[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO49673.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d36A.bssp"
#ERROR : Can't open dsspfile "3d36B.bssp"
#ERROR : Can't open dsspfile "3dgeA.bssp"
#ERROR : Can't open dsspfile "2c2aA.bssp"
#ERROR : Can't open dsspfile "1r62A.bssp"
#ERROR : Can't open dsspfile "1tilE.bssp"
#ERROR : Can't open dsspfile "1thnA.bssp"
#ERROR : Can't open dsspfile "1l0oA.bssp"
#ERROR : Can't open dsspfile "1bxdA.bssp"
#ERROR : Can't open dsspfile "2bu8A.bssp"
#ERROR : Can't open dsspfile "1i5dA.bssp"
#ERROR : Can't open dsspfile "1i59B.bssp"
#ERROR : Can't open dsspfile "1i58A.bssp"
#ERROR : Can't open dsspfile "2ch4A.bssp"
#ERROR : Can't open dsspfile "1y8pA.bssp"
#ERROR : Can't open dsspfile "2zdyB.bssp"
#ERROR : Can't open dsspfile "3cgzB.bssp"
#ERROR : Can't open dsspfile "1id0A.bssp"
#ERROR : Can't open dsspfile "1i5cA.bssp"
#ERROR : Can't open dsspfile "2e0aB.bssp"
#ERROR : Can't open dsspfile "3crlB.bssp"
#ERROR : Can't open dsspfile "3crlA.bssp"
#ERROR : Can't open dsspfile "1b3qB.bssp"
#ERROR : Can't open dsspfile "1v9yA.bssp"
#ERROR : Can't open dsspfile "1jm6A.bssp"
#ERROR : Can't open dsspfile "3cgzC.bssp"
#ERROR : Can't open dsspfile "3cgzA.bssp"
#ERROR : Can't open dsspfile "1vb6B.bssp"
#ERROR : Can't open dsspfile "1vb6A.bssp"
#ERROR : Can't open dsspfile "1v9zA.bssp"
#ERROR : Can't open dsspfile "1th8A.bssp"
#ERROR : Can't open dsspfile "1s66U.bssp"
#ERROR : Can't open dsspfile "1s66L.bssp"
#ERROR : Can't open dsspfile "2zkjA.bssp"
#ERROR : Can't open dsspfile "2zdyA.bssp"
#ERROR : Can't open dsspfile "1jm6B.bssp"
#ERROR : Can't open dsspfile "1i5aA.bssp"
#ERROR : Can't open dsspfile "3d2rB.bssp"
#ERROR : Can't open dsspfile "3d2rA.bssp"
#ERROR : Can't open dsspfile "2bu2A.bssp"
#ERROR : Can't open dsspfile "2pnrA.bssp"
#ERROR : Can't open dsspfile "3crkB.bssp"
#ERROR : Can't open dsspfile "3crkA.bssp"
#ERROR : Can't open dsspfile "2e0aA.bssp"

## Summary of PDB Search
:578
    3e-33  35%  3d36A  [x.x.x] SPORULATION KINASE B
    6e-33  35%  3d36B  [x.x.x] SPORULATION KINASE B
    2e-19  32%  3dgeA  [x.x.x] SENSOR PROTEIN
    2e-19  31%  2c2aA  [x.x.x] SENSOR HISTIDINE KINASE
    2e-12  49%  1r62A  [d.122.1] NITROGEN REGULATION PROTEIN NR(II)
    7e-07  29%  1tilE  [d.122.1] ANTI-SIGMA F FACTOR
    7e-07  29%  1thnA  [d.122.1] ANTI-SIGMA F FACTOR
    7e-07  29%  1l0oA  [d.122.1] ANTI-SIGMA F FACTOR
    7e-07  41%  1bxdA  [d.122.1] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
    5e-05  32%  2bu8A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    6e-05  36%  1i5dA  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    6e-05  36%  1i59B  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    6e-05  36%  1i58A  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    6e-05  36%  2ch4A  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    8e-05  27%  1y8pA  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    1e-04  30%  2zdyB  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
    2e-04  26%  3cgzB  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    2e-04  30%  1id0A  [d.122.1] PHOQ HISTIDINE KINASE
    2e-04  34%  1i5cA  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    2e-04  28%  2e0aB  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
    2e-04  30%  3crlB  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    2e-04  30%  3crlA  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    2e-04  35%  1b3qB  [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)
    3e-04  31%  1v9yA  [d.110.3] HEME PAS SENSOR PROTEIN
    3e-04  30%  1jm6A  [a.29.5 - d.122.1] PYRUVATE DEHYDROGENASE KINASE, ISOZYME 2
    3e-04  27%  3cgzC  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    3e-04  27%  3cgzA  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    4e-04  41%  1vb6B  [x.x.x] HEME PAS SENSOR PROTEIN
