[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO49533.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bwrA.bssp"
#ERROR : Can't open dsspfile "2bwmA.bssp"
#ERROR : Can't open dsspfile "2wbfX.bssp"
#ERROR : Can't open dsspfile "3ch2X.bssp"

## Summary of PDB Search
:2558
    2e-05  26%  2bwrA  [x.x.x] PSATHYRELLA VELUTINA LECTIN
    2e-05  26%  2bwmA  [x.x.x] PSATHYRELLA VELUTINA LECTIN PVL
    8e-05  28%  2wbfX  [x.x.x] SERINE-REPEAT ANTIGEN PROTEIN
    8e-04  30%  3ch2X  [x.x.x] SERINE-REPEAT ANTIGEN PROTEIN
:2558

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KVLSYIPRIEGLFAQIEYWQNSWESFWKVTTKDNTTSIYGQSENARIADPHDNTRVFKWLIEKTYDAKGN
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           KVGEQCPKVE------DHWMNLWDNGKILHNKNEPNSLDGKGYTAYESERHDNMDAFVKIIKTEVMNKGS
3ch2X           KVGEQCPKVE------DHWMNLW---------DNGKILHGKGYTAYESERHDNMDAFVKIIKTEVMNKGS


                         .         .         .         +         .         .         .:280
query           KIEYFYKQEDNENAPDNICEKNRTYATNKYVSSIKYGNYLDGKGEEAWAFEVVFDYGQYxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           VIAYIKAEEFSGKKVKNLCGDD---TADHAVNIVGYGNYVNSEGEKKSYWIVRNSWGPY-----------
3ch2X           VIAYIKAEEFSGKKVQNLCGDD---TADHAVNIVGYGNYVNSEGEKKSYWIVRNSWGPY-----------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMIDMNGDGLADLLLYEDNTAKIYPSLKKKGYGIPTRASLS
2bwrA           ------------------------------LADTTGDNQSDVVGFGENGVWISTNNGNNTFVDPPKMVLA
2bwmA           ------------------------------LADTTGDNQSDVVGFGENGVWISTNNGNNTFVDPPKMVLA
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EDYPTTSNGYAEEVLSYADMFGDGMAHRVRIRNGSVECWPNLGHGRFGKRVLFANAPRFGDTLDASRLFL
2bwrA           -NFAYAAGGWRVEIRFMADLRKTGRADIVGFGDGGIYISRNNGGGQFAPAQLALNNFGYGWRLDRHLRFL
2bwmA           -NFAYAAGGWRVEIRFMADLRKTGRADIVGFGDGGIYISRNNGGGQFAPAQLALNNFGYGWRLDRHLRFL
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           ADLDGTGMTDLIYAYPDKVQVFFNQGGNSFSPPLSIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ADVTGDGLLDVVGFGENQVYIARNSGNGTFQPAQAV----------------------------------
2bwmA           ADVTGDGLLDVVGFGENQVYIARNSGNGTFQPAQAV----------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1890
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1960
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:2030
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:2100
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:2170
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:2240
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:2310
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:2380
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:2450
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:2520
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           ----------------------------------------------------------------------
2bwmA           ----------------------------------------------------------------------
2wbfX           ----------------------------------------------------------------------
3ch2X           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:2590
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwrA           --------------------------------------
2bwmA           --------------------------------------
2wbfX           --------------------------------------
3ch2X           --------------------------------------