[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO49715.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c8cA.bssp"
#ERROR : Can't open dsspfile "1qu7A.bssp"
#ERROR : Can't open dsspfile "1qu7B.bssp"
#ERROR : Can't open dsspfile "3fosB.bssp"
#ERROR : Can't open dsspfile "3fosA.bssp"
#ERROR : Can't open dsspfile "3g67B.bssp"
#ERROR : Can't open dsspfile "3g67A.bssp"
#ERROR : Can't open dsspfile "2ch7A.bssp"
#ERROR : Can't open dsspfile "3g6bB.bssp"
#ERROR : Can't open dsspfile "3g6bA.bssp"
#ERROR : Can't open dsspfile "2ch7B.bssp"

## Summary of PDB Search
:621
    1e-16  36%  3c8cA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN
    8e-11  36%  1qu7A  [h.4.5] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    2e-10  36%  1qu7B  [h.4.5] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    2e-07  26%  3fosB  [x.x.x] SENSOR PROTEIN
    2e-07  26%  3fosA  [x.x.x] SENSOR PROTEIN
    4e-07  27%  3g67B  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN
    4e-07  27%  3g67A  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN
    7e-07  23%  2ch7A  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN
    1e-06  27%  3g6bB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN
    1e-06  27%  3g6bA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN
    2e-05  24%  2ch7B  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN
:621

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEGEMVASLIIREEIQHFLD
3c8cA           ----------------------------------------------------------------------
1qu7A           ----------------------------------------------------------------------
1qu7B           ----------------------------------------------------------------------
3fosB           ---------------------------------------------------EHKQEASVLLRNKINYLI-
3fosA           ---------------------------------------------------EHKQEASVLLRNKINYLI-
3g67B           ----------------------------------------------------------------------
3g67A           ----------------------------------------------------------------------
2ch7A           ----------------------------------------------------------------------
3g6bB           ----------------------------------------------------------------------
3g6bA           ----------------------------------------------------------------------
2ch7B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SKGEIVKNLSLAQEFQSQDKKQILKLLLSAQNQSEFQNIYFVTGSGEITIAPVKQLPKDFDPRQRVWYQE
3c8cA           -----------------------------------------------------------WDPRVRPWYKD
1qu7A           ----------------------------------------------------------------------
1qu7B           ----------------------------------------------------------------------
3fosB           --GETARSLSIAIDRPVDIKKQSI-LEKTFDSEPRFSGLYFLNAKGDVT-ASTTELKTKVNLADRSFFIK
3fosA           --GETARSLSIAIDRPVDIKKQSI-LEKTFDSEPRFSGLYFLNAKGDVT-ASTTELKTKVNLADRSFFIK
3g67B           ----------------------------------------------------------------------
3g67A           ----------------------------------------------------------------------
2ch7A           ----------------------------------------------------------------------
3g6bB           ----------------------------------------------------------------------
3g6bA           ----------------------------------------------------------------------
2ch7B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AVKKGTMVCTDPYIDQATGKPCMTVALAVKDSEGRFVGVLGADIKLETISSLAVKYKFGEEGYFYVCDKQ
3c8cA           AKNAGKLVITAPYADSASGEILVSVATPVKDSTGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSED
1qu7A           ----------------------------------------------------------------------
1qu7B           ----------------------------------------------------------------------
3fosB           AKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLI--NLLSPDVYIEVVNQD
3fosA           AKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLI--NLLSPDVYIEVVNQD
3g67B           ----------------------------------------------------------------------
3g67A           ----------------------------------------------------------------------
2ch7A           ----------------------------------------------------------------------
3g6bB           ----------------------------------------------------------------------
3g6bA           ----------------------------------------------------------------------
2ch7B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GKVIGHPDAKAINGDIMNRAYVKAALAGKSGFDTYADNGVKKLVYYSEIPKTGWGLFVQQPEQEAYAELY
3c8cA           GTTIAHP-KKEFNGK-------PSEFLGESNVDTHIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALD
1qu7A           ----------------------------------------------------------------------
1qu7B           ----------------------------------------------------------------------
3fosB           GKIFASGQA-------------------------------------------------------------
3fosA           GKIFASGQA-------------------------------------------------------------
3g67B           ----------------------------------------------------------------------
3g67A           ----------------------------------------------------------------------
2ch7A           ----------------------------------------------------------------------
3g6bB           ----------------------------------------------------------------------
3g6bA           ----------------------------------------------------------------------
2ch7B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RARxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c8cA           ELR-------------------------------------------------------------------
1qu7A           ----------------------------------------------------------------------
1qu7B           ----------------------------------------------------------------------
3fosB           ----------------------------------------------------------------------
3fosA           ----------------------------------------------------------------------
3g67B           ----------------------------------------------------------------------
3g67A           ----------------------------------------------------------------------
2ch7A           ----------------------------------------------------------------------
3g6bB           ----------------------------------------------------------------------
3g6bA           ----------------------------------------------------------------------
2ch7B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxVKDSTNRVTGACNSMAVSMEQIHEASDKNASDISNVAATTEQITASAENINEMVGSVSLSA
3c8cA           ----------------------------------------------------------------------
1qu7A           ----------------------------EQQAASLEQTAASMEQLTATVKQNAENARQASHLALSASETA
1qu7B           -----------------------------------EQTAASMEQLTATVKQNAENARQASHLALSASETA
3fosB           ----------------------------------------------------------------------
3fosA           ----------------------------------------------------------------------
3g67B           ----------------------------------SDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERV
3g67A           ----------------------------------SDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERV
2ch7A           ---------VAESIEEISKANEEITNQLLGISKEMDNISTRIESISASVQETTAGSEEISSATKNIXXXA
3g6bB           ----------------------------------SDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERV
3g6bA           ----------------------------------SDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERV
2ch7B           ---------VAESIEEISKANEEITNQLLGISKEMDNISTRIESISASVQETTAGSEEISSATKNIXXXA