    4e-04  41%  1vb6A  [x.x.x] HEME PAS SENSOR PROTEIN
    4e-04  41%  1v9zA  [d.110.3] HEME PAS SENSOR PROTEIN
    4e-04  28%  1th8A  [d.122.1] ANTI-SIGMA F FACTOR
    4e-04  41%  1s66U  [d.110.3] HYPOTHETICAL PROTEIN YDDU
    4e-04  41%  1s66L  [d.110.3] HYPOTHETICAL PROTEIN YDDU
    5e-04  28%  2zkjA  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    5e-04  28%  2zdyA  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
    5e-04  30%  1jm6B  [a.29.5 - d.122.1] PYRUVATE DEHYDROGENASE KINASE, ISOZYME 2
    5e-04  35%  1i5aA  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    5e-04  28%  3d2rB  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    5e-04  28%  3d2rA  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    5e-04  32%  2bu2A  [x.x.x] PYRUVATE DEHYDROGENSAE KINASE ISOENZYME 2
    7e-04  27%  2pnrA  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    7e-04  30%  3crkB  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    7e-04  30%  3crkA  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    0.001  28%  2e0aA  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
:578

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36A           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1tilE           ----------------------------------------------------------------------
1thnA           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1y8pA           ----------------------------------------------------------------------
2zdyB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
1v9yA           ----------------------------------------------------------------------
1jm6A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
1vb6B           ----------------------------------------------------------------------
1vb6A           ----------------------------------------------------------------------
1v9zA           ----------------------------------------------------------------------
1th8A           ----------------------------------------------------------------------
1s66U           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
2zkjA           ----------------------------------------------------------------------
2zdyA           ----------------------------------------------------------------------
1jm6B           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
2pnrA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36A           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1tilE           ----------------------------------------------------------------------
1thnA           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1y8pA           ----------------------------------------------------------------------
2zdyB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
1v9yA           ----------------------------------------------------------------------
1jm6A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
1vb6B           ----------------------------------------------------------------------
1vb6A           ----------------------------------------------------------------------
1v9zA           ----------------------------------------------------------------------
1th8A           ----------------------------------------------------------------------
1s66U           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
2zkjA           ----------------------------------------------------------------------
2zdyA           ----------------------------------------------------------------------
1jm6B           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
2pnrA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36A           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1tilE           ----------------------------------------------------------------------
