[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO49801.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dgeA.bssp"
#ERROR : Can't open dsspfile "2c2aA.bssp"
#ERROR : Can't open dsspfile "1w25A.bssp"
#ERROR : Can't open dsspfile "2v0nA.bssp"
#ERROR : Can't open dsspfile "1m5tA.bssp"
#ERROR : Can't open dsspfile "2zwmA.bssp"
#ERROR : Can't open dsspfile "1nxpA.bssp"
#ERROR : Can't open dsspfile "3dgfC.bssp"
#ERROR : Can't open dsspfile "3dgeC.bssp"
#ERROR : Can't open dsspfile "2a9oA.bssp"
#ERROR : Can't open dsspfile "3gt7A.bssp"
#ERROR : Can't open dsspfile "1mvoA.bssp"
#ERROR : Can't open dsspfile "2a9rA.bssp"
#ERROR : Can't open dsspfile "2ayzA.bssp"
#ERROR : Can't open dsspfile "2ayxA.bssp"
#ERROR : Can't open dsspfile "1p6qA.bssp"
#ERROR : Can't open dsspfile "1mb3A.bssp"
#ERROR : Can't open dsspfile "1mavA.bssp"
#ERROR : Can't open dsspfile "1zesC.bssp"
#ERROR : Can't open dsspfile "1zesA.bssp"
#ERROR : Can't open dsspfile "2iynB.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "2r25B.bssp"
#ERROR : Can't open dsspfile "1oxkB.bssp"
#ERROR : Can't open dsspfile "1oxbB.bssp"
#ERROR : Can't open dsspfile "1m5uA.bssp"
#ERROR : Can't open dsspfile "2a9qA.bssp"
#ERROR : Can't open dsspfile "1sd5A.bssp"
#ERROR : Can't open dsspfile "1s8nA.bssp"
#ERROR : Can't open dsspfile "1nxtA.bssp"
#ERROR : Can't open dsspfile "3d36B.bssp"
#ERROR : Can't open dsspfile "3d36A.bssp"
#ERROR : Can't open dsspfile "2oqrA.bssp"
#ERROR : Can't open dsspfile "1zesB.bssp"
#ERROR : Can't open dsspfile "2j8eA.bssp"
#ERROR : Can't open dsspfile "1dc7A.bssp"
#ERROR : Can't open dsspfile "2zayA.bssp"
#ERROR : Can't open dsspfile "1tmyA.bssp"
#ERROR : Can't open dsspfile "3f7nA.bssp"
#ERROR : Can't open dsspfile "2jb9B.bssp"
#ERROR : Can't open dsspfile "2jb9A.bssp"
#ERROR : Can't open dsspfile "1mb0A.bssp"
#ERROR : Can't open dsspfile "2jvjA.bssp"
#ERROR : Can't open dsspfile "2jbaA.bssp"
#ERROR : Can't open dsspfile "3fftA.bssp"
#ERROR : Can't open dsspfile "1d4zA.bssp"
#ERROR : Can't open dsspfile "3c3mA.bssp"
#ERROR : Can't open dsspfile "1xheB.bssp"
#ERROR : Can't open dsspfile "1xheA.bssp"
#ERROR : Can't open dsspfile "1fspA.bssp"
#ERROR : Can't open dsspfile "3ffxA.bssp"
#ERROR : Can't open dsspfile "2jbaB.bssp"
#ERROR : Can't open dsspfile "1dc8A.bssp"
#ERROR : Can't open dsspfile "1dz3A.bssp"
#ERROR : Can't open dsspfile "2jvkA.bssp"
#ERROR : Can't open dsspfile "3ffwA.bssp"
#ERROR : Can't open dsspfile "1srrC.bssp"
#ERROR : Can't open dsspfile "1srrB.bssp"
#ERROR : Can't open dsspfile "1srrA.bssp"
#ERROR : Can't open dsspfile "1peyC.bssp"
#ERROR : Can't open dsspfile "1natA.bssp"
#ERROR : Can't open dsspfile "2jviA.bssp"
#ERROR : Can't open dsspfile "1zgzB.bssp"
#ERROR : Can't open dsspfile "1zgzA.bssp"
#ERROR : Can't open dsspfile "1udrA.bssp"
#ERROR : Can't open dsspfile "3breB.bssp"
#ERROR : Can't open dsspfile "3breA.bssp"
#ERROR : Can't open dsspfile "1udrB.bssp"
#ERROR : Can't open dsspfile "3jteA.bssp"
#ERROR : Can't open dsspfile "1jlkB.bssp"
#ERROR : Can't open dsspfile "1jlkA.bssp"
#ERROR : Can't open dsspfile "2qxyB.bssp"
#ERROR : Can't open dsspfile "2qxyA.bssp"
#ERROR : Can't open dsspfile "1zh4A.bssp"
#ERROR : Can't open dsspfile "1zh2B.bssp"
#ERROR : Can't open dsspfile "1zh2A.bssp"
#ERROR : Can't open dsspfile "1ys7B.bssp"
#ERROR : Can't open dsspfile "1ys7A.bssp"
#ERROR : Can't open dsspfile "1ys6B.bssp"
#ERROR : Can't open dsspfile "2iynA.bssp"
#ERROR : Can't open dsspfile "1i3cB.bssp"
#ERROR : Can't open dsspfile "1i3cA.bssp"
#ERROR : Can't open dsspfile "1qmpB.bssp"
#ERROR : Can't open dsspfile "1kgsA.bssp"
#ERROR : Can't open dsspfile "3cwoX.bssp"
#ERROR : Can't open dsspfile "1bxdA.bssp"
#ERROR : Can't open dsspfile "1k68A.bssp"
#ERROR : Can't open dsspfile "3i5aA.bssp"
#ERROR : Can't open dsspfile "3c97A.bssp"
#ERROR : Can't open dsspfile "2iynC.bssp"
#ERROR : Can't open dsspfile "1zitA.bssp"
#ERROR : Can't open dsspfile "1qmpA.bssp"
#ERROR : Can't open dsspfile "1nxoA.bssp"
#ERROR : Can't open dsspfile "3cu5B.bssp"
#ERROR : Can't open dsspfile "2pl1A.bssp"
#ERROR : Can't open dsspfile "2pkxB.bssp"
#ERROR : Can't open dsspfile "2pkxA.bssp"
#ERROR : Can't open dsspfile "1nxxA.bssp"
#ERROR : Can't open dsspfile "1nxsA.bssp"
#ERROR : Can't open dsspfile "2ftkE.bssp"
#ERROR : Can't open dsspfile "3cfyA.bssp"
#ERROR : Can't open dsspfile "1ys6A.bssp"
#ERROR : Can't open dsspfile "1mihA.bssp"
#ERROR : Can't open dsspfile "1cyeA.bssp"
#ERROR : Can't open dsspfile "2cheA.bssp"
#ERROR : Can't open dsspfile "1f4vC.bssp"
#ERROR : Can't open dsspfile "1djmA.bssp"
#ERROR : Can't open dsspfile "3chyA.bssp"
#ERROR : Can't open dsspfile "2qzjA.bssp"
#ERROR : Can't open dsspfile "1k66A.bssp"
#ERROR : Can't open dsspfile "1chnA.bssp"
#ERROR : Can't open dsspfile "1qmpD.bssp"
#ERROR : Can't open dsspfile "3hebA.bssp"
#ERROR : Can't open dsspfile "1ymuA.bssp"
#ERROR : Can't open dsspfile "1p2fA.bssp"
#ERROR : Can't open dsspfile "1dcfA.bssp"
#ERROR : Can't open dsspfile "3hdvD.bssp"
#ERROR : Can't open dsspfile "3hdvC.bssp"
#ERROR : Can't open dsspfile "3hdvB.bssp"
#ERROR : Can't open dsspfile "3hdvA.bssp"
#ERROR : Can't open dsspfile "5chyA.bssp"
#ERROR : Can't open dsspfile "1vlzB.bssp"
#ERROR : Can't open dsspfile "1vlzA.bssp"
#ERROR : Can't open dsspfile "1id0A.bssp"
#ERROR : Can't open dsspfile "1e6lA.bssp"
#ERROR : Can't open dsspfile "1ymvA.bssp"
#ERROR : Can't open dsspfile "1ehcA.bssp"
#ERROR : Can't open dsspfile "1e6kA.bssp"
#ERROR : Can't open dsspfile "3cu5A.bssp"
#ERROR : Can't open dsspfile "1ab6A.bssp"
#ERROR : Can't open dsspfile "1ab5A.bssp"
#ERROR : Can't open dsspfile "1xhfA.bssp"
#ERROR : Can't open dsspfile "1jbeA.bssp"
#ERROR : Can't open dsspfile "1e6mA.bssp"
#ERROR : Can't open dsspfile "1i5cB.bssp"
#ERROR : Can't open dsspfile "1i5bB.bssp"
#ERROR : Can't open dsspfile "1i5bA.bssp"
#ERROR : Can't open dsspfile "1heyA.bssp"
#ERROR : Can't open dsspfile "1b3qA.bssp"
#ERROR : Can't open dsspfile "1a2oA.bssp"
#ERROR : Can't open dsspfile "3h5iA.bssp"
#ERROR : Can't open dsspfile "6chyA.bssp"
#ERROR : Can't open dsspfile "2i6fC.bssp"
#ERROR : Can't open dsspfile "2i6fB.bssp"
#ERROR : Can't open dsspfile "2i6fA.bssp"
#ERROR : Can't open dsspfile "1i5dA.bssp"
#ERROR : Can't open dsspfile "2gkgA.bssp"
#ERROR : Can't open dsspfile "3dzdA.bssp"
#ERROR : Can't open dsspfile "2vuiB.bssp"
#ERROR : Can't open dsspfile "1rnlA.bssp"
#ERROR : Can't open dsspfile "2nt4A.bssp"
#ERROR : Can't open dsspfile "2jk1A.bssp"
#ERROR : Can't open dsspfile "1i59B.bssp"
#ERROR : Can't open dsspfile "1i58A.bssp"
#ERROR : Can't open dsspfile "3i42A.bssp"
#ERROR : Can't open dsspfile "2ch4A.bssp"
#ERROR : Can't open dsspfile "1a04A.bssp"
#ERROR : Can't open dsspfile "1i58B.bssp"
#ERROR : Can't open dsspfile "3eodA.bssp"
#ERROR : Can't open dsspfile "1b3qB.bssp"
#ERROR : Can't open dsspfile "2qr3A.bssp"
#ERROR : Can't open dsspfile "1qkkA.bssp"
#ERROR : Can't open dsspfile "1l5zA.bssp"
#ERROR : Can't open dsspfile "1l5yB.bssp"
#ERROR : Can't open dsspfile "1l5yA.bssp"
#ERROR : Can't open dsspfile "1i5aB.bssp"
#ERROR : Can't open dsspfile "2vuhB.bssp"
#ERROR : Can't open dsspfile "3cg4A.bssp"
#ERROR : Can't open dsspfile "1c4wA.bssp"
#ERROR : Can't open dsspfile "1i5cA.bssp"
#ERROR : Can't open dsspfile "1i5aA.bssp"
#ERROR : Can't open dsspfile "1i59A.bssp"
#ERROR : Can't open dsspfile "3eqzB.bssp"
#ERROR : Can't open dsspfile "3eqzA.bssp"
#ERROR : Can't open dsspfile "1dbwB.bssp"
#ERROR : Can't open dsspfile "1dbwA.bssp"
#ERROR : Can't open dsspfile "3b2nA.bssp"
#ERROR : Can't open dsspfile "1d5wB.bssp"
#ERROR : Can't open dsspfile "1d5wA.bssp"
#ERROR : Can't open dsspfile "2ch4B.bssp"

## Summary of PDB Search
:916
    7e-25  35%  3dgeA  [x.x.x] SENSOR PROTEIN
    2e-22  34%  2c2aA  [x.x.x] SENSOR HISTIDINE KINASE
    8e-16  37%  1w25A  [c.23.1 - c.23.1 - d.58.29] STALKED-CELL DIFFERENTIATION
    8e-16  37%  2v0nA  [x.x.x] RESPONSE REGULATOR PLED
    1e-15  35%  1m5tA  [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
    6e-15  38%  2zwmA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN YYCF
    1e-14  35%  1nxpA  [c.23.1] DNA-BINDING RESPONSE REGULATOR
    1e-14  38%  3dgfC  [x.x.x] RESPONSE REGULATOR
    1e-14  38%  3dgeC  [x.x.x] RESPONSE REGULATOR
    1e-14  35%  2a9oA  [x.x.x] RESPONSE REGULATOR
    2e-13  36%  3gt7A  [x.x.x] SENSOR PROTEIN
    6e-13  33%  1mvoA  [c.23.1] PHOP RESPONSE REGULATOR
    2e-12  35%  2a9rA  [x.x.x] DNA-BINDING RESPONSE REGULATOR
    2e-12  32%  2ayzA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    2e-12  32%  2ayxA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    1e-11  32%  1p6qA  [c.23.1] CHEY2
    3e-11  32%  1mb3A  [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
    3e-11  32%  1mavA  [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
    1e-10  29%  1zesC  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-10  29%  1zesA  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-10  29%  2iynB  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-10  29%  1b00A  [c.23.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-10  33%  2r25B  [x.x.x] OSMOSENSING HISTIDINE PROTEIN KINASE SLN1
    1e-10  33%  1oxkB  [c.23.1] SLN1
    1e-10  33%  1oxbB  [c.23.1] SLN1
    1e-10  34%  1m5uA  [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
    2e-10  34%  2a9qA  [x.x.x] RESPONSE REGULATOR
    3e-10  34%  1sd5A  [c.23.1] PUTATIVE ANTITERMINATOR
    3e-10  34%  1s8nA  [c.23.1] PUTATIVE ANTITERMINATOR
    3e-10  35%  1nxtA  [c.23.1] DNA-BINDING RESPONSE REGULATOR
    3e-10  25%  3d36B  [x.x.x] SPORULATION KINASE B
    3e-10  25%  3d36A  [x.x.x] SPORULATION KINASE B
    4e-10  30%  2oqrA  [x.x.x] SENSORY TRANSDUCTION PROTEIN REGX3
    5e-10  28%  1zesB  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    6e-10  40%  2j8eA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    8e-10  35%  1dc7A  [c.23.1] NITROGEN REGULATION PROTEIN
    1e-09  25%  2zayA  [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
    2e-09  35%  1tmyA  [c.23.1 (1u0sY)] CHEY PROTEIN
    2e-09  40%  3f7nA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    2e-09  28%  2jb9B  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    2e-09  28%  2jb9A  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    4e-09  34%  1mb0A  [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
    4e-09  28%  2jvjA  [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    4e-09  29%  2jbaA  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    4e-09  39%  3fftA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    4e-09  38%  1d4zA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    4e-09  37%  3c3mA  [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
    7e-09  30%  1xheB  [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA
    7e-09  30%  1xheA  [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA
    7e-09  28%  1fspA  [c.23.1 (1puxA)] STAGE 0 SPORULATION PROTEIN F
    7e-09  39%  3ffxA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    9e-09  28%  2jbaB  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    9e-09  34%  1dc8A  [c.23.1] NITROGEN REGULATION PROTEIN
    1e-08  32%  1dz3A  [c.23.1] STAGE 0 SPORULATION PROTEIN A
    2e-08  28%  2jvkA  [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    2e-08  39%  3ffwA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    2e-08  27%  1srrC  [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN
    2e-08  27%  1srrB  [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN
    2e-08  27%  1srrA  [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN
    2e-08  27%  1peyC  [c.23.1] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    2e-08  27%  1natA  [x.x.x] SPORULATION RESPONSE REGULATORY PROTEIN
    2e-08  28%  2jviA  [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    3e-08  28%  1zgzB  [x.x.x] TORCAD OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    3e-08  28%  1zgzA  [x.x.x] TORCAD OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    3e-08  34%  1udrA  [c.23.1] CHEY PROTEIN
    4e-08  31%  3breB  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    4e-08  31%  3breA  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    6e-08  34%  1udrB  [c.23.1] CHEY PROTEIN
    6e-08  33%  3jteA  [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
    6e-08  25%  1jlkB  [c.23.1] RESPONSE REGULATOR RCP1
    6e-08  25%  1jlkA  [c.23.1] RESPONSE REGULATOR RCP1
    8e-08  33%  2qxyB  [x.x.x] RESPONSE REGULATOR
    8e-08  33%  2qxyA  [x.x.x] RESPONSE REGULATOR
    1e-07  40%  1zh4A  [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    1e-07  40%  1zh2B  [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    1e-07  40%  1zh2A  [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-07  36%  1ys7B  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
    2e-07  36%  1ys7A  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
    2e-07  36%  1ys6B  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
    3e-07  30%  2iynA  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    4e-07  25%  1i3cB  [c.23.1] RESPONSE REGULATOR RCP1
    4e-07  25%  1i3cA  [c.23.1] RESPONSE REGULATOR RCP1
    5e-07  32%  1qmpB  [c.23.1] SPO0A
    5e-07  36%  1kgsA  [c.23.1 - a.4.6] DNA BINDING RESPONSE REGULATOR D
    5e-07  46%  3cwoX  [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
    5e-07  35%  1bxdA  [d.122.1] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
    6e-07  26%  1k68A  [c.23.1] PHYTOCHROME RESPONSE REGULATOR RCPA
    6e-07  31%  3i5aA  [x.x.x] RESPONSE REGULATOR/GGDEF DOMAIN PROTEIN
    6e-07  30%  3c97A  [x.x.x] SIGNAL TRANSDUCTION HISTIDINE KINASE
