSPAFMQRLR
1szsA           RTHYTLALTGKVNYSAGMGLMP-GHVYCPLHGISEFKNDAAPEDAAIVIEPVQGEGGFYASSPAFMQRLR
2eo5A           RTFGSISLTASKAVQRSIGPFMPGVIHVPYNPSELVNNLVPPEEVAIFFEPIQGEGGYVIPPKNFFAELQ
1z3zA           MXXXXXXXXXXXX-RKGVGPIPAPFTYRPRFEFDLIDRQSSGNLAAFIAEPILSSGGIIELPDGYMAALK
1zodA           MXXXXXXXXXXXX-RKGVGPIPAPFTYRPRFEFDLIDRQSSGNLAAFIAEPILSSGGIIELPDGYMAALK
1dgdA           MXXXXXXXXXXXX-RKGVGPIPAPFTYRPRFEFDLIDRQSSGNLAAFIAEPILSSGGIIELPDGYMAALK
1d7uA           MXXXXXXXXXXXX-RKGVGPIPAPFTYRPRFEFDLIDRQSSGNLAAFIAEPILSSGGIIELPDGYMAALK
3gjuA           SGV-TGSLTGLDLFHNAFD-LPRAFSQHCADKLEEILAE-GPETIAAFIEPILGTGGIVPPPAGYWEKIQ
3i5tB           STALTAACTGRTGNWPNFDPNPEAFLDDLVQEFEDRIESLGPDTIAAFLEPILASGGVIIPPAGYHARFK
3hmuB           STVASSALGGMAGMQSGLIPINQPNWWAEGGDMDPXXXXXXXRVAAFIAEPVQGAGGVIVAPDSYWPEIQ
3hmuA           STVASSALGGMAGMQSGLIPINQPNWWAEGGDMDPXXXXXXXRVAAFIAEPVQGAGGVIVAPDSYWPEIQ
3i5tA           STALTAACTGRTGNWPNFDPNPEAFLDDLVQEFEDRIESLGPDTIAAFLEPILASGGVIIPPAGYHARFK
3fcrA           XXXXXXXXXXXXXFHKKFDEAPYYFRREDLNELEALIEREGADTIAAFIEPILGTGGIVPPPAGYWEAIQ
2cfbA           HA-ATLTA--------------------PYNDLEAVSRLFEQYIAGVILEPVVGNAGFIPPDAGFLEGLR
3bs8A           HGDSLLIKAGSGVATLGLPDVPEGIAKVPYNDLESVKQQFGEDIAGVIVEPVAGNMGVVPPQEGFLQGLR
3du4A           DTIGAVSVGSIELFHHVYGPLMFESYKAPIPYVYRSESG-DPDECRXXXSMVQGASGMIVMPEGYLAGVR
2zsmB           SHDAVLVAAGGVPTSAGVPEAVARLTLVPYNDVEALERVFGDRIAGVIVEPVIANAGVIPPRREFLAALQ
2zsmA           SHDAVLVAAGGVPTSAGVPEAVARLTLVPYNDVEALERVFGDRIAGVIVEPVIANAGVIPPRREFLAALQ
2epjA           SHDAVLVAAGGVPTSAGVPEAVARLTLVPYNDVEALERVFGDRIAGVIVEPVIANAGVIPPRREFLAALQ
3bv0B           DTFLAMSICDPHGGMHSLDVLAQVFAPQVPRDYDAFEAQLAQHAAAVVVEPVQGAGGMRFHDPRYLHDLR
3bv0A           DTFLAMSICDPHGGMHSLDVLAQVFAPQVPRDYDAFEAQLAQHAAAVVVEPVQGAGGMRFHDPRYLHDLR
3drdB           --MKSYKAPIPYVYRSESGDPDECRDQCXXXXXXXXXXXXXXXXXXSIESMVQGASGMIVMPEGYLAGVR
3drdA           --MKSYKAPIPYVYRSESGDPDECRDQCXXXXXXXXXXXXXXXXXXSIESMVQGASGMIVMPEGYLAGVR
3dodB           --MKSYKAPIPYVYRSESGDPDECRDQCXXXXXXXXXXXXXXXXXXSIESMVQGASGMIVMPEGYLAGVR
3dodA           --MKSYKAPIPYVYRSESGDPDECRDQCXXXXXXXXXXXXXXXXXXSIESMVQGASGMIVMPEGYLAGVR
2zukB           CTVGSMAFSGHADGLILLXXXXXXXXXXXXXTGDAILTLLTEKLAAVFIEPIQSDGGLIVPPDGFLRKFA
3dxvA           CTVGSMAFSGLILLXXXLTLLTEKLAAVP-------AGSIG----AAFIEPIQSDGGLIVPPDGFLRKFA
2gsaA           HADMFLVKAGSGVATLGLPSSPANTLTTPYNDLEAVKALFAENIAGVILEPIVGNSGFIVPDAGFLEGLR
2hozA           HADMFLVKAGSGVATLGLPSSPANTLTTPYNDLEAVKALFAENIAGVILEPIVGNSGFIVPDAGFLEGLR
2zukA           CTVGSMAXTGDAI----LTLLTEKLAAVP-------AGSIG----AAFIEPIQSDGGLIVPPDGFLRKFA
3dxvB           CTVGSMAFSGHSVQADALTLLTEKLAAVP-------AGSIG----AAFIEPIQSDGGLIVPPDGFLRKFA
2hozB           HADMFLVKAGLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENIAGVILEPIVGNSGFIVPDAGFLEGLR
1qj3B           DTFGAMSVCDPDNLPENLAPAPQSRMEWDERDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
2jjfA           RSGYTLSLTNDAPYMRGLDEPXXXXXXXXXXXXXXXXFETRPHDIACFVEPIQGEGGDRHFRPEFFAAMR
2hoyA           HADMANTLT------------------TPYNDLEAVKALFAENIAGVILEPIVGNSGFIVPDAGFLEGLR
2hp1B           HNTLT----------------------TPYNDLEAVKALFAENIAGVILEPIVGNSGFIVPDAGFLEGLR
2cinA           RSGYTLSLTNDAPYMRGLDEPXXXXXXXXXXXXXXXXFETRPHDIACFVEPIQGEGGDRHFRPEFFAAMR
1qj3A           DTFGAMSVCDPDNLPENLAPAPQSMGEWDERDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
2hoyB           NTLTT-----------------------PYNDLEAVKALFAENIAGVILEPIVGNSGFIVPDAGFLEGLR