1thnA           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1y8pA           ----------------------------------------------------------------------
2zdyB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
1v9yA           ----------------------------------------------------------------------
1jm6A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
1vb6B           ----------------------------------------------------------------------
1vb6A           ----------------------------------------------------------------------
1v9zA           ----------------------------------------------------------------------
1th8A           ----------------------------------------------------------------------
1s66U           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
2zkjA           ----------------------------------------------------------------------
2zdyA           ----------------------------------------------------------------------
1jm6B           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
2pnrA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxIIFNAMSQGVIILNHEGIVTFFNKAAEEIWHINADELVGRPFF
3d36A           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1tilE           ----------------------------------------------------------------------
1thnA           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1y8pA           ----------------------------------------------------------------------
2zdyB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
1v9yA           ---------------------------IFFPALEQGAVLINENDEVMFFNPAAEKLWGYKREEVIGNDML
1jm6A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
1vb6B           ---------------------------IFFPALEQGAVLINENDEVMFFNPAAEKLWGYKREEVIG----
1vb6A           ---------------------------IFFPALEQGAVLINENDEVMFFNPAAEKLWGYKREEVIG----
1v9zA           ---------------------------IFFPALEQGAVLINENDEVMFFNPAAEKLWGYKREEVIG----
1th8A           ----------------------------------------------------------------------
1s66U           ---------------------------IFFPALEQGAVLINENDEVMFFNPAAEKLWGYKREEVIG----
1s66L           ---------------------------IFFPALEQGAVLINENDEVMFFNPAAEKLWGYKREEVIG----
2zkjA           ----------------------------------------------------------------------
2zdyA           ----------------------------------------------------------------------
1jm6B           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
2pnrA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           CFSRCRRAEPLLIRSLKEANSFTNIECKCSNLLHEKYILVNISxxxxxxxxxxxxxxxxxDVTELRRQEA
3d36A           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2c2aA           ------------------------------------------------------------NVTESKELE-
1r62A           ----------------------------------------------------------------------
1tilE           ----------------------------------------------------------------------
1thnA           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1y8pA           ----------------------------------------------------------------------
2zdyB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
1v9yA           IPRDLRPAHPEYIRHNRERE--LQLEKKDGSKIWTRFALSKVS---------------------------
1jm6A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
1vb6B           ----------------------------------------------------------------------
1vb6A           ----------------------------------------------------------------------
1v9zA           ----------------------------------------------------------------------
1th8A           ----------------------------------------------------------------------
1s66U           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
2zkjA           ----------------------------------------------------------------------
2zdyA           ----------------------------------------------------------------------
