[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO49907.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3hv1B.bssp"
#ERROR : Can't open dsspfile "3hv1A.bssp"
#ERROR : Can't open dsspfile "1lstA.bssp"
#ERROR : Can't open dsspfile "2q2aA.bssp"
#ERROR : Can't open dsspfile "2pvuA.bssp"
#ERROR : Can't open dsspfile "2q2cA.bssp"
#ERROR : Can't open dsspfile "1hslA.bssp"
#ERROR : Can't open dsspfile "1wdnA.bssp"
#ERROR : Can't open dsspfile "1gggA.bssp"
#ERROR : Can't open dsspfile "2vhaA.bssp"
#ERROR : Can't open dsspfile "3i6vA.bssp"
#ERROR : Can't open dsspfile "2ia4B.bssp"
#ERROR : Can't open dsspfile "2ia4A.bssp"
#ERROR : Can't open dsspfile "1xt8B.bssp"
#ERROR : Can't open dsspfile "1xt8A.bssp"
#ERROR : Can't open dsspfile "3delB.bssp"
#ERROR : Can't open dsspfile "2ieeA.bssp"
#ERROR : Can't open dsspfile "2ieeB.bssp"
#ERROR : Can't open dsspfile "2o1mA.bssp"
#ERROR : Can't open dsspfile "3h7mA.bssp"
#ERROR : Can't open dsspfile "2v25A.bssp"
#ERROR : Can't open dsspfile "2pyyB.bssp"
#ERROR : Can't open dsspfile "2pyyA.bssp"
#ERROR : Can't open dsspfile "2o1mB.bssp"
#ERROR : Can't open dsspfile "3fatB.bssp"
#ERROR : Can't open dsspfile "3fatA.bssp"
#ERROR : Can't open dsspfile "3fasA.bssp"
#ERROR : Can't open dsspfile "2anjA.bssp"
#ERROR : Can't open dsspfile "1p1wA.bssp"
#ERROR : Can't open dsspfile "1y1mB.bssp"
#ERROR : Can't open dsspfile "1pbqB.bssp"
#ERROR : Can't open dsspfile "1p1qB.bssp"
#ERROR : Can't open dsspfile "1p1oA.bssp"
#ERROR : Can't open dsspfile "1p1nA.bssp"
#ERROR : Can't open dsspfile "1lb9A.bssp"
#ERROR : Can't open dsspfile "1lb8B.bssp"
#ERROR : Can't open dsspfile "1lb8A.bssp"
#ERROR : Can't open dsspfile "1xhyA.bssp"
#ERROR : Can't open dsspfile "1wvjA.bssp"
#ERROR : Can't open dsspfile "1syiA.bssp"
#ERROR : Can't open dsspfile "2p2aB.bssp"
#ERROR : Can't open dsspfile "2p2aA.bssp"
#ERROR : Can't open dsspfile "1mqiA.bssp"
#ERROR : Can't open dsspfile "1mqhA.bssp"
#ERROR : Can't open dsspfile "1mm6B.bssp"
#ERROR : Can't open dsspfile "1mm6A.bssp"
#ERROR : Can't open dsspfile "1m5dA.bssp"
#ERROR : Can't open dsspfile "1lbcC.bssp"
#ERROR : Can't open dsspfile "1lbcB.bssp"
#ERROR : Can