2jjeA           RSGYTLSLTNDAPYMRGLDEPXXXXXXXXXXXXXXXXFETRPHDIACFVEPIQGEGGDRHFRPEFFAAMR
2jjhA           RSGYTLSLTNDAPYMRGLDEPXXXXXXXXXXXXXXXXFETRPHDIACFVEPIQGAGGDRHFRPEFFAAMR
1qj5A           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1mlyA           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1s09A           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1qj5B           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1mlyB           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1mgvA           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1s09B           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1s08A           NTFGAMSVCDPENL---FAPAPQSMGEWDERDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1s07B           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1s07A           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1s06A           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1s0aA           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1s06B           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1s0aB           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1s08B           NTFGAMSVCDPNLFA----PAPQSRMDGEWDDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
1dtyA           DTFGAMSVCDPDNSMHSLGYLPENFAPAPQSDMVGFARLMAAHRAAVIIEPVQGAGGMRMYHPEWLKRIR
2e7uA           HADGLLVEAGSGALTLGVPSVPEEYAVLEYNDPEGLREVLGEEIAAIIFEPVVGNAGVLVPTEDFLKALH
3i4jB           RELYTPLMRPEA-WPKLPKPDPARNGAEDAEGLRALLEREGPETAAFMAEPVVGSDAALAPAPGYYERVR
3i4jA           ---------RPEAWPKLPKPDPARNGAEDAEGLRALLEREGPETAAFMAEPVVGSDAALAPAPGYYERVR
1ohvA           RTMGCL-ATTHSKAIHKIDIPSFDWPIAPFRCLEEVEDLIVKYVAGIIVEPIQSEGGDNHASDDFFRKLR
1gtxA           RTMGCL-ATTHSKAIHKIDIPSFDWPIAPFRCLEEVEDLIVKYVAGIIVEPIQSEGGDNHASDDFFRKLR
2cy8A           TTANTLL--------------------IRPDDIEGMREVFANHIAAFIAEPVGSHFGVTPVSDSFLREGA
1wyuB           SNPATASMAG---YQREIPSGPEGEV-----DLEALKRELGPHVAALMLT----NPNTLGLFERRILEIS
1wytB           SNPATASMAG---YQREIPSGPEGEV-----DLEALKRELGPHVAALMLT----NPNTLGLFERRILEIS
1o4sB           --------------------------------LEEVEGLLVGKTKAVLINSPNNPTGVVYRRE-FLEGLV
1o4sA           --------------------------------LEEVEGLLVGKTKAVLINSPNNPTGVVYRRE-FLEGLV


                         .         .         .         +         .         .         .:280
query           QLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHAS
2e54A           KLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAKGLGGGVPIGAVIVNER-ANVLEPGDHGT
2ordA           KLCDEYDALLVFDEVQCG-GRTGKLFAYQKYGVVPDVLTTAKGLGGGVPIGAVIVNER-ANVLEPGDHGT
2eh6A           EICKEKDVLLIIDEVQTGIGRTGEFYAYQHFNLKPDVIALAKGLGGGVPIGAILAREEVAQSFTPGSHGS
2pb0B           DLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAFHVGSHGS
2pb2A           DLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAF----HGS
2pb0A           DLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAF-----GS
2pb2B           DLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAF------S
1vefA           EITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTXXXXXXXXXXXXXXXMREEVARSMPKGGHGT
2byjA           ELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGYPVSAVLCDDDIMLTIKPGEHGS
2oatA           ELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGYPVSAVLCDDDIMLTIKPGEHGS
1gbnA           ELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGYPVSAVLCDDDIMLTIKPGEHGS