1jm6B           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
2pnrA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RIREQEKLAVVGQMAAGMAHEIRNPLTSVRGFAQLMSEKMAEEQNPYKEFMEIMIQEIDQADSFINNFLQ
3d36A           ---------MVIRLAASISHEIRNPLTAARGFIQLIEEQLAADKR--RQYARIAIEELDRAEAIITDYLT
3d36B           -------------LAASISHEIRNPLTAARGFIQLIEEQLAADKR--RQYARIAIEELDRAEAIITDYLT
3dgeA           ------------EFIANISHELRTPLTAIKAYAETIYNSLGEDLSTLKEFLEVIIDQSNHXXXXXXXXXD
2c2aA           RLKRIDRMKT--EFIANISHELRTPLTAIKAYAETIYNSLGEDLSTLKEFLEVIIDQSNHXXXXXXXXXD
1r62A           ----------------------------------------------------------------------
1tilE           ----------------------------------------------------------------------
1thnA           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1y8pA           ----------------------------------------------------------------------
2zdyB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
1v9yA           ----------------------------------------------------------------------
1jm6A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
1vb6B           ----------------------------------------------------------------------
1vb6A           ----------------------------------------------------------------------
1v9zA           ----------------------------------------------------------------------
1th8A           ----------------------------------------------------------------------
1s66U           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
2zkjA           ----------------------------------------------------------------------
2zdyA           ----------------------------------------------------------------------
1jm6B           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
2pnrA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LARPKPPKMQACSLNQLILNFIKIFESQAFLQGVKIGIDLGEIPTIVIDKDQIKQVLLNLCQNALQAMNM
3d36A           FAKPAPETPEKLNVKLEIERVIDILRPLANMSCVDIQATLAPF-SVIGEREKFRQCLLNVMKNAIEAMPN
3d36B           FAKPAPETPEKLNVKLEIERVIDILRPLANMSCVDIQATLAPF-SVIGEREKFRQCLLNVMKNAIEAMPN
3dgeA           FSRLERKSLQICDLVESAVNAIKEFASS---HNVNVLFE-SNVPCPVIDPTRIRQVLLNLLNNGVKYSKK
2c2aA           FSRLERKSLQICDLVESAVNAIKEFASS---HNVNVLFE-SNVPCPVIDPTRIRQVLLNLLNNGVKYSKK
1r62A           ------------------------------------------LPELAHDPDQIEQVLLNIVRNALQALGP
1tilE           --------------NEMHLQFSARSENESFAR-VTVAAFVAQLDPTMDELTEIKTVVSEAVTNAIHGYNN
1thnA           --------------NEMHLQFSARSENESFAR-VTVAAFVAQLDPTMDELTEIKTVVSEAVTNAIHGYNN
1l0oA           --------------NEMHLQFSARSENESFAR-VTVAAFVAQLDPTMDELTEIKTVVSEAVTNAIHGYNN
1bxdA           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
1i5dA           --------------------------------------------------EEIGEPLLHLLRNAIEERIA
1i59B           --------------------------------------------------EEIGEPLLHLLRNAIEERIA
1i58A           --------------------------------------------------EEIGEPLLHLLRNAIEERIA
2ch4A           --------------------------------------------------EEIGEPLLHLLRNAIEERIA
1y8pA           ---------------------------------------------VVYVPSHLFHMLFELFKNSMRATRK
2zdyB           ---------------------------------------------IVYVPSHLHHMLFELFKNAMRATNQ
3cgzB           -------------LDNLISALNKVYQRK----GVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYC--
1id0A           -------------------------------KGVNISLDISPEISFVGEQNDFVEVMGNVLDNACKYC--
1i5cA           --------------------------------------------------EEIGEPLLHLLRNAIEERIA
2e0aB           ---------------------------------------------IVYVPSHLHHMLFELFKNAMRATNQ
3crlB           -------------------------------------------------------MLFELFKNAMRATSH
3crlA           -------------------------------------------------------MLFELFKNAMRATSH
1b3qB           --------------------------------------------------EEIGEPLLHLLRNAIEERIA
