[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO49707.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2q6aB.bssp"
#ERROR : Can't open dsspfile "2q6aA.bssp"
#ERROR : Can't open dsspfile "2q69B.bssp"
#ERROR : Can't open dsspfile "2q69A.bssp"
#ERROR : Can't open dsspfile "2q67B.bssp"
#ERROR : Can't open dsspfile "2q67A.bssp"
#ERROR : Can't open dsspfile "3e83B.bssp"
#ERROR : Can't open dsspfile "3e83A.bssp"
#ERROR : Can't open dsspfile "2ahzA.bssp"
#ERROR : Can't open dsspfile "2ahyB.bssp"
#ERROR : Can't open dsspfile "2ahyA.bssp"
#ERROR : Can't open dsspfile "2q68B.bssp"
#ERROR : Can't open dsspfile "2q68A.bssp"
#ERROR : Can't open dsspfile "1orqC.bssp"
#ERROR : Can't open dsspfile "1lnqA.bssp"
#ERROR : Can't open dsspfile "2a0lA.bssp"

## Summary of PDB Search
:298
    2e-05  37%  2q6aB  [x.x.x] POTASSIUM CHANNEL PROTEIN
    2e-05  37%  2q6aA  [x.x.x] POTASSIUM CHANNEL PROTEIN
    2e-05  37%  2q69B  [x.x.x] POTASSIUM CHANNEL PROTEIN
    2e-05  37%  2q69A  [x.x.x] POTASSIUM CHANNEL PROTEIN
    2e-05  37%  2q67B  [x.x.x] POTASSIUM CHANNEL PROTEIN
    2e-05  37%  2q67A  [x.x.x] POTASSIUM CHANNEL PROTEIN
    3e-05  37%  3e83B  [x.x.x] POTASSIUM CHANNEL PROTEIN
    3e-05  37%  3e83A  [x.x.x] POTASSIUM CHANNEL PROTEIN
    3e-05  37%  2ahzA  [x.x.x] POTASSIUM CHANNEL PROTEIN
    3e-05  37%  2ahyB  [x.x.x] POTASSIUM CHANNEL PROTEIN
    3e-05  37%  2ahyA  [x.x.x] POTASSIUM CHANNEL PROTEIN
    3e-05  37%  2q68B  [x.x.x] POTASSIUM CHANNEL PROTEIN
    3e-05  37%  2q68A  [x.x.x] POTASSIUM CHANNEL PROTEIN
    5e-04  34%  1orqC  [f.14.1] POTASSIUM CHANNEL
    5e-04  27%  1lnqA  [f.14.1 - c.2.1 - d.286.1] POTASSIUM CHANNEL RELATED PROTEIN
    5e-04  34%  2a0lA  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL
:298