2bylA           ELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGYPVSAVLCDDDIMLTIKPGEHFS
1z7dB           DICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVILLGKALSGGYPISAVLANDDIMLVIKPGEHGS
1z7dE           DICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVILLGKALSGGYPISAVLANDDIMLVIKPGEHGS
1z7dA           DICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVILLGKALSGGYPISAVLANDDIMLVIKPGEHGS
1z7dD           DICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVILLGKALSGGYPISAVLANDDIMLVIKPGEHGS
1z7dC           DICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVILLGKALSGGYPISAVLANDDIMLVIKPGEHGS
1sffA           ALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGG
1szuA           ALCDEHGIMLIADEAQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGG
1szkA           ALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGG
1szsA           ALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGG
2eo5A           KLAKKYGILLVDDEVQMGLGRTGKLFAIENFNTVPDVITLAKALGGGMPIGATIFRKDL--------DFK
1z3zA           RKCEARGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLT
1zodA           RKCEARGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLT
1dgdA           RKCEARGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLT
1d7uA           RKCEARGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLT
3gjuA           AVLKKYDVLLVADEVVTGFGRLGTF-GSDHYGIKPDLITIAKGLTSAYPLSGVIVADRVWQVLVQGSHGW
3i5tB           AICEKHDILYISDEVVTGFGRCGEFASEKVFGVVPDIITFAKGVTSGYPLGGLAISEAVLARIS-GENAK
3hmuB           RICDKYDILLIADEVICGFGRTGNWFGTQTMGIRPHIMTIAKGLSSGYPIGGSIVCDEVAHVIGKDEHGY
3hmuA           RICDKYDILLIADEVICGFGRTGNWFGTQTMGIRPHIMTIAKGLSSGYPIGGSIVCDEVAHVIGKDEHGY
3i5tA           AICEKHDILYISDEVVTGFGRCGEFASEKVFGVVPDIITFAKGVTSGYPLGGLAISEAVLARIS-GENAK
3fcrA           TVLNKHDILLVADEVVTGFGRLGTF-GSDHYGLEPDIITIAKGLTSAYPLSGSIVSDKVWKVLEQGGHGW
2cfbA           ELTKQYGALLVFDEVMTGF-RIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAPA--GP
3bs8A           DITEQYGSLLIFDEVMTGF-RVDYNCAQGYFGVTPDLTCLGKVIGGGLPVGAYGGKAEIMEQIAPSGQAG
3du4A           ELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYPIAVTFATEDIYKAFKTFFHGH
2zsmB           RLSRESGALLILDEVVTGF-RLGLEGAQGYFNIEGDIIVLGKIIGGGFPVGAVAGSREVMSLLTPQGNAG
2zsmA           RLSRESGALLILDEVVTGF-RLGLEGAQGYFNIEGDIIVLGKIIGGGFPVGAVAGSREVMSLLTPQGNAG
2epjA           RLSRESGALLILDEVVTGF-RLGLEGAQGYFNIEGDIIVLGKIIGGGFPVGAVAGSREVMSLLTPQGNAG
3bv0B           DICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYSLAATLCTADVAHTISAG---P
3bv0A           DICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYSLAATLCTADVAHTISAG---P
3drdB           ELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYPIAVTFATEDIYKAFKTFFHGH
3drdA           ELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYPIAVTFATEDIYKAFKTFFHGH
3dodB           ELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYPIAVTFATEDIYKAFKTFFHGH
3dodA           ELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYPIAVTFATEDIYKAFKTFFHGH
2zukB           DICRAHGILVVCDEVKVGLARSGRLHCFEHEGFVPDIXXXXXXXXXXXXXSAVIAPAEIASAFA----MQ
3dxvA           DICRAHGILVVCDEVKVGLARSGRLHCFEHEGFVPDIXXXXXXXXXXXXXSAVIAPAEIASAFA----MQ
2gsaA           EITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTPDXXXXXXXXXXXXPVGAYGGKREIMQLVAPAGQAG
2hozA           EITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTPDXXXXXXXXXXXXPVGAYGGKREIMQLVAPAGQAG
2zukA           DICRAHGILVVCDEVKVGLARSGRLHCFEHEGFVPDIXXXXXXXXXXXXXSAVIAPAEIASAFA----MQ