    1e-06  30%  2iynC  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-06  27%  1zitA  [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    1e-06  31%  1qmpA  [c.23.1] SPO0A
    2e-06  30%  1nxoA  [c.23.1] DNA-BINDING RESPONSE REGULATOR
    2e-06  26%  3cu5B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    2e-06  33%  2pl1A  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP
    2e-06  33%  2pkxB  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP
    2e-06  33%  2pkxA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP
    2e-06  31%  1nxxA  [c.23.1] DNA-BINDING RESPONSE REGULATOR
    2e-06  30%  1nxsA  [c.23.1] DNA-BINDING RESPONSE REGULATOR
    2e-06  26%  2ftkE  [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    3e-06  24%  3cfyA  [x.x.x] PUTATIVE LUXO REPRESSOR PROTEIN
    4e-06  37%  1ys6A  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
    4e-06  33%  1mihA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    4e-06  32%  1cyeA  [x.x.x] CHEY
    4e-06  32%  2cheA  [x.x.x] CHEY
    5e-06  33%  1f4vC  [c.23.1] CHEMOTAXIS CHEY PROTEIN
    5e-06  33%  1djmA  [c.23.1] CHEMOTAXIS PROTEIN Y
    5e-06  33%  3chyA  [c.23.1 (1a0oA)] CHEY
    7e-06  27%  2qzjA  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR
    7e-06  25%  1k66A  [c.23.1] PHYTOCHROME RESPONSE REGULATOR RCPB
    7e-06  30%  1chnA  [x.x.x] CHEY
    9e-06  31%  1qmpD  [c.23.1] SPO0A
    1e-05  23%  3hebA  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN
    2e-05  30%  1ymuA  [c.23.1] CHEY
    2e-05  27%  1p2fA  [c.23.1 - a.4.6] RESPONSE REGULATOR
    2e-05  23%  1dcfA  [c.23.1] ETR1 PROTEIN
    2e-05  33%  3hdvD  [x.x.x] RESPONSE REGULATOR
    2e-05  33%  3hdvC  [x.x.x] RESPONSE REGULATOR
    2e-05  33%  3hdvB  [x.x.x] RESPONSE REGULATOR
    2e-05  33%  3hdvA  [x.x.x] RESPONSE REGULATOR
    2e-05  32%  5chyA  [x.x.x] CHEY
    3e-05  32%  1vlzB  [c.23.1] CHEY
    3e-05  32%  1vlzA  [c.23.1] CHEY
    3e-05  30%  1id0A  [d.122.1] PHOQ HISTIDINE KINASE
    3e-05  32%  1e6lA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    4e-05  31%  1ymvA  [x.x.x] CHEY
    4e-05  32%  1ehcA  [x.x.x] CHEY
    4e-05  31%  1e6kA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    4e-05  30%  3cu5A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    4e-05  31%  1ab6A  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    4e-05  32%  1ab5A  [c.23.1] CHEY
    5e-05  29%  1xhfA  [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA
    5e-05  34%  1jbeA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    5e-05  32%  1e6mA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    6e-05  27%  1i5cB  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    6e-05  27%  1i5bB  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    6e-05  27%  1i5bA  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    6e-05  31%  1heyA  [x.x.x] CHEY
    8e-05  23%  1b3qA  [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)
    8e-05  24%  1a2oA  [c.23.1 - c.40.1] CHEB METHYLESTERASE
    1e-04  28%  3h5iA  [x.x.x] RESPONSE REGULATOR/SENSORY BOX PROTEIN/GGDEF
    1e-04  31%  6chyA  [c.23.1] CHEY
    1e-04  24%  2i6fC  [x.x.x] RESPONSE REGULATOR FRZS
    1e-04  24%  2i6fB  [x.x.x] RESPONSE REGULATOR FRZS
    1e-04  24%  2i6fA  [x.x.x] RESPONSE REGULATOR FRZS
    1e-04  24%  1i5dA  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    1e-04  24%  2gkgA  [x.x.x] RESPONSE REGULATOR HOMOLOG
    1e-04  26%  3dzdA  [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    2e-04  31%  2vuiB  [x.x.x] HYDROGENASE TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-04  29%  1rnlA  [x.x.x] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    2e-04  26%  2nt4A  [x.x.x] RESPONSE REGULATOR HOMOLOG
    2e-04  31%  2jk1A  [x.x.x] HYDROGENASE TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-04  27%  1i59B  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    2e-04  27%  1i58A  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    2e-04  24%  3i42A  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN (CHEY-
    2e-04  27%  2ch4A  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    2e-04  29%  1a04A  [c.23.1 - a.4.6] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN
    2e-04  26%  1i58B  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    3e-04  27%  3eodA  [x.x.x] PROTEIN HNR
    3e-04  22%  1b3qB  [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)
    4e-04  21%  2qr3A  [x.x.x] TWO-COMPONENT SYSTEM RESPONSE REGULATOR
    4e-04  29%  1qkkA  [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    4e-04  29%  1l5zA  [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    4e-04  29%  1l5yB  [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    4e-04  29%  1l5yA  [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    4e-04  26%  1i5aB  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    5e-04  31%  2vuhB  [x.x.x] HYDROGENASE TRANSCRIPTIONAL REGULATORY PROTEIN
    5e-04  31%  3cg4A  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN (CHEY-
    5e-04  32%  1c4wA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    7e-04  28%  1i5cA  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    7e-04  26%  1i5aA  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    7e-04  27%  1i59A  [d.122.1] CHEMOTAXIS PROTEIN CHEA
    7e-04  37%  3eqzB  [x.x.x] RESPONSE REGULATOR
    7e-04  37%  3eqzA  [x.x.x] RESPONSE REGULATOR
    7e-04  26%  1dbwB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    7e-04  26%  1dbwA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    7e-04  31%  3b2nA  [x.x.x] UNCHARACTERIZED PROTEIN Q99UF4
    9e-04  27%  1d5wB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    9e-04  27%  1d5wA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    9e-04  25%  2ch4B  [x.x.x] CHEMOTAXIS PROTEIN CHEA
:916

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1mb3A           ----------------------------------------------------------------------
1mavA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
2r25B           ----------------------------------------------------------------------
1oxkB           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1m5uA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2oqrA           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
1mb0A           ----------------------------------------------------------------------
2jvjA           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
1fspA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2jvkA           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
1srrC           ----------------------------------------------------------------------
1srrB           ----------------------------------------------------------------------
1srrA           ----------------------------------------------------------------------
1peyC           ----------------------------------------------------------------------
1natA           ----------------------------------------------------------------------
2jviA           ----------------------------------------------------------------------
1zgzB           ----------------------------------------------------------------------
1zgzA           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1jlkB           ----------------------------------------------------------------------
1jlkA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
1i3cB           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1qmpB           ----------------------------------------------------------------------
1kgsA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1k68A           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1qmpA           ----------------------------------------------------------------------
1nxoA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
1nxxA           ----------------------------------------------------------------------
1nxsA           ----------------------------------------------------------------------
2ftkE           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1ys6A           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
2qzjA           ----------------------------------------------------------------------
1k66A           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1qmpD           ----------------------------------------------------------------------
3hebA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1p2fA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1vlzB           ----------------------------------------------------------------------
1vlzA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1i5cB           ----------------------------------------------------------------------
1i5bB           ----------------------------------------------------------------------
1i5bA           ----------------------------------------------------------------------
1heyA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2i6fC           ----------------------------------------------------------------------
2i6fB           ----------------------------------------------------------------------
2i6fA           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
2gkgA           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1rnlA           ----------------------------------------------------------------------
2nt4A           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
3i42A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1i58B           ----------------------------------------------------------------------
3eodA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2qr3A           ----------------------------------------------------------------------
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1i5aB           ----------------------------------------------------------------------
2vuhB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
1i59A           ----------------------------------------------------------------------
3eqzB           ----------------------------------------------------------------------
3eqzA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1mb3A           ----------------------------------------------------------------------
1mavA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
2r25B           ----------------------------------------------------------------------
1oxkB           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1m5uA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2oqrA           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
1mb0A           ----------------------------------------------------------------------
2jvjA           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
1fspA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2jvkA           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
1srrC           ----------------------------------------------------------------------
1srrB           ----------------------------------------------------------------------
1srrA           ----------------------------------------------------------------------
1peyC           ----------------------------------------------------------------------
1natA           ----------------------------------------------------------------------
2jviA           ----------------------------------------------------------------------
1zgzB           ----------------------------------------------------------------------
1zgzA           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1jlkB           ----------------------------------------------------------------------
1jlkA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
1i3cB           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1qmpB           ----------------------------------------------------------------------
1kgsA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1k68A           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1qmpA           ----------------------------------------------------------------------
1nxoA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
1nxxA           ----------------------------------------------------------------------
1nxsA           ----------------------------------------------------------------------
2ftkE           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1ys6A           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
2qzjA           ----------------------------------------------------------------------
1k66A           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1qmpD           ----------------------------------------------------------------------
3hebA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1p2fA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1vlzB           ----------------------------------------------------------------------
1vlzA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1i5cB           ----------------------------------------------------------------------
1i5bB           ----------------------------------------------------------------------
1i5bA           ----------------------------------------------------------------------
1heyA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2i6fC           ----------------------------------------------------------------------
2i6fB           ----------------------------------------------------------------------
2i6fA           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