1v9yA           ----------------------------------------------------------------------
1jm6A           -------------------------------------------------------MLFELFKNAMRATSH
3cgzC           -------------LDNLISALNKVYQRK----GVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYC--
3cgzA           -------------LDNLISALNKVYQRK----GVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYC--
1vb6B           ----------------------------------------------------------------------
1vb6A           ----------------------------------------------------------------------
1v9zA           ----------------------------------------------------------------------
1th8A           --------------NEMHLQFSARSENESFAR-VTVAAFVAQLDPTMDELTEIKTVVSEAVTNAIHGYNN
1s66U           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
2zkjA           ---------------------------------------------IVYVPSHLHHMLFELFKNAMRATNQ
2zdyA           ---------------------------------------------IVYVPSHLHHMLFELFKNAMRATNQ
1jm6B           -------------------------------------------------------MLFELFKNAMRATSH
1i5aA           --------------------------------------------------EEIGEPLLHLLRNAIEERIA
3d2rB           ---------------------------------------------IVYVPSHLHHMLFELFKNAMRATNQ
3d2rA           ---------------------------------------------IVYVPSHLHHMLFELFKNAMRATNQ
2bu2A           ----------------------------------------------------------------------
2pnrA           ---------------------------------------------VVYVPSHLFHMLFELFKNSMRATRK
3crkB           -------------------------------------------------------MLFELFKNAMRATSH
3crkA           -------------------------------------------------------MLFELFKNAMRATSH
2e0aA           ---------------------------------------------IVYVPSHLHHMLFELFKNAMRATNQ


                         *         .         .         .         .         +         .:560
query           QGTITIATRFHAAEKEVSLSVRDNGPGIPGDNIDKLGTPFFTTKDKGTGLGLSISYTIVDKHQGRIEVES
3d36A           GGTLQVYVSIDNGR--VLIRIADTGVGMTKEQLERLGEPYFTTKGKGTGLGMMVVYRIIESMNGTIRIES
3d36B           GGTLQVYVSIDNGR--VLIRIADTGVGMTKEQLERLGEPYFTTKGKGTGLGMMVVYRIIESMNGTIRIES
3dgeA           DAPDKVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYTYEVPGTGLGLAITKEIVELHGGRIWVES
2c2aA           DAPDKVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVD---TGLGLAITKEIVELHGGRIWVES
1r62A           EGEIILRTRLHGERYRLAIDVEDNGPGI--------------------GLGLSIARNLIDQHSGKIEFTS
1tilE           DPNGIVSISVIIEDGVVHLTVRDEGVGIP--DIEEARQPLFTTKPELERSGM--GFTIMENFMDEVIVES
1thnA           DPNGIVSISVIIEDGVVHLTVRDEGVGIP--DIEEARQPLFTTKPELERSGM--GFTIMENFMDEVIVES
1l0oA           DPNGIVSISVIIEDGVVHLTVRDEGVGIP--DIEEARQPLFTTKPELERSGM--GFTIMENFMDEVIVES
1bxdA           --------------------VEDDGPGIAPEQRKHLFQPFVRGDSSGTGLGLAIVQRIVDNHNGMLELGT
2bu8A           -------------EEDLSIKMSDRGGGVPLRKIERLFSYMYSTPLAGFGYGLPISRLYAKYFQGDLQLFS
1i5dA           KGKPPIGTLILSARHEVVIEVEDDGRGIDKEKIIRLFVPGFSTKEKGRGVGMDVVKNVVESLNGSISIES
1i59B           KGKPPIGTLILSARHEVVIEVEDDGRGIDKEKIIRLFVPGFSTKEKGRGVGMDVVKNVVESLNGSISIES
1i58A           KGKPPIGTLILSARHEVVIEVEDDGRGIDKEKIIRLFVPGFSTKEKGRGVGMDVVKNVVESLNGSISIES
2ch4A           KGKPPIGTLILSARHEVVIEVEDDGRGIDKEKIIRLFVPGFSTKEKGRGVGMDVVKNVVESLNGSISIES
1y8pA           EGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRLFNYMYSTAPRGFGYGLPISRLYARYFQGDLKLYS
2zdyB           PSLTPIEVIVVLGKEDLTIKISDRGGGVPLRIIDRL---FSYTYSTGFGYGLPISRLYAKYFQGDLNLYS
3cgzB           LEFVEISAR--QTDDHLHIFVEDDGPGIPHSKR--------STLRPGQGVGLAVAREITEQYAGQIIASD
1id0A           LEFVEISAR--QTDEHLYIVVEDDGPGIPGQRVDTLRP--------GQGVGLAVAREITEQYEGKI----
1i5cA           KGKPPIGTLILSARHEVVIEVEDDGRGIDKEKIIRLFVPGFSTKERG--VGMDVVKNVVESLNGSISIES
2e0aB           PSLTPIEVIVVLGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPAGFGYGLPISRLYAKYFQGDLNLYS
3crlB           ESSLTIKIMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPAGFGYGLPISRLYAKYFQGDLQLFS