3dxvB           DICRAHGILVVCDEVKVGLARSGRLHCFEHEGFVPDIXXXXXXXXXXXXXSAVIAPAEIASAFA----MQ
2hozB           EITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTPDXXXXXXXXXXXXPVGAYGGKREIMQLVAPAGQAG
1qj3B           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALGGTMTLSATLTTREVAETISNGGHGP
2jjfA           ELCDEFDALLIFDEVQTGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVDEVADNVFAPSRLAS
2hoyA           EITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTPDXXXXXXXXXXXXPVGAYGGKREIMQLVAPAGQAG
2hp1B           EITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTPDXXXXXXXXXXXXPVGAYGGKREIMQLVAPAGQAG
2cinA           ELCDEFDALLIFDEVQTGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVDEVADNVFAPSRLNS
1qj3A           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALGGTMTLSATLTTREVAETISNGGHGP
2hoyB           EITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTPDXXXXXXXXXXXXPVGAYGGKREIMQLVAPAGQAG
2jjeA           ELCDEFDALLIFDEVQTGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVDEVADNVFAPSRLNS
2jjhA           ELCDEFDALLIFDEVQTGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVDEVADNVFAPSRLNS
1qj5A           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALGGTMTLSATLTTREVAETISNGEHGP
1mlyA           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALGGTMTLSATLTTREVAETISNGEHGP
1s09A           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGEHGP
1qj5B           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALGGTMTLSATLTTREVAETISNGEHGP
1mlyB           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALGGTMTLSATLTTREVAETISNGEHGP
1mgvA           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALGGTMTLSATLTTREVAETISNGEHGP
1s09B           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGEHGP
1s08A           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGMHGP
1s07B           KICDREGILLIADEIATGFGATGKLFACEHAEIAPDILCLGKALGGTMTLSATLTTREVAETISNGEHGP
1s07A           KICDREGILLIADEIATGFGATGKLFACEHAEIAPDILCLGKALGGTMTLSATLTTREVAETISNGEHGP
1s06A           KICDREGILLIADEIATGFGKTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGEHGP
1s0aA           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGEHGP
1s06B           KICDREGILLIADEIATGFGKTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGEHGP
1s0aB           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGEHGP
1s08B           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNFMHGP
1dtyA           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALGGTMTLSATLTTREVAETISDGEHGP
2e7uA           E-AKAYGVLLIADEVMTGF-RLAFGGATELLGLKPDLVTLGKIXXXXXXXXXXXXRREIMEKVAPLGQAG
3i4jB           DICDEAGIIFIADEVMSGMGRCGSPLALSRWGVTPDIVXXXXXXXXXXXXXXXXXXPQVYETVMGGMHGF
3i4jA           DICDEAGIIFIADEVMSGMGRCGSPLALSRWGVTPDIVXXXXXXXXXXXXXXXXXXPQVYETVMGGSHGF
1ohvA           DISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGLDADVMTFSKKM----MTGGFFHKEEF-RPNAPYRIFN
1gtxA           DISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGLDADVMTFSKKM----MTGGFFHKEEF-RPNAPYRIFN
2cy8A           ELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAXXXXXXXXXXREDVMGVLSRG----
1wyuB           RLCKEAGVQLYYD---------------------------------------------------------
1wytB           RLCKEAGVQLYYD---------------------------------------------------------
1o4sB           RLAKKRNFYIISDEVYDSLVYTDEFTSILDVSEGFDRIVYINGFSTGWRVGYLISSEKVATAVSKIQSHT