2gkgA           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1rnlA           ----------------------------------------------------------------------
2nt4A           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
3i42A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1i58B           ----------------------------------------------------------------------
3eodA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2qr3A           ----------------------------------------------------------------------
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1i5aB           ----------------------------------------------------------------------
2vuhB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
1i59A           ----------------------------------------------------------------------
3eqzB           ----------------------------------------------------------------------
3eqzA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1mb3A           ----------------------------------------------------------------------
1mavA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
2r25B           ----------------------------------------------------------------------
1oxkB           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1m5uA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2oqrA           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
1mb0A           ----------------------------------------------------------------------
2jvjA           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
1fspA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2jvkA           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
1srrC           ----------------------------------------------------------------------
1srrB           ----------------------------------------------------------------------
1srrA           ----------------------------------------------------------------------
1peyC           ----------------------------------------------------------------------
1natA           ----------------------------------------------------------------------
2jviA           ----------------------------------------------------------------------
1zgzB           ----------------------------------------------------------------------
1zgzA           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1jlkB           ----------------------------------------------------------------------
1jlkA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
1i3cB           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1qmpB           ----------------------------------------------------------------------
1kgsA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1k68A           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1qmpA           ----------------------------------------------------------------------
1nxoA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
1nxxA           ----------------------------------------------------------------------
1nxsA           ----------------------------------------------------------------------
2ftkE           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1ys6A           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
2qzjA           ----------------------------------------------------------------------
1k66A           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1qmpD           ----------------------------------------------------------------------
3hebA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1p2fA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1vlzB           ----------------------------------------------------------------------
1vlzA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1i5cB           ----------------------------------------------------------------------
1i5bB           ----------------------------------------------------------------------
1i5bA           ----------------------------------------------------------------------
1heyA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2i6fC           ----------------------------------------------------------------------
2i6fB           ----------------------------------------------------------------------
2i6fA           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
2gkgA           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1rnlA           ----------------------------------------------------------------------
2nt4A           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
3i42A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1i58B           ----------------------------------------------------------------------
3eodA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2qr3A           ----------------------------------------------------------------------
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1i5aB           ----------------------------------------------------------------------
2vuhB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
1i59A           ----------------------------------------------------------------------
3eqzB           ----------------------------------------------------------------------
3eqzA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1mb3A           ----------------------------------------------------------------------
1mavA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
2r25B           ----------------------------------------------------------------------
1oxkB           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1m5uA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2oqrA           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
1mb0A           ----------------------------------------------------------------------
2jvjA           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
1fspA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2jvkA           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
1srrC           ----------------------------------------------------------------------
1srrB           ----------------------------------------------------------------------
1srrA           ----------------------------------------------------------------------
1peyC           ----------------------------------------------------------------------
1natA           ----------------------------------------------------------------------
2jviA           ----------------------------------------------------------------------
1zgzB           ----------------------------------------------------------------------
1zgzA           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1jlkB           ----------------------------------------------------------------------
1jlkA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
1i3cB           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1qmpB           ----------------------------------------------------------------------
1kgsA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1k68A           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1qmpA           ----------------------------------------------------------------------
1nxoA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
1nxxA           ----------------------------------------------------------------------
1nxsA           ----------------------------------------------------------------------
2ftkE           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1ys6A           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
2qzjA           ----------------------------------------------------------------------
1k66A           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1qmpD           ----------------------------------------------------------------------
3hebA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1p2fA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1vlzB           ----------------------------------------------------------------------
1vlzA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1i5cB           ----------------------------------------------------------------------
1i5bB           ----------------------------------------------------------------------
1i5bA           ----------------------------------------------------------------------
1heyA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2i6fC           ----------------------------------------------------------------------
2i6fB           ----------------------------------------------------------------------
2i6fA           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
2gkgA           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1rnlA           ----------------------------------------------------------------------
2nt4A           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
3i42A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1i58B           ----------------------------------------------------------------------
3eodA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2qr3A           ----------------------------------------------------------------------
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1i5aB           ----------------------------------------------------------------------
2vuhB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
1i59A           ----------------------------------------------------------------------
3eqzB           ----------------------------------------------------------------------
3eqzA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1mb3A           ----------------------------------------------------------------------
1mavA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
2r25B           ----------------------------------------------------------------------
1oxkB           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1m5uA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2oqrA           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
1mb0A           ----------------------------------------------------------------------
2jvjA           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
1fspA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2jvkA           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
1srrC           ----------------------------------------------------------------------
1srrB           ----------------------------------------------------------------------
1srrA           ----------------------------------------------------------------------
1peyC           ----------------------------------------------------------------------
1natA           ----------------------------------------------------------------------
2jviA           ----------------------------------------------------------------------
1zgzB           ----------------------------------------------------------------------
1zgzA           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1jlkB           ----------------------------------------------------------------------
1jlkA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
1i3cB           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1qmpB           ----------------------------------------------------------------------
1kgsA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1k68A           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1qmpA           ----------------------------------------------------------------------
1nxoA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
1nxxA           ----------------------------------------------------------------------
1nxsA           ----------------------------------------------------------------------
2ftkE           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1ys6A           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
2qzjA           ----------------------------------------------------------------------
1k66A           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1qmpD           ----------------------------------------------------------------------
3hebA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1p2fA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1vlzB           ----------------------------------------------------------------------
1vlzA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1i5cB           ----------------------------------------------------------------------
1i5bB           ----------------------------------------------------------------------
1i5bA           ----------------------------------------------------------------------
1heyA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2i6fC           ----------------------------------------------------------------------
2i6fB           ----------------------------------------------------------------------
2i6fA           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
2gkgA           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1rnlA           ----------------------------------------------------------------------
2nt4A           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
3i42A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1i58B           ----------------------------------------------------------------------
3eodA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2qr3A           ----------------------------------------------------------------------
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1i5aB           ----------------------------------------------------------------------
2vuhB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
1i59A           ----------------------------------------------------------------------