3crlA           ESSLTIKIMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPAGFGYGLPISRLYAKYFQGDLQLFS
1b3qB           KGKPPIGTLILSARHEVVIEVEDDGRGIDKEKIIRLFVPGFSTKEKGRGVGMDVVKNVVESLNGSMGIES
1v9yA           ----------------------------------------------------------------------
1jm6A           ESSLTIKIMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTTPAGFGYGLPISRLYAKYFQGDLQLFS
3cgzC           LEFVEISAR--QTDDHLHIFVEDDGPGIPH------------TLRPGQGVGLAVAREITEQYAGQIIASD
3cgzA           LEFVEISAR--QTDDHLHIFVEDDGPGIPH------------TLRPGQGVGLAVAREITEQYAGQIIASD
1vb6B           ----------------------------------------------------------------------
1vb6A           ----------------------------------------------------------------------
1v9zA           ----------------------------------------------------------------------
1th8A           DPNGIVSISVIIEDGVVHLTVRDEGVGIP--DIEEARQPL-----ERSGMG----FTIMENFMDEVIVES
1s66U           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
2zkjA           PSLTPIEVIVVLGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPAGFGYGLPISRLYAKYFQGDLNLYS
2zdyA           PSLTPIEVIVVLGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPAGFGYGLPISRLYAKYFQGDLNLYS
1jm6B           ESSLTIKIMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPAGFGYGLPISRLYAKYFQGDLQLFS
1i5aA           KGKPPIGTLILSARHEVVIEVEDDGRGIDKEKIIRLFVPGFSTKE---GVGMDVVKNVVESLNGSISIES
3d2rB           PSLTPIEVIVVLGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPAGFGYGLPISRLYAKYFQGDLNLYS
3d2rA           PSLTPIEVIVVLGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPAGFGYGLPISRLYAKYFQGDLNLYS
2bu2A           -------------EEDLSIKMSDRGGGVPLRKIERLFSYMYSTL-AGFGYGLPISRLYAKYFQGDLQLFS
2pnrA           EGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRLFN--YAAPLAGFGYGLPISRLYARYFQGDLKLYS
3crkB           ESSLTIKIMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYST---APGYGLPISRLYAKYFQGDLQLFS
3crkA           ESSLTIKIMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYST---APGYGLPISRLYAKYFQGDLQLFS
2e0aA           PSLTPIEVIVVLGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPAGFGYGLPISRLYAKYFQGDLNLYS


                         .         .         .         *         .         .         .:630
query           TIDEGTCFKVYLPVxxxx
3d36A           EIHKGTTVSIYLPL----
3d36B           EIHKGTTVSIYLPL----
3dgeA           EVGKGSRFFVWIP-----
2c2aA           EVGKGSRFFVWIP-----
1r62A           WPGH-TEFSVYLPI----
1tilE           EVNKGT--TVYL------
1thnA           EVNKGT--TVYL------
1l0oA           EVNKGT--TVYL------
1bxdA           SERGGLSIRAWLPV----
2bu8A           MEGFGTDAVIYL------
1i5dA           EKDKGTKVTIRLPL----
1i59B           EKDKGTKVTIRLPL----
1i58A           EKDKGTKVTIRLPL----
2ch4A           EKDKGTKVTIRLPL----
1y8pA           MEGVGTDAVIYL------
2zdyB           LSGYGTDAIIYL------
3cgzB           SLLGGARMEV--------
1id0A           ------------------
1i5cA           EKDKGTKVTIRLPL----
2e0aB           LSGYGTDAIIYL------
3crlB           MEGFGTDAVIYL------
3crlA           MEGFGTDAVIYL------
1b3qB           EKDKGTKVTIRLPL----
1v9yA           ------------------
1jm6A           MEGFGTDAVIYL------
3cgzC           SLLGGARMEV--------
3cgzA           SLLGGARMEV--------
1vb6B           ------------------
1vb6A           ------------------
1v9zA           ------------------
1th8A           EVNKGT--TVYL------
1s66U           ------------------
1s66L           ------------------
2zkjA           LSGYGTDAIIYL------
2zdyA           LSGYGTDAIIYL------
1jm6B           MEGFGTDAVIYL------
1i5aA           EKDKGTKVTIRLPL----
3d2rB           LSGYGTDAIIYL------
3d2rA           LSGYGTDAIIYL------
2bu2A           MEGFGTDAVIYL------
2pnrA           MEGVGTDAVIYL------
3crkB           MEGFGTDAVIYL------
3crkA           MEGFGTDAVIYL------
2e0aA           LSGYGTDAIIYL------