1o4sA           RLAKKRNFYIISDEVYDSLVYTDEFTSILDVSEGFDRIVYINGFSTGWRVGYLISSEKVATAVSKIQSHT


                         .         *         .         .         .         .         +:350
query           TFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDI
2e54A           TFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMKEEYDVVADVRGLMIGIQFREEVSNREV
2ordA           TFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLKKLQEK--EEYDVVADVRGGLIGIQFREEVSNREV
2eh6A           TFGGNPLACRAGTVVVDEV--EKLLPHVREVGNYFKE-----XXXXXXXXXXXXXXXXXXXXXXXXCKDY
2pb0B           TYGGNPLACAVAGAAFDIINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKDF
2pb2A           TYGGNPLACAVAGAAFDIINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKDF
2pb0A           TYGGNPLACAVAGAAFDIINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKDF
2pb2B           TYGGNPLACAVAGAAFDIINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKDF
1vefA           TFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPS--PKIREVRGMGLMVGLELKEKAAPY
2byjA           TYGGNPLGCRXXXXXXXXXXXXXXXXXXDKLGIILRNELMKLPSDV--VTAVRGKGLLNAIVIKETKDDA
2oatA           TYGGNPLGCRXXXXXXXXXXXXXXXXXXDKLGIILRNELMKLPSDV--VTAVRGKGLLNAIVIKETKDDA
1gbnA           TYGGNPLGCRXXXXXXXXXXXXXXXXXXDKLGIILRNELMKLPSDV--VTAVRGKGLLNAIVIKETKDDA
2bylA           TYGGNPLGCRXXXXXXXXXXXXXXXXXXDKLGIILRNELMKLPSDV--VTAVRGKGLLNAIVIKETKDDA
1z7dB           TYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVNV
1z7dE           TYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVNV
1z7dA           TYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVNV
1z7dD           TYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVNV
1z7dC           TYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVNV
1sffA           TYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRFEDGDHNKPDAKLTAEI
1szuA           TYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRFEDGDHNKPDAKLTAEI
1szkA           TYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRFEDGDHNKPDAKLTAEI
1szsA           TYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRFEDGDHNKPDAKLTAEI
2eo5A           TFGGNALACAIGSKVID--IVKDLLPHVNEIGKIFAEELQGLADDVRGI----GLAWGLEYNEKKVRDRI
1z3zA           THVSDPLPAAVGLRVLDVVQRDGLVARANVMXXXXXXXXXXXMERFDCIGDXXXXXXXXXXEIVKDRRKI
1zodA           THVSDPLPAAVGLRVLDVVQRDGLVARANVMXXXXXXXXXXXMERFDCIGDXXXXXXXXXXEIVKDRRKI
1dgdA           THVSDPLPAAVGLRVLDVVQRDGLVARANVMXXXXXXXXXXXMERFDCIGDXXXXXXXXXXEIVKDRRKI
1d7uA           THVSDPLPAAVGLRVLDVVQRDGLVARANVMXXXXXXXXXXXMERFDCIGDXXXXXXXXXXEIVKDRRKI
3gjuA           TYSAHPICVAAGVANLE-LIDEDLVTNAGETGAYFRAELAKAVGGHKNVGEVRGDGLAAVEFVADKDDRV
3i5tB           TYSNQPVACAAALANIELMEREGIVDQAREMADYFAAALASL-RDLPGVAETRSVGLVGCVQCLLGTAEI
3hmuB           TYSGHPVAAAVAXXXXXXXXXXXXXDHVRNVAAPYLKEKWEALTDHPLVGEAKIVGMMASIALTPNKASR
3hmuA           TYSGHPVAAAVAXXXXXXXXXXXXXDHVRNVAAPYLKEKWEALTDHPLVGEAKIVGMMASIALTPNKASR
3i5tA           TYSNQPVACAAALANIELMEREGIVDQAREMADYFAAALASL-RDLPGVAETRSVGLVGCVQCLLDGTKI
3fcrA           TYSAHPIGAAAGVANLKLLDELNLVSNAGEVGAYLNATAEALSCAVEFVKD--RDSRTFFDAADKIGPQI
2cfbA           TLSGNPLAMTAGIKTLEILSRPGSYEH-------------------------------------------
3bs8A           TLSGNPLAMTAGLETLKQLTPDS-YKNFIKKGDRLEEGISKAA---------------------------
3du4A           SYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMCGAELVRSKEKV
2zsmB           TFNAHPITMAAGLATLKALEEEPV----------------------------------------------