3eqzB           ----------------------------------------------------------------------
3eqzA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1mb3A           ----------------------------------------------------------------------
1mavA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
2r25B           ----------------------------------------------------------------------
1oxkB           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1m5uA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2oqrA           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
1mb0A           ----------------------------------------------------------------------
2jvjA           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
1fspA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2jvkA           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
1srrC           ----------------------------------------------------------------------
1srrB           ----------------------------------------------------------------------
1srrA           ----------------------------------------------------------------------
1peyC           ----------------------------------------------------------------------
1natA           ----------------------------------------------------------------------
2jviA           ----------------------------------------------------------------------
1zgzB           ----------------------------------------------------------------------
1zgzA           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1jlkB           ----------------------------------------------------------------------
1jlkA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
1i3cB           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1qmpB           ----------------------------------------------------------------------
1kgsA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1k68A           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1qmpA           ----------------------------------------------------------------------
1nxoA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
1nxxA           ----------------------------------------------------------------------
1nxsA           ----------------------------------------------------------------------
2ftkE           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1ys6A           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
2qzjA           ----------------------------------------------------------------------
1k66A           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1qmpD           ----------------------------------------------------------------------
3hebA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1p2fA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1vlzB           ----------------------------------------------------------------------
1vlzA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1i5cB           ----------------------------------------------------------------------
1i5bB           ----------------------------------------------------------------------
1i5bA           ----------------------------------------------------------------------
1heyA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2i6fC           ----------------------------------------------------------------------
2i6fB           ----------------------------------------------------------------------
2i6fA           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
2gkgA           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1rnlA           ----------------------------------------------------------------------
2nt4A           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
3i42A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1i58B           ----------------------------------------------------------------------
3eodA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2qr3A           ----------------------------------------------------------------------
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1i5aB           ----------------------------------------------------------------------
2vuhB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
1i59A           ----------------------------------------------------------------------
3eqzB           ----------------------------------------------------------------------
3eqzA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1mb3A           ----------------------------------------------------------------------
1mavA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
2r25B           ----------------------------------------------------------------------
1oxkB           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1m5uA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2oqrA           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
1mb0A           ----------------------------------------------------------------------
2jvjA           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
1fspA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2jvkA           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
1srrC           ----------------------------------------------------------------------
1srrB           ----------------------------------------------------------------------
1srrA           ----------------------------------------------------------------------
1peyC           ----------------------------------------------------------------------
1natA           ----------------------------------------------------------------------
2jviA           ----------------------------------------------------------------------
1zgzB           ----------------------------------------------------------------------
1zgzA           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1jlkB           ----------------------------------------------------------------------
1jlkA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
1i3cB           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1qmpB           ----------------------------------------------------------------------
1kgsA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1k68A           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1qmpA           ----------------------------------------------------------------------
1nxoA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
1nxxA           ----------------------------------------------------------------------
1nxsA           ----------------------------------------------------------------------
2ftkE           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1ys6A           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
2qzjA           ----------------------------------------------------------------------
1k66A           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1qmpD           ----------------------------------------------------------------------
3hebA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1p2fA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1vlzB           ----------------------------------------------------------------------
1vlzA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1i5cB           ----------------------------------------------------------------------
1i5bB           ----------------------------------------------------------------------
1i5bA           ----------------------------------------------------------------------
1heyA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2i6fC           ----------------------------------------------------------------------
2i6fB           ----------------------------------------------------------------------
2i6fA           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
2gkgA           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1rnlA           ----------------------------------------------------------------------
2nt4A           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
3i42A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1i58B           ----------------------------------------------------------------------
3eodA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2qr3A           ----------------------------------------------------------------------
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1i5aB           ----------------------------------------------------------------------
2vuhB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
1i59A           ----------------------------------------------------------------------
3eqzB           ----------------------------------------------------------------------
3eqzA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxEQASHLALSSQYKSEFLSNMSHELRTPLNSLLILARILVENKDGNLSPKQVEYAETXXXXXXXXX
3dgeA           -----------------KTEFIANISHELRTPLTAIKAYAETIY-NSLGELDLSTLEFLEVIIDQSNHXX
2c2aA           -----KELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIY-NSLGELDLSTLEFLEVIIDQSNHXX
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1mb3A           ----------------------------------------------------------------------
1mavA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
2r25B           ----------------------------------------------------------------------
1oxkB           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1m5uA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
3d36B           ----------------------ASISHEIRNPLTAARGFIQLIEEQPLA--ADKRRQYARIAIEELDRAE
3d36A           ----------------------ASISHEIRNPLTAARGFIQLIEEQPLA--ADKRRQYARIAIEELDRAE
2oqrA           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
1mb0A           ----------------------------------------------------------------------
2jvjA           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
1fspA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2jvkA           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
1srrC           ----------------------------------------------------------------------
1srrB           ----------------------------------------------------------------------
1srrA           ----------------------------------------------------------------------
1peyC           ----------------------------------------------------------------------
1natA           ----------------------------------------------------------------------
2jviA           ----------------------------------------------------------------------
1zgzB           ----------------------------------------------------------------------
1zgzA           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1jlkB           ----------------------------------------------------------------------
1jlkA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
1i3cB           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1qmpB           ----------------------------------------------------------------------
1kgsA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1k68A           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1qmpA           ----------------------------------------------------------------------
1nxoA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
1nxxA           ----------------------------------------------------------------------
1nxsA           ----------------------------------------------------------------------
2ftkE           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1ys6A           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
2qzjA           ----------------------------------------------------------------------
1k66A           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1qmpD           ----------------------------------------------------------------------
3hebA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1p2fA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1vlzB           ----------------------------------------------------------------------
1vlzA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1i5cB           ----------------------------------------------------------------------
1i5bB           ----------------------------------------------------------------------
1i5bA           ----------------------------------------------------------------------
1heyA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2i6fC           ----------------------------------------------------------------------
2i6fB           ----------------------------------------------------------------------
2i6fA           ----------------------------------------------------------------------
1i5dA           ----------------------------------------------------------------------
2gkgA           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1rnlA           ----------------------------------------------------------------------
2nt4A           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
3i42A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1i58B           ----------------------------------------------------------------------
3eodA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2qr3A           ----------------------------------------------------------------------
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1i5aB           ----------------------------------------------------------------------
2vuhB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
1i59A           ----------------------------------------------------------------------
3eqzB           ----------------------------------------------------------------------