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2q6aB           ----------------------------------------------------------------------
2q6aA           ----------------------------------------------------------------------
2q69B           ----------------------------------------------------------------------
2q69A           ----------------------------------------------------------------------
2q67B           ----------------------------------------------------------------------
2q67A           ----------------------------------------------------------------------
3e83B           ----------------------------------------------------------------------
3e83A           ----------------------------------------------------------------------
2ahzA           ----------------------------------------------------------------------
2ahyB           ----------------------------------------------------------------------
2ahyA           ----------------------------------------------------------------------
2q68B           ----------------------------------------------------------------------
2q68A           ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1lnqA           ----------------------------------------------------------------------
2a0lA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2q6aB           ----------------------------------------------------------------------
2q6aA           ----------------------------------------------------------------------
2q69B           ----------------------------------------------------------------------
2q69A           ----------------------------------------------------------------------
2q67B           ----------------------------------------------------------------------
2q67A           ----------------------------------------------------------------------
3e83B           ----------------------------------------------------------------------
3e83A           ----------------------------------------------------------------------
2ahzA           ----------------------------------------------------------------------
2ahyB           ----------------------------------------------------------------------
2ahyA           ----------------------------------------------------------------------
2q68B           ----------------------------------------------------------------------
2q68A           ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1lnqA           ----------------------------------------------------------------------
2a0lA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxF
2q6aB           ---------------------------------------------------------------------F
2q6aA           ---------------------------------------------------------------------F
2q69B           ---------------------------------------------------------------------F
2q69A           ---------------------------------------------------------------------F
2q67B           ---------------------------------------------------------------------F
2q67A           ---------------------------------------------------------------------F
3e83B           ---------------------------------------------------------------------F
3e83A           ---------------------------------------------------------------------F
2ahzA           ---------------------------------------------------------------------F
2ahyB           ---------------------------------------------------------------------F
2ahyA           ---------------------------------------------------------------------F
2q68B           ---------------------------------------------------------------------F
2q68A           ---------------------------------------------------------------------F
1orqC           ----------------------------------------------------------------------
1lnqA           ----------------------------------------------------------------------
2a0lA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VIIFNLYTMILLVSNTNPYSFIDSTGPVTEHIRLLYFTIITFTSVGYGDITPRGNFPVFITMIISITGFL
2q6aB           QVLFVL-TILTLISGTIFYSTVEGLRPIDA----LYFSVVTLTTVGEGNFSPQTDFGKIFT---------
2q6aA           QVLFVL-TILTLISGTIFYSTVEGLRPIDA----LYFSVVTLTTVGEGNFSPQTDFGKIFT---------
2q69B           QVLFVL-TILTLISGTIFYSTVEGLRPIDA----LYFSVVTLTTVGNGNFSPQTDFGKIFT---------
2q69A           QVLFVL-TILTLISGTIFYSTVEGLRPIDA----LYFSVVTLTTVGNGNFSPQTDFGKIFT---------
2q67B           QVLFVL-TILTLISGTIFYSTVEGLRPIDA----LYFSVVTLTTVGAGNFSPQTDFGKIFT---------
2q67A           QVLFVL-TILTLISGTIFYSTVEGLRPIDA----LYFSVVTLTTVGAGNFSPQTDFGKIFT---------
3e83B           QVLFVL-TILTLISGTIFYSTVEGLRPIDA----LYFSVVTLTTVGDGNFSPQTDFGKIFT---------
3e83A           QVLFVL-TILTLISGTIFYSTVEGLRPIDA----LYFSVVTLTTVGDGNFSPQTDFGKIFT---------
2ahzA           QVLFVL-TILTLISGTIFYSTVEGLRPIDA----LYFSVVTLTTVGDGNFSPQTDFGKIFT---------
2ahyB           QVLFVL-TILTLISGTIFYSTVEGLRPIDA----LYFSVVTLTTVGDGNFSPQTDFGKIFT---------
2ahyA           QVLFVL-TILTLISGTIFYSTVEGLRPIDA----LYFSVVTLTTVGDGNFSPQTDFGKIFT---------
2q68B           QVLFVL-TILTLISGTIFYSTVEGLRPIDA----LYFSVVTLTTVGAGNFEPQTDFGKIFT---------
2q68A           QVLFVL-TILTLISGTIFYSTVEGLRPIDA----LYFSVVTLTTVGAGNFEPQTDFGKIFT---------
1orqC           ---------IYIVEYPDPNSSIKSV------FDALWWAVVTATTVGYGDVVPATPIGKVIGIAVMLTGIS
1lnqA           -----LLVLAVIIYGTAGFHFIEGESWTVS----LYWTFVTIATVGYGDYSPSTPLGMYFTVTLIVLGIG
2a0lA           ---------IYIVEYPDPNSSIKSV------FDALWWAVVTATTVGYGDVVPATPIGKVIGIAVMLTGIS


                         .         *         .         .         .         .         +:350
query           YSALFIGGLLxxxxxxxx
2q6aB           ------------------
2q6aA           ------------------
2q69B           ------------------
2q69A           ------------------
2q67B           ------------------
2q67A           ------------------
3e83B           ------------------
3e83A           ------------------
2ahzA           ------------------
2ahyB           ------------------
2ahyA           ------------------
2q68B           ------------------
2q68A           ------------------
1orqC           ALTLLIG-----------
1lnqA           TFAVAVERLL--------
2a0lA           ALTLLIG-----------