                         .         .         +         .         .         .         .:490
query           QHGQEEIGEVIGAMEGIKSSTNEISRAISEVENQSKKXXXXXXXXXXXXXXXNXXXXXXXXXXXXXGEHG
3c8cA           ----------------------------------------------------------------------
1qu7A           QRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQT--------------NIXXXXXXXXXXXXXXXX
1qu7B           QRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQT--------------NIXXXXXXXXXXXXXXXX
3fosB           ----------------------------------------------------------------------
3fosA           ----------------------------------------------------------------------
3g67B           KEASSQIGETLENIRSIEKLIQNIMRIARET---------------------NILALNATIEAARAGEAG
3g67A           KEASSQIGETLENIRSIEKLIQNIMRIARET---------------------NILALNATIEAARAGEAG
2ch7A           KEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAEQTXXXXXXXXXXXXXXXXXX
3g6bB           KEASSQIGETLENIRSIEKLIQNIMRIARET---------------------NILALNATIEAARAGEAG
3g6bA           KEASSQIGETLENIRSIEKLIQNIMRIARET---------------------NILALNATIEAARAGEAG
2ch7B           KEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAEQTXXXXXXXXXXXXXXXXXX


                         *         .         .         .         .         +         .:560
query           KGFTVVADEVRKLAEQTSAATREIHGVIENVYASVRDSVDKMLTGNEMVEMGSQRVQEAGEVFKTITINI
3c8cA           ----------------------------------------------------------------------
1qu7A           XXXXVVAGEVRNLAQRSAQAAREIKSLIE-------DSVGK-------VDVGSTLVESAGETMAEIVSAV
1qu7B           XXXXVVAGEVRNLAQRSAQAAREIKSLIE-------DSVGK-------VDVGSTLVESAGETMAEIVSAV
3fosB           ----------------------------------------------------------------------
3fosA           ----------------------------------------------------------------------
3g67B           KGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLKTLQNMVRFMENNVKLLQEVRNSLDTSK
3g67A           KGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLKTLQNMVRFMENNVKLLQEVRNSLDTSK
2ch7A           XXXXXXXDEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVSSEITARVEEGTKLADEADEKLNSIVGAV
3g6bB           KGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLKTLQNMVRFMENIVKLLQEVRNSLDTSK
3g6bA           KGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLKTLQNMVRFMENIVKLLQEVRNSLDTSK
2ch7B           XXXXXXXDEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVSSEITARVEEGTKLADEADEKLNSIVGAV


                         .         .         .         *         .         .         .:630
query           EELVEKMAQITRATITMSASIQNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c8cA           -------------------------------------------------------------
1qu7A           TRVTDIMGEIASASDEQSRGIDQV-------------------------------------
1qu7B           TRVTDIMGEIASASDEQSRGIDQV-------------------------------------
3fosB           -------------------------------------------------------------
3fosA           -------------------------------------------------------------
3g67B           ESLSEKSAEIDSAT-----------------------------------------------
3g67A           ESLSEKSAEIDSAT-----------------------------------------------
2ch7A           ERINEMLQNIAAAIEEQTAAVDEI-------------------------------------
3g6bB           ESLSEKSAEIDSAT-----------------------------------------------
3g6bA           ESLSEKSAEIDSAT-----------------------------------------------
2ch7B           ERINEML------------------------------------------------------