3eqzA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXAKIEAGKLIVKPEQISLTELIYTLERQFQPIARQKLLDFTIQLDNDIPKTFFTDKNRLMQI
3dgeA           XXXXXXXDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQV
2c2aA           XXXXXXXDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQV
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1mb3A           ----------------------------------------------------------------------
1mavA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
2r25B           ----------------------------------------------------------------------
1oxkB           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1m5uA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
3d36B           AIITDYLTFAKPAPET----PEKLNVKLEIERVIDILRPLANMSCVDIQATL---APFSVIGEREKFRQC
3d36A           AIITDYLTFAKPAPET----PEKLNVKLEIERVIDILRPLANMSCVDIQATL---APFSVIGEREKFRQC
2oqrA           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
1mb0A           ----------------------------------------------------------------------
2jvjA           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
1fspA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2jvkA           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
1srrC           ----------------------------------------------------------------------
1srrB           ----------------------------------------------------------------------
1srrA           ----------------------------------------------------------------------
1peyC           ----------------------------------------------------------------------
1natA           ----------------------------------------------------------------------
2jviA           ----------------------------------------------------------------------
1zgzB           ----------------------------------------------------------------------
1zgzA           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1jlkB           ----------------------------------------------------------------------
1jlkA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
1i3cB           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1qmpB           ----------------------------------------------------------------------
1kgsA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1k68A           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1qmpA           ----------------------------------------------------------------------
1nxoA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
1nxxA           ----------------------------------------------------------------------
1nxsA           ----------------------------------------------------------------------
2ftkE           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1ys6A           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
2qzjA           ----------------------------------------------------------------------
1k66A           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1qmpD           ----------------------------------------------------------------------
3hebA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1p2fA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1vlzB           ----------------------------------------------------------------------
1vlzA           ----------------------------------------------------------------------
1id0A           ----------------------------LLDNLTSALNKVYQRKGVNISLDISPEI--SFVGEQNDFVEV
1e6lA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1i5cB           ----------------------------------------------------DTELDRTFVEEIGELLHL
1i5bB           ----------------------------------------------------DTELDRTFVEEIGELLHL
1i5bA           ----------------------------------------------------DTELDRTFVEEIGELLHL
1heyA           ----------------------------------------------------------------------
1b3qA           -----------LDLQNVVMKIRMVPISFVFNRFPRMVRDLAKKKEVNFIMREDTELDRTFVEEIGELLHL
1a2oA           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2i6fC           ----------------------------------------------------------------------
2i6fB           ----------------------------------------------------------------------
2i6fA           ----------------------------------------------------------------------
1i5dA           -----------------VMKIRMVPISFVFNRFPRMVRDLAKKKEVNFIMREDTELDRTFVEEIGELLHL
2gkgA           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1rnlA           ----------------------------------------------------------------------
2nt4A           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
1i59B           ----------------------------------------------------DTELDRTFVEEIGELLHL
1i58A           ----------------------------------------------------DTELDRTFVEEIGELLHL
3i42A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------DTELDRTFVEEIGELLHL
1a04A           ----------------------------------------------------------------------
1i58B           ----------------------------------------------------DTELDRTFVEEIGELLHL
3eodA           ----------------------------------------------------------------------
1b3qB           -----------LDLQNVVMKIRMVPISFVFNRFPRMVRDLAKKKEVNFIMREDTELDRTFVEEIGELLHL
2qr3A           ----------------------------------------------------------------------
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1i5aB           ----------------------------------------------------DTELDRTFVEEIGELLHL
2vuhB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1i5cA           ----------------------------------------------------DTELDRTFVEEIGELLHL
1i5aA           ----------------------------------------------------DTELDRTFVEEIGELLHL
1i59A           ----------------------------------------------------DTELDRTFVEEIGELLHL
3eqzB           ----------------------------------------------------------------------
3eqzA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------DTELDRTFVEEIGELLHL


                         .         +         .         .         .         .         *:700
query           LKNLLSNAFKFTNEGCVNLHVQRATKISEKGTQIVFSVSDTGIGIAKDKQALIFEAFQQGDGTTSRKFGG
3dgeA           LLNLLNNGVKYSKKDAPDKYVK--VILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPG
2c2aA           LLNLLNNGVKYSKKDAPDKYVK--VILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVD---------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1mb3A           ----------------------------------------------------------------------
1mavA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
2r25B           ----------------------------------------------------------------------
1oxkB           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1m5uA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
3d36B           LLNVMKNAIEMPNGGTLQVYV------SIDNGRVLIRIADTGVGMTKEQLERLGEPY-----FTTKGVKG
3d36A           LLNVMKNAIEMPNGGTLQVYV------SIDNGRVLIRIADTGVGMTKEQLERLGEPY-----FTTKGVKG
2oqrA           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
1mb0A           ----------------------------------------------------------------------
2jvjA           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
1fspA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2jvkA           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
1srrC           ----------------------------------------------------------------------
1srrB           ----------------------------------------------------------------------
1srrA           ----------------------------------------------------------------------
1peyC           ----------------------------------------------------------------------
1natA           ----------------------------------------------------------------------
2jviA           ----------------------------------------------------------------------
1zgzB           ----------------------------------------------------------------------
1zgzA           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1jlkB           ----------------------------------------------------------------------
1jlkA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
1i3cB           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1qmpB           ----------------------------------------------------------------------
1kgsA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1bxdA           -----------------------------------FQVEDDGPGIAPEQRKHLFQPFVRGD--SARTISG
1k68A           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1qmpA           ----------------------------------------------------------------------
1nxoA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
1nxxA           ----------------------------------------------------------------------
1nxsA           ----------------------------------------------------------------------
2ftkE           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1ys6A           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
2qzjA           ----------------------------------------------------------------------
1k66A           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1qmpD           ----------------------------------------------------------------------
3hebA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1p2fA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1vlzB           ----------------------------------------------------------------------
1vlzA           ----------------------------------------------------------------------
1id0A           MGNVLDNACKYCLE-----FVEISARQTDEHLYIV--VEDDGPGIPLSKREVIFDRGQRVD--TLRP--G
1e6lA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1i5cB           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGI--DKEKIIRKAIEKGLIDESKAFST
1i5bB           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGI--DKEKIIRKAIEKGLIDESKAFST
1i5bA           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGI--DKEKIIRKAIEKGLIDESKAFST
1heyA           ----------------------------------------------------------------------
1b3qA           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGI--DKEKIIRKAIEKGLIDESKAAGF
1a2oA           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2i6fC           ----------------------------------------------------------------------
2i6fB           ----------------------------------------------------------------------
2i6fA           ----------------------------------------------------------------------
1i5dA           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGIDKEKQEILNFLFVPGFSTKEKEVSG
2gkgA           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1rnlA           ----------------------------------------------------------------------
2nt4A           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
1i59B           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGIDKEKQEILNFLFVPGFSTKEKEVSG
1i58A           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGIDKEKQEILNFLFVPGFSTKEKEVSG
3i42A           ----------------------------------------------------------------------
2ch4A           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGIDKEKQEILNFLFVPGFSTKEKEVSG
1a04A           ----------------------------------------------------------------------
1i58B           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGI--DKEKIIRKAIEKGLIDESKAVPG
3eodA           ----------------------------------------------------------------------
1b3qB           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGIDKEKQEILNFLFVPGFSTKEKEVSG
2qr3A           ----------------------------------------------------------------------
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1i5aB           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGI--DKEKIIRKAIEKGLIDESKAAGF
2vuhB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1i5cA           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGIDKEKQEILNFLFVPGFSTKER----
1i5aA           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGI--DKEKIIRKAIEKGDESKAATLSD
1i59A           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGI--DKEKIIRKAIEKGPGFSTKR---
3eqzB           ----------------------------------------------------------------------
3eqzA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2ch4B           LRNAIDHGIEPKEERIAKGKPPIGTLIRHEGNNVVIEVEDDGRGI--DKEKIIRKAIEKGDQEILNFLFV


                         .         .         .         .         +         .         .:770
query           TGLGLSICRELAGLLGGFIELQSIKGKGSTFSVYIPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dgeA           TGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIP----------------------------------
2c2aA           TGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIP----------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1mb3A           ----------------------------------------------------------------------
1mavA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
2r25B           ----------------------------------------------------------------------
1oxkB           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1m5uA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
3d36B           TGLGMMVVYRIIESMNGTIRIESEIHKGTTVSIYLP----------------------------------
3d36A           TGLGMMVVYRIIESMNGTIRIESEIHKGTTVSIYLP----------------------------------
2oqrA           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
1mb0A           ----------------------------------------------------------------------
2jvjA           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
1fspA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2jvkA           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
1srrC           ----------------------------------------------------------------------
1srrB           ----------------------------------------------------------------------