2zsmA           TFNAHPITMAAGLATLKALEEEPV----------------------------------------------
2epjA           TFNAHPITMAAGLATLKALEEEPV----------------------------------------------
3bv0B           TFMANPLACAVSVASVELLL--------------------------------------------------
3bv0A           TFMANPLACAVSVASVELLL--------------------------------------------------
3drdB           SYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMCGAELVRSKEKV
3drdA           SYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMCGAELVRSKEKV
3dodB           SYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMCGAELVRSKEKV
3dodA           SYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMCGAELVRSKEKV
2zukB           TLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCDRQSL
3dxvA           TLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCDRQSL
2gsaA           TLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQE-------------------------
2hozA           TLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQE-------------------------
2zukA           TLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCDRQSL
3dxvB           TLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCDRQSL
2hozB           TLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQE-------------------------
1qj3B           TFMGNP----------------------------------------------------------------
2jjfA           TWGGNLTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFPAVPRGRGLMCAFSLPTTADRDEL
2hoyA           TLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQE-------------------------
2hp1B           TLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQE-------------------------
2cinA           TWGGNLTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFPAVPRGRGLMCAFSLPTTADRDEL
1qj3A           TFMGNP----------------------------------------------------------------
2hoyB           TLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQE-------------------------
2jjeA           SWGGNLTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFPAVPRGRGLMCAFSLPTTADRDEL
2jjhA           TWGGNLTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFPAVPRGRGLMCAFSLPTTADRDEL
1qj5A           TFMGNP----------------------------------------------------------------
1mlyA           TFMGNP----------------------------------------------------------------
1s09A           TFMGNP----------------------------------------------------------------
1qj5B           TFMGNP----------------------------------------------------------------
1mlyB           TFMGNP----------------------------------------------------------------
1mgvA           TFMGNP----------------------------------------------------------------
1s09B           TFMGNP----------------------------------------------------------------
1s08A           TFMGNP----------------------------------------------------------------
1s07B           TFMGNP----------------------------------------------------------------
1s07A           TFMGNP----------------------------------------------------------------
1s06A           TFMGNP----------------------------------------------------------------
1s0aA           TFMGNP----------------------------------------------------------------
1s06B           TFMGNP----------------------------------------------------------------
1s0aB           TFMGNP----------------------------------------------------------------