1srrA           ----------------------------------------------------------------------
1peyC           ----------------------------------------------------------------------
1natA           ----------------------------------------------------------------------
2jviA           ----------------------------------------------------------------------
1zgzB           ----------------------------------------------------------------------
1zgzA           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1jlkB           ----------------------------------------------------------------------
1jlkA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
1i3cB           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1qmpB           ----------------------------------------------------------------------
1kgsA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1bxdA           TGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLP----------------------------------
1k68A           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1qmpA           ----------------------------------------------------------------------
1nxoA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
1nxxA           ----------------------------------------------------------------------
1nxsA           ----------------------------------------------------------------------
2ftkE           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1ys6A           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
2qzjA           ----------------------------------------------------------------------
1k66A           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1qmpD           ----------------------------------------------------------------------
3hebA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1p2fA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1vlzB           ----------------------------------------------------------------------
1vlzA           ----------------------------------------------------------------------
1id0A           QGVGLAVAREI-----------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1i5cB           KGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLP----------------------------------
1i5bB           KGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLP----------------------------------
1i5bA           KGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLP----------------------------------
1heyA           ----------------------------------------------------------------------
1b3qA           SGVGMDVVKNVVESLNGSMGIESEKDKGTKVTIRLP----------------------------------
1a2oA           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2i6fC           ----------------------------------------------------------------------
2i6fB           ----------------------------------------------------------------------
2i6fA           ----------------------------------------------------------------------
1i5dA           RGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLP----------------------------------
2gkgA           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1rnlA           ----------------------------------------------------------------------
2nt4A           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
1i59B           RGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLP----------------------------------
1i58A           RGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLP----------------------------------
3i42A           ----------------------------------------------------------------------
2ch4A           RGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLP----------------------------------
1a04A           ----------------------------------------------------------------------
1i58B           FSVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLP----------------------------------
3eodA           ----------------------------------------------------------------------
1b3qB           RGVGMDVVKNVVESLNGSMGIESEKDKGTKVTIRLP----------------------------------
2qr3A           ----------------------------------------------------------------------
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1i5aB           STVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLP----------------------------------
2vuhB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1i5cA           -GVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLP----------------------------------
1i5aA           QGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLP----------------------------------
1i59A           -GVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLP----------------------------------
3eqzB           ----------------------------------------------------------------------
3eqzA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2ch4B           PGFSMDVVKNVVESLNGSISIESEKDKGTKVTIRLP----------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxQGDKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDL
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
1w25A           -----------------------RILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARDLP-DI
2v0nA           -----------------------RILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARDLP-DI
1m5tA           -----------------------KVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKP-DL
2zwmA           -----------------------KILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQP-DL
1nxpA           -----------------------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALE-QFEAEQPDI
3dgfC           -----------------------KVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSETP--DL
3dgeC           -----------------------KVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSETP--DL
2a9oA           -----------------------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALE-QFEAEQPDI
3gt7A           ------------------------ILIVEDSPTQAEHLKHILEETGYQTEHVRNGREAVRFLSLTRP-DL
1mvoA           -----------------------KILVVDDEESIVTLLQYNLERSGYDVITASDGEEALK-KAETEKPDL
2a9rA           -----------------------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALE-QFEAEQPDI
2ayzA           ------------------------ILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNH-IDI
2ayxA           ------------------------ILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNH-IDI
1p6qA           -----------------------KVLIVDDQVTSRLLLGDALQQLGFQITAAGDGEQGMKIMAQNPH-HL
1mb3A           -----------------------KVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKP-DL
1mavA           -----------------------KVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKP-DL
1zesC           -----------------------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDL
1zesA           -----------------------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDL
2iynB           -----------------------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDL
1b00A           -----------------------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDL
2r25B           -----------------------KILVVEDNHVNQEVIKRMLNLEGIEIELACDGQEAKELTSKGENYNM
1oxkB           -----------------------KILVVEDNHVNQEVIKRMLNLEGIEIELACDGQEAKELTSKGENYNM
1oxbB           -----------------------KILVVEDNHVNQEVIKRMLNLEGIEIELACDGQEAKELTSKGENYNM
1m5uA           -----------------------KVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKP-DL
2a9qA           -----------------------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALE------QFEA
1sd5A           -----------------------RVLIAEDEALIRMDLAEMLREEGYEIVGAGDGQEAVE-LAELHKPDL
1s8nA           -----------------------RVLIAEDEALIRMDLAEMLREEGYEIVGAGDGQEAVE-LAELHKPDL
1nxtA           -----------------------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALE-QFEAEQPDI
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2oqrA           ------------------------VLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRA-GADI
1zesB           -----------------------RILVVEDEAPIREMVCFVLEQNGFQPVEA---EDYDSAVNQLNWPDL
2j8eA           ----------------DKELK---FLVVDDESTMRRIVRNLLKE-----LGFNNVEEAEDGVLQAGGYGF
1dc7A           ------------------------VWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALAKTP--DV
2zayA           ----------------------WRIMLVDTQXXXXXXXXXXXXQEGFDIIQCGNAIEAVPVAVKTHP-HL
1tmyA           ---------------------GKRVLIVDDAAFMRMMLKDIITKAGYEVAGATNGREAVEKYKELKP-DI
3f7nA           ----------------DKELK---FLVVDDESTMRRIVRNLLKE-----LGFNNVEEAEDGVLQAGGYGF
2jb9B           -----------------------RILVVEAEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDL
2jb9A           -----------------------RILVVEAEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDL
1mb0A           -----------------------KVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKP-DL
2jvjA           -----------------------KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DL
2jbaA           -----------------------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDL
3fftA           ----------------DKELK---FLVVDDESTMRRIVRNLLKE-----LGFNNVEEAEDGVLQAGGYGF
1d4zA           ----------------DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
3c3mA           ----------------------YTILVVDDSP--IVDVFVTLERGGYRPITAFSGEECLEALNATPP-DL
1xheB           ------------------------ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYD-INL
1xheA           ------------------------ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYD-INL
1fspA           -----------------------KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DL
3ffxA           ----------------DKELK---FLVVDDESTMRRIVRNLLKE-----LGFNNVEEAEDGVLQAGGYGF
2jbaB           -----------------------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDL
1dc8A           ------------------------VWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALAKTPD---
1dz3A           -----------------------KVCIADDNRELVSLLDEYISSQDMEVITAYNGQDCLQMLEEKRP-DI
2jvkA           -----------------------KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DL
3ffwA           ----------------DKELK---FLVVDDQSTMRRIVRNLLKE-----LGFNNVEEAEDGVLQAGGYGF
1srrC           -----------------------KILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DL
1srrB           -----------------------KILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DL
1srrA           -----------------------KILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DL
1peyC           -----------------------KILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DL
1natA           -----------------------KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DL
2jviA           -----------------------KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DL
1zgzB           ----------------------HHIVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREI--QNQSVDL
1zgzA           ----------------------HHIVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREI--QNQSVDL
1udrA           --------------------KELKFLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
3breB           ------------------------VLLVDDQAMIGEAVRRSLSEAGIDFHFCSDPQQAVAVANQIKPT-V
3breA           ------------------------VLLVDDQAMIGEAVRRSLSEAGIDFHFCSDPQQAVAVANQIKPT-V
1udrB           -----------------------KFLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
3jteA           -----------------------KILVIDDESTILQNIKFLLEIDGNEVLTASSSTEGLRIFTENNSIDV
1jlkB           ------------------------ILLVEDSKADSRLVQEVLKTSTIELIILRDGLAAMAFLQQSPRPNL
1jlkA           ------------------------ILLVEDSKADSRLVQEVLKTSTIELIILRDGLAAMAFLQQSPRPNL
2qxyB           -------------------------VVVDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRREK-IDL
2qxyA           -------------------------VVVDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRREK-IDL
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
1ys7B           -----------------------------------------------EVATAVDGAEALRSATENRP-DA
1ys7A           -----------------------------------------------EVATAVDGAEALRSATENRP-DA
1ys6B           -----------------------------------------------EVATAVDGAEALRSATENRP-DA
2iynA           -----------------------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDL
1i3cB           ------------------------ILLVEDSKADSRLVQEVLKTSTIELIILRDGLAAAFLQQQSPRPNL
1i3cA           ------------------------ILLVEDSKADSRLVQEVLKTSTIELIILRDGLAAAFLQQQSPRPNL
1qmpB           -----------------------KVCIADDNRELVSLLDEYISSQDMEVITAYNGQDCLQMLEEKRP-DI
1kgsA           -----------------------RVLVVEDERDLADLITEALKKETVDVCYDG-----EEGYALNEPFDV
3cwoX           ---------------------GKRVLIVDD---------------------ATNGREAVEKYKELKP-DI
1bxdA           ----------------------------------------------------------------------
1k68A           -----------------------KIFLVEDNKADIRLIQEALANSTVEVVTVRDGMEAMAYLRQEGEYDL
3i5aA           ------------------------VLLVDDQAMIGEAVRRGLAGHEIDFHFCADPHQAIAQAVQIKPT-V
3c97A           ------------------------VLIAEDNDICRLVAAKALEKCTNDITVVTNGLQALQAY-QNRQFDV
2iynC           -----------------------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDL
1zitA           -----------------------RVLVVDDEESITSSLSAILEEEGYHPDTAKTLREAEKKIKEL-FFPV
1qmpA           -----------------------KVCIADDNRELVSLLDEYISSQDMEVITAYNGQDCLQMLEEKRP-DI
1nxoA           -----------------------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREAEQFEAEQPXXXX
3cu5B           -----------------------RILIVDDEKLTRDGLIANINWKALQIDQADDGINAIQIALKHPP-NV
2pl1A           --------------------------------------------------------------------DI
2pkxB           --------------------------------------------------------------------DI
2pkxA           --------------------------------------------------------------------DI
1nxxA           -----------------------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREAEQFEAEQPXXXX
1nxsA           -----------------------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALE---QFEAEQX
2ftkE           -----------------------KILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DL
3cfyA           -----------------------RVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSKP-QL
1ys6A           -----------------------------------------------EVATAVDGAEALRSATENRP-DA
1mihA           ----------------DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
1cyeA           --------------RSDKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
2cheA           ----------------DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGFGF
1f4vC           ----------------DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
1djmA           ----------------DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
3chyA           ----------------DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
2qzjA           -----------------------KILIIDGDKDNCQKLKGFLEEKGISIDLAYNCEEAIGKIFSNK-YDL
1k66A           ------------------------LLVVEDSDEDFSTFQRLLQREGVPIYRCITGDQALDFLYQTPRPAV
1chnA           --------------------KELKFLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
1qmpD           -----------------------KVCIADDNRELVSLLDEYISSQDMEVITAYNGQDCLQMLEEKRP-DI
3hebA           -------------------------IVIEDDLGHARLIEKNIRRAGVEIIAFTDGTSALNYLVSAGRAQL
1ymuA           -----------------------KFLVVDD-----FSTGRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
1p2fA           ----------------------WKIAVVDDDKNILKKVSEKLQQLRVKTFLTG-----EDFLNDEEAFHV
1dcfA           ---------------------GLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKV--
3hdvD           ------------------------VLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGL
3hdvC           ------------------------VLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGL
3hdvB           ------------------------VLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGL
3hdvA           ------------------------VLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGL
5chyA           ----------------DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
1vlzB           ----------------DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
1vlzA           ----------------DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
1id0A           ----------------------------------------------------------------------
1e6lA           ----------------DKELK---FLVVD-----AFSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
1ymvA           -----------------------KFLVVDDGGTGRRIVRNLLKE-----LGFNNVEEAEDGVLQAGGYGF
1ehcA           ----------------DKELK---FLVVDK-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
1e6kA           --------------RSDKELK---FLVVAD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
3cu5A           -----------------------RILIVDDEKLTRDGLIANINWKALQIDQADDGINAIQIALKHPP-NV
1ab6A           -----------------------KFLVVDDNSTMRRIVRNLLKE-----LGFNNVEEAEDGVLQAGGYGF
1ab5A           -----------------------KFLVVDDNS-TMRRITRNL----LKELGFNNVEEAEDGVLQAGGYGF
1xhfA           ------------------------ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEHQ--ILSEYDINL
1jbeA           ----------------DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
1e6mA           ----------------DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
1i5cB           ----------------------------------------------------------------------
1i5bB           ----------------------------------------------------------------------
1i5bA           ----------------------------------------------------------------------
1heyA           --------------------------------------------------------------LQAGGYGF
1b3qA           ----------------------------------------------------------------------
1a2oA           -----------------------RVLSVDDSALMRQIMTEIINSHDMEMVATAPDPLVARDLIKKFNPDV
3h5iA           -----------------------KILIVEDSKFQAKTIANILNKYGYTVEIALTGEAAVEKVSGGWYPDL
6chyA           ----------------DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
2i6fC           -----------------------KILIVESDTALSATLRSALEGRGFTVDETTDGKSVEQIRRDRPDLVV
2i6fB           -----------------------KILIVESDTALSATLRSALEGRGFTVDETTDGKSVEQIRRDRPDLVV
2i6fA           -----------------------KILIVESDTALSATLRSALEGRGFTVDETTDGKSVEQIRRDRPDLVV
1i5dA           ----------------------------------------------------------------------
2gkgA           -----------------------KILIVESDTALSATLRSALEGRGFTVDETTDGKSVEQIRRDRPDLVV
3dzdA           -----------------------RVLVVDDEESITSSLSAILEEEGYHPDTAKTLREAEKKIKEL-FFPV
2vuiB           ------------------------ILLVDDEPHSLAAMKLALED-DFDVLTA-QGXXXXXXXXXXXWVQV
1rnlA           ---------------------------------------------------ASNGEQGIE-LAESLDPDL
2nt4A           -----------------------KILIVESDTALSATLRSALEGRGFTVDETTDGKSVEQIRRDRPDLVV
2jk1A           ------------------------ILLVDDEPHSLAAMKLALED-DFDVLTA-QGXXXXXXXXXXXWVQV
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
3i42A           -----------------------QALIVEDYQAAAETFKELLEMLGFQADYVMSGTDALHA-MSTRGYDA
2ch4A           ----------------------------------------------------------------------
1a04A           ---------------------------------------------------ASNGEQGIE-LAESLDPDL
1i58B           ----------------------------------------------------------------------
3eodA           -------------------LVGKQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGTP----
1b3qB           ----------------------------------------------------------------------
2qr3A           -------------------------IIIVDDNKGVLTAVQLLLKNHFSKVIXXXXXXXXXXXXREENPEV
1qkkA           ------------------------VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGL-SADFAGI
1l5zA           ------------------------VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGL-SADFAGI
1l5yB           ------------------------VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGL-SADFAGI
1l5yA           ------------------------VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGL-SADFAGI
1i5aB           ----------------------------------------------------------------------
2vuhB           ------------------------ILLVDDEPHSLAAMKLALED-DFDVLTA-QGXXXXXXXXXXXWVQV
3cg4A           -------------------------VIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFS-GV
1c4wA           ----------------DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVLQAGGYGF
1i5cA           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
1i59A           ----------------------------------------------------------------------
3eqzB           -----------------------RVFIVDDD-----TLTCNLLKTIVEPIF-GNVEAFQHLTLSLNKQDI
3eqzA           -----------------------RVFIVDDD-----TLTCNLLKTIVEPIF-GNVEAFQHLTLSLNKQDI
1dbwB           -------------------MQDYTVHIVDDEVRKSLAFMLTMNGFAVKM-----HQSAEAFLAFAPDVGV
1dbwA           -------------------MQDYTVHIVDDEVRKSLAFMLTMNGFAVKM-----HQSAEAFLAFAPDVGV
3b2nA           -----------------------------------------------------NGLDAMK-LIEEYNPNV
1d5wB           -------------------MQDYTVHIVDDEVRKSLAFMLTMNGFAVKM-----HQSAEAFLAFAPDVNG
1d5wA           -------------------MQDYTVHIVDDEVRKSLAFMLTMNGFAVKM-----HQSAEAFLAFAPDVNG
2ch4B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           VLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVW
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
1w25A           ILLDVMMPGMDGFTVCRKLKDDPTTRHIPVVLITALDGRGDRIQGLESGASDFLTKPIDDVMLFARVR--
2v0nA           ILLDVMMPGMDGFTVCRKLKDDPTTRHIPVVLITALDGRGDRIQGLESGASDFLTKPIDDVMLFARVR--
1m5tA           ILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRL
2zwmA           ILLDIMLPNKDGVEVCREVRK--KYD-MPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKAN
1nxpA           IILDLMLPEIDGLEVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKAL
3dgfC           IVLDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFI------
3dgeC           IVLDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFI------
2a9oA           IILDLMLPEIDGLEVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKAL
3gt7A           IISDVLMPEMDGYALCRWLKGQPDLRTIPVILLTILSDPRDVVRSLECGADDFITKP-------------
1mvoA           IVLDVMLPKLDGIEVCKQLRQ--QKLMFPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAI
2a9rA           IIL-LMLPEIDGLEVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKAL
2ayzA           VLSDVNMPNMDGYRLTQRIRQLGL--TLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLY
2ayxA           VLSDVNMPNMDGYRLTQRIRQLGL--TLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLY
1p6qA           VISDFNMPKMDGLGLLQAVRANPATKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKM-------
1mb3A           ILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVT------DEERIREGGCEAYISKPISVVHFLETIKRL
1mavA           ILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTAE------ERIREGGCEAYISKPISVVHFLETIKRL
1zesC           ILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAV
1zesA           ILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAV
2iynB           ILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAV
1b00A           ILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAV
2r25B           IFMDVQMPKVDGLLSTKMIRRDLGYTS-PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTIL---
1oxkB           IFMDVQMPKVDGLLSTKMIRRDLGYTS-PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTIL---
1oxbB           IFMDVQMPKVDGLLSTKMIRRDLGYTS-PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTIL---
1m5uA           ILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTA----------IRGGCEAYISKPISVVHFLETIKRL
2a9qA           EQPDIIILDLDGLEVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKAL
1sd5A           VIMDVKMPRRDGIDAASEIASK---RIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELA
1s8nA           VIMDVKMPRRDGIDAASEIASK---RIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELA
1nxtA           IIL-LMLP--DGLEVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKAL
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2oqrA           VLLDLMLPGMSGTDVCKQLRAR---SSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAV
1zesB           ILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAV
2j8eA           VISDWMMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKP-------------
1dc7A           LLSDIRMPGMDGLALLKQIKQ--RHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALV---
2zayA           IITEANMPKISGMDLFNSLKKNPQTASIPVIALSGRATAKEEAQLLDMGFIDFIAKPVNAIRL-------
1tmyA           VTMDITMPEMNGIDAIKEIMKIDPNAK--IIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEAL---
3f7nA           VISDWMMPNMDGLELLKTIRADGAMSALPVLMVTALAKKENIIAAAQAGASGYVVKP-------------
2jb9B           ILLEWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAV
2jb9A           ILLEWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAV
1mb0A           ILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVT-------------GGCEAYISKPISVVHFLETIK--
2jvjA           VLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGELDMAQESKELGALTHFAKPFDIDEIRDAVKKY
2jbaA           ILLAWMLPGGSGIQFIKHLRRESMTRDIPVVMLTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAV
3fftA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKP-------------
1d4zA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENVIAAAQAGASGYVVKP-------------
3c3mA           VLLDI---EPDGWETLERIKTDPATRDIPVL-LTAKPLTPEEANEYGSYIEDYILKPTTHHQLYEAIEHV
1xheB           VIMDINLPGKNG---LLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL
1xheA           VIMDINLPGKNG---LLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL
1fspA           VLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKY
3ffxA           VISDWRMPNMDGLELLKTIRADGAMSALPVLMVTAHAKKENIIAAAQAGASGYVVKP-------------
2jbaB           ILLAWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAV
1dc8A           VLLSIRMPGMDGLALLKQIKQ--RHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALV---
1dz3A           LLLDIIMPHLDGLAVLERIRAGFEHQP-NVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIR--
2jvkA           VLLDMKIPGMDGIEIAKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKY
3ffwA           VISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKP-------------
1srrC           VLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKY
1srrB           VLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKY
1srrA           VLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKY
1peyC           VLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKY
1natA           VLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKY
2jviA           VLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTAFAKPFDIDEIRDAVKKY
1zgzB           ILLDINLPDENGLLT----RALRERSTVGIILVTGRSDRIDRIVGLE-GADDYVTKPLELRELVVRVKNL
1zgzA           ILLDINLPDENGLLT----RALRERSTVGIILVTGRSDRIDRIVGLE-GADDYVTKPLELRELVVRVKNL
1udrA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEADAENIKALAQAGASGYVVKP-------------
3breB           ILQDLVMPGVDGLTLLAAYRGNPATRDIPIIVLSTKEEPTVKSAAFAAGANDYLVKLPDAIELVARIR--
3breA           ILQDLVMPGVDGLTLLAAYRGNPATRDIPIIVLSTKEEPTVKSAAFAAGANDYLVKLPDAIELVARIR--
1udrB           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEADAENIKALAQAGASGYVVKP-------------
3jteA           VITDMKMPKLSGMDILREIKKITPH--MAVIILTG---HGDLDNAILAGAFEYLRKPVTAQDL-------
1jlkB           ILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKMVQ--
1jlkA           ILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKMVQ--
2qxyB           VFVDVF----EGEESLNLIRRIEEFPDTKVAVLSAYVDKDLIINSVKAGAVDYILKPFRLDYLLERVK--