1s08B           TFMGNP----------------------------------------------------------------
1dtyA           TFMGNP----------------------------------------------------------------
2e7uA           TLSGNP----------------------------------------------------------------
3i4jB           TYAGHPVSVAAGLSVLD-----------------------------------------------------
3i4jA           TYAGHPVSVAAGLSVLD-----------------------------------------------------
1ohvA           TWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYPFISRVRGTFCSFDTPDESIRNKL
1gtxA           TWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYPFISRVRGTFCSFDTPDESIRNKL
2cy8A           SFTGNPXXXXXXXXXXXXXLEDDVCAKINDLGQFAREAMNHLFA--------------------------
1wyuB           ----------------------------------------------------------------------
1wytB           ----------------------------------------------------------------------
1o4sB           TSCINTVAQYAALKALE-----------------------------------------------------
1o4sA           TSCINTVAQYAALKALE-----------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV
2e54A           ATKCFENKLLVVPAGNNTIRFLPPLTVEYGEIDLAVETLKKVL---
2ordA           ATKCFENKLLVVPAGNNTIRFLPPLTVEYGEIDLAVETLKKVL---
2eh6A           VLKALEKGLLINCTAGKVLRFLPPLIIQKEHIDRAISVLREIL---
2pb0B           LYAGAEAGVMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAV---
2pb2A           LYAGAEAGVMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAV---
2pb0A           LYAGAEAGVMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAV---
2pb2B           LYAGAEAGVMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAV---
1vefA           IARLEKEHRVLALQAGTVIRFLPPLVIEKED---------------
2byjA           WKVCLDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTIL--
2oatA           WKVCLDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTIL--
1gbnA           WKVCLDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTIL--
2bylA           WKVCLDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTIL--
1z7dB           LDICLENGLITRDVHDKTIRLTPPLCITKEQLDECTEIIVKTV---
1z7dE           LDICLENGLITRDVHDKTIRLTPPLCITKEQLDECTEIIVKTV---
1z7dA           LDICLENGLITRDVHDKTIRLTPPLCITKEQLDECTEIIVKTV---
1z7dD           LDICLENGLITRDVHDKTIRLTPPLCITKEQLDECTEIIVKTV---
1z7dC           LDICLENGLITRDVHDKTIRLTPPLCITKEQLDECTEIIVKTV---
1sffA           VARARDKGLLLSCPYYNVLRILVPLTIEDAQIRQGLEIISQ-----
1szuA           VARARDKGLLLSCPYYNVLRILVPLTIEDAQIRQGLEIISQ-----
1szkA           VARARDKGLLLSCPYYNVLRILVPLTIEDAQIRQGLEIISQ-----
1szsA           VARARDKGLLLSCPYYNVLRILVPLTIEDAQIRQGLEIISQ-----
2eo5A           IGESFKRGLLLLPAGRSAIRVIPPLVISEEEAKQGLDILKKVIKVV
1z3zA           TRECMNLGLSMNIVQGGVFRIAPPLTVSEDEIDLGLSLLGQAI---
1zodA           TRECMNLGLSMNIVQGGVFRIAPPLTVSEDEIDLGLSLLGQAI---
1dgdA           TRECMNLGLSMNIVQGGVFRIAPPLTVSEDEIDLGLSLLGQAI---
1d7uA           TRECMNLGLSMNIVQGGVFRIAPPLTVSEDEIDLGLSLLGQAI---
3gjuA           VATALASGVIGRAPQGDILGFAPPLCLTREQADIVV----------
3i5tB           DERCFELGLIVR-PLGDLCVISPPLIISRAQIDEMVAIMRQAITEV
3hmuB           AKFASEPGTLIMRHVGDRMIISPPLVITPAEIDEMFVRIRKSL---
3hmuA           AKFASEPGTLIMRHVGDRMIISPPLVITPAEIDEMFVRIRKSL---
3i5tA           DERCFELGLIVR-PLGDLCVISPPLIISRAQIDEMVAIMRQAITEV
3fcrA           SAKLLEQDKIIRAPQGDILGFAPPFCLTRAEADQVVEGTLRAVKAV
2cfbA           ----------------------------------------------
3bs8A           ----------------------------------------------