2qxyA           VFVDVF----EGEESLNLIRRIEEFPDTKVAVLSAYVDKDLIINSVKAGAVDYILKPFRLDYLLERVK--
1zh4A           ------------------IRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVA
1zh2B           ------------------IRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVA
1zh2A           ------------------IRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVA
1ys7B           IVLDINMPVLDGVSVVTALRAMDN--DVPVCVLSARSSVDDRVAGLEAGADDYLVKP-------------
1ys7A           IVLDINMPVLDGVSVVTALRAMDN--DVPVCVLSARSSVDDRVAGLEAGADDYLVKP-------------
1ys6B           IVLDINMPVLDGVSVVTALRAMDN--DVPVCVLSARSSVDDRVAGLEAGADDYLVKP-------------
2iynA           ILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARG---------ETGADDYITKPFSPKELVARIK--
1i3cB           ILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKVQGIW
1i3cA           ILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKVQGIW
1qmpB           LLL-IIMPHLDGLAVLERIRAQPN-----VIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIR--
1kgsA           VILDIL-PVHDGWEILKS---RESGVNTPVL-LTALSDVEYRVKGLN-GADDYLPKPFDLRELIARVRAL
3cwoX           VTMDITMPEMNGIDAIKEIMKIDPNAK--IIVCSAMGQQAMVIEAIKAGAKDFI----------------
1bxdA           ----------------------------------------------------------------------
1k68A           ILL-LNLPKKDGREVLAEIKSDPTLKRIPVVVLSTSINEDDIFHSYDLHVNCYITKSANLSQLFQIVK--
3i5aA           ILQDLVMPGLDGLTLVREYRSNPLTRDIPIIVLSTKEDPLIKSAAFAAGANDYLVKLPDNIELVARIR--
3c97A           IIMDIQMPVMDGLEAVSEIRNYERTHNTKRASXXXXXXXXXXXXRPGAELDEYVSKPLNPNQL-------
2iynC           ILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTA------------TGADDYITKPFSPKELVARIKAV
1zitA           IVLDVWMPDGDGVNFIDFIKE--NSPDSVVIVITGHGSVDTAVKAIKKGAYEFLEKPFSVERFL------
1qmpA           LLL-IIMPHLDGLAVLERIRAGFEHQP-NVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIR--
1nxoA           XXXXXXXXEV-----AKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKAL
3cu5B           LLTDVRMPRMDGIELVDNILKL--YPDCSVIFMSGYSDKEYLKAAIKFRAIRYVEKPIDPSEIMDALK--
2pl1A           AIVDLGLPDEDGLSLIRRWRSNDV--SLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEV-------
2pkxB           AIVDLGLPDEDGLSLIRRWRSNDV--SLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEV-------
2pkxA           AIVDLGLPDEDGLSLIRRWRSNDV--SLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEV-------
1nxxA           XXXXXXX------EVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKAL
1nxsA           XXXXXXXXXXXXXXVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKAL
2ftkE           VLL-MKIPGMDGIEILKRMKVIDE--NIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKY
3cfyA           IILDLKLPDMSGEDVLDWINQ----NDIPVIIATAHGSVDLAVNLIQKGAEDFLEKPINADRLKTSVALH
1ys6A           IVLDINMPVLDGVSVVTALRAMD--NDVPVCVLSARV--DDRVAGLEAGADDYLVKP-------------
1mihA           VISDWRMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
1cyeA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
2cheA           IISDWNMPNMDGLELLKTIRADSAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
1f4vC           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
1djmA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
3chyA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
2qzjA           IFLEIILSDGDGWTLCKKIRNV---TTCPIVYTYINEDQSILN-ALNSGGDDYLIKPLNLEILYAKVKAI
1k66A           ILLDLNLPGTDGREVLQEIKQDEVLKKIPVVIMTTSSNPKDXXXXXXXXXXXXXVKPLEIDRLTETVQTF
1chnA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
1qmpD           LLL-IIMPHLDGLAVLERIRAGHQPN---VIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIR--
3hebA           VLLDLNLPDT-GIDILKLVKENPHTRRSPVVILTTTDDQREIQRCYDLGANVYITKPVNYENFANAIR--
1ymuA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
1p2fA           VVLDVL-PDYSGYEICRIKETRPETW---VILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRF
1dcfA           VFMDVCMPGVENYQALRIHEKFTQRHQRPLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVL---
3hdvD           I-TDLRQPE-SGLDLIRTIRASER------AALSIIVVSGDTDVDVHLGVVDFLLKPVDLGKLLELV---
3hdvC           I-TDLRQPE-SGLDLIRTIRASER------AALSIIVVSGDTDVDVHLGVVDFLLKPVDLGKLLELV---
3hdvB           I-TDLRQPE-SGLDLIRTIRASER------AALSIIVVSGDTDVDVHLGVVDFLLKPVDLGKLLELV---
3hdvA           I-TDLRQPE-SGLDLIRTIRASER------AALSIIVVSGDTDVDVHLGVVDFLLKPVDLGKLLELV---
5chyA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGWVVKP-------------
1vlzB           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVXXXXXXXXXXXXXXXGASGYVVKP-------------
1vlzA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVXXXXXXXXXXXXXXXGASGYVVKP-------------
1id0A           ----------------------------------------------------------------------
1e6lA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
1ymvA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
1ehcA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
1e6kA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
3cu5A           LLTDVRMPRMDGIELVDNILKL--YPDCSVI-----FMSGYSDK-EYLRAIRYVEKPIDPSEIMDALK--
1ab6A           VISDWNMPNMDGLELLKTIRADGAMSALPVLMTTXXXXXXXXXXXXXXGASGYVVKP-------------
1ab5A           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
1xhfA           VI-DINLPGKNGLLLARELREQANVA----LFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL
1jbeA           VISDWNMPNMDGLELLKTIR--AAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
1e6mA           VISAWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
1i5cB           ----------------------------------------------------------------------
1i5bB           ----------------------------------------------------------------------
1i5bA           ----------------------------------------------------------------------
1heyA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
1b3qA           ----------------------------------------------------------------------
1a2oA           LTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTL-RALELGAIDFVTKP-------------
3h5iA           ILMDIELGEMDGVQTALAIQQISE---LPVVFLTAHTEPAVVEKIRSVTAYGYVMKSATEQVLITIVEMA
6chyA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVXXXXXXXXXXXXXXXGASGWVVKP-------------
2i6fC           LAVDLSAGQ-NGYLICGKLKKDDDLKNVPIVIIGNPDGFAQHRK-LKAHADEYVAKPVDADQLV------
2i6fB           LAVDLSAGQ-NGYLICGKLKKDDDLKNVPIVIIGNPDGFAQHRK-LKAHADEYVAKPVDADQLV------
2i6fA           LAVDLSAGQ-NGYLICGKLKKDDDLKNVPIVIIGNPDGFAQHRK-LKAHADEYVAKPVDADQLV------
1i5dA           ----------------------------------------------------------------------
2gkgA           LAVDLSAGQ-NGYLICGKLKKDDDLKNVPIVIIGNPDGFAQHRK-LKAHADEYVAKPVDADQLV------
3dzdA           IVLDV-WPDGDGVNFIDFIKE--NSPDSVVIVITGHGSVDTAVKAIKKGAYEFLEKPFSVERFL------
2vuiB           IICDQRMPGRTGVDFLTEVRRWPETVRIIITGYTASMMAAIND----AGIHQFLTKPWHPEQLLSSAR--
1rnlA           ILLDLNMPGMNGLETLDKLREKSLSGRIVVFSVSNH--EEDVVTALKRGADGYLLKDMEPEDLLKAL---
2nt4A           LAVDLSAGQ-NGYLICGKLKKDDDLKNVPIVII------GNPDRKLKAHADEYVAKPVDADQLV------
2jk1A           IICDQRMPGRTGVDFLTEVRRWPETVRIIITGYTASMMAAIND----AGIHQFLTKPWHPEQLLSSAR--
1i59B           ----------------------------------------------------------------------
1i58A           ----------------------------------------------------------------------
3i42A           VFIDLNLPDTSGLALVKQLRALPMEKTSKFVAVS--GFKNDLGKEACELFDFYLEKPIDIASLEPILQ--
2ch4A           ----------------------------------------------------------------------
1a04A           ILLDLNMPGMNGLETLDKLREKSLSGRIVVFSVSNH--EEDVVTALKRGADGYLLKDMEPEDLLKAL---
1i58B           ----------------------------------------------------------------------
3eodA           ---DLMICDIAGLKLLEHIRNRGD--QTPVLVISATENMADIAKALRLGVEDVLLKP--VNRLREMVFAC
1b3qB           ----------------------------------------------------------------------
2qr3A           VLLDMNFTSNEGLFWLHEIKR--QYRDLPVVLFTAYADIDLAVRGIKEGASDFVVKPWDNQKLLETL---
1qkkA           VISDIRMPGMDGLALFRKILALDP--DLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSAR--
1l5zA           VISDIRMPGMDGLALFRKILALDP--DLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSAR--
1l5yB           VISDIRMPGMDGLALFRKILALDP--DLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSAR--
1l5yA           VISDIRMPGMDGLALFRKILALDP--DLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSAR--
1i5aB           ----------------------------------------------------------------------
2vuhB           IICEQRMPGRTGVDFLTEVRRWPETVRIIITGYTASMMAAIND----AGIHQFLTKPWHPEQLLSSAR--
3cg4A           VLLDI---PGDGWDTIRAILDNSLEQGIAIV-LTAKNAP-DAKIGLQEYVVDYITKPFDNEDLI------
1c4wA           VI-SWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP-------------
1i5cA           ----------------------------------------------------------------------
1i5aA           ----------------------------------------------------------------------
1i59A           ----------------------------------------------------------------------
3eqzB           IILDLMMPDMDGIEVIRHL---------------------------------------------------
3eqzA           IILDLMMPDMDGIEVIRHL---------------------------------------------------
1dbwB           LVTDLRMPDMSGVELLRNLGDLKI--NIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFE-----------
1dbwA           LVTDLRMPDMSGVELLRNLGDLKI--NIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFE-----------
3b2nA           VILDIEMPGMTGLEVLAEIRK--KHLNIKVIIVTTFKRPGYFEKAVVNDVDAYVLKERSIEELV------
1d5wB           VLVTLRMPDMSGVELLRNLGDLKI--NIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFE-----------
1d5wA           VLVTLRMPDMSGVELLRNLGDLKI--NIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFE-----------
2ch4B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           LYRKVN
3dgeA           ------
2c2aA           ------
1w25A           ------
2v0nA           ------
1m5tA           LERQ--
2zwmA           LRRQL-
1nxpA           LRR---
3dgfC           ------
3dgeC           ------
2a9oA           LRR---
3gt7A           ------
1mvoA           LRR---
2a9rA           LRR---
2ayzA           AER---
2ayxA           AER---
1p6qA           ------
1mb3A           LERQ--
1mavA           LERQ--
1zesC           MRR---
1zesA           MRR---
2iynB           MRR---
1b00A           MRR---
2r25B           ------
1oxkB           ------
1oxbB           ------
1m5uA           LERQ--
2a9qA           LRR---
1sd5A           VSR---
1s8nA           VSR---
1nxtA           LRR---
3d36B           ------
3d36A           ------
2oqrA           LRR---
1zesB           MRR---
2j8eA           ------
1dc7A           ------
2zayA           ------
1tmyA           ------
3f7nA           ------
2jb9B           MRR---
2jb9A           MRR---
1mb0A           ------
2jvjA           LPLKSN
2jbaA           MRR---
3fftA           ------
1d4zA           ------
3c3mA           LARR--
1xheB           LSR---
1xheA           LSR---
1fspA           LPLKSN
3ffxA           ------
2jbaB           MRR---
1dc8A           ------
1dz3A           ------
2jvkA           LPLKSN
3ffwA           ------
1srrC           L-----
1srrB           L-----
1srrA           L-----
1peyC           L-----
1natA           L-----
2jviA           LPLKSN
1zgzB           LWR---
1zgzA           LWR---
1udrA           ------
3breB           ------
3breA           ------
1udrB           ------
3jteA           ------
1jlkB           ------
1jlkA           ------
2qxyB           ------
2qxyA           ------
1zh4A           LRR---
1zh2B           LRR---
1zh2A           LRR---
1ys7B           ------
1ys7A           ------
1ys6B           ------
2iynA           ------
1i3cB           L-----
1i3cA           L-----
1qmpB           ------
1kgsA           IRRK--
3cwoX           ------
1bxdA           ------
1k68A           ------
3i5aA           ------
3c97A           ------
2iynC           MRR---
1zitA           ------
1qmpA           ------
1nxoA           LRR---
3cu5B           ------
2pl1A           ------
2pkxB           ------
2pkxA           ------
1nxxA           LRR---
1nxsA           LRR---
2ftkE           L-----
3cfyA           LKR---
1ys6A           ------
1mihA           ------
1cyeA           ------
2cheA           ------
1f4vC           ------
1djmA           ------
3chyA           ------
2qzjA           LRR---
1k66A           I-----
1chnA           ------
1qmpD           ------
3hebA           ------
1ymuA           ------
1p2fA           LERE--
1dcfA           ------
3hdvD           ------
3hdvC           ------
3hdvB           ------
3hdvA           ------
5chyA           ------
1vlzB           ------
1vlzA           ------
1id0A           ------
1e6lA           ------
1ymvA           ------
1ehcA           ------
1e6kA           ------
3cu5A           ------
1ab6A           ------
1ab5A           ------
1xhfA           LSR---
1jbeA           ------
1e6mA           ------
1i5cB           ------
1i5bB           ------
1i5bA           ------
1heyA           ------
1b3qA           ------
1a2oA           ------
3h5iA           L-----
6chyA           ------
2i6fC           ------
2i6fB           ------
2i6fA           ------
1i5dA           ------
2gkgA           ------
3dzdA           ------
2vuiB           ------
1rnlA           ------
2nt4A           ------
2jk1A           ------
1i59B           ------
1i58A           ------
3i42A           ------
2ch4A           ------
1a04A           ------
1i58B           ------
3eodA           LY----
1b3qB           ------
2qr3A           ------
1qkkA           ------
1l5zA           ------
1l5yB           ------
1l5yA           ------
1i5aB           ------
2vuhB           ------
3cg4A           ------
1c4wA           ------
1i5cA           ------
1i5aA           ------
1i59A           ------
3eqzB           ------
3eqzA           ------
1dbwB           ------
1dbwA           ------
3b2nA           ------
1d5wB           ------
1d5wA           ------
2ch4B           ------