3du4A           SLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEMVAIMKQAI---
2zsmB           ----------------------------------------------
2zsmA           ----------------------------------------------
2epjA           ----------------------------------------------
3bv0B           ----------------------------------------------
3bv0A           ----------------------------------------------
3drdB           SLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEMVAIMKQAI---
3drdA           SLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEMVAIMKQAI---
3dodB           SLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEMVAIMKQAI---
3dodA           SLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEMVAIMKQAI---
2zukB           IYRAYQLGLVVYYVNGNVLEFTPPLTITETDIHKALDLLDRA----
3dxvA           IYRAYQLGLVVYYVNGNVLEFTPPLTITETDIHKALDLLDRA----
2gsaA           ----------------------------------------------
2hozA           ----------------------------------------------
2zukA           IYRAYQLGLVVYYVNGNVLEFTPPLTITETDIHKALDLLDRA----
3dxvB           IYRAYQLGLVVYYVNGNVLEFTPPLTITETDIHKALDLLDRA----
2hozB           ----------------------------------------------
1qj3B           ----------------------------------------------
2jjfA           IRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVV
2hoyA           ----------------------------------------------
2hp1B           ----------------------------------------------
2cinA           IRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVV
1qj3A           ----------------------------------------------
2hoyB           ----------------------------------------------
2jjeA           IRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVV
2jjhA           IRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVV
1qj5A           ----------------------------------------------
1mlyA           ----------------------------------------------
1s09A           ----------------------------------------------
1qj5B           ----------------------------------------------
1mlyB           ----------------------------------------------
1mgvA           ----------------------------------------------
1s09B           ----------------------------------------------
1s08A           ----------------------------------------------
1s07B           ----------------------------------------------
1s07A           ----------------------------------------------
1s06A           ----------------------------------------------
1s0aA           ----------------------------------------------
1s06B           ----------------------------------------------
1s0aB           ----------------------------------------------
1s08B           ----------------------------------------------
1dtyA           ----------------------------------------------
2e7uA           ----------------------------------------------
3i4jB           ----------------------------------------------
3i4jA           ----------------------------------------------
1ohvA           ISIARNKGVMLGGCGDKSIRFRPTLV--------------------
1gtxA           ISIARNKGVMLGGCGDKSIRFRPTLV--------------------
2cy8A           ----------------------------------------------
1wyuB           ----------------------------------------------
1wytB           ----------------------------------------------
1o4sB           ----------------------------------------------
1o4sA           ----------------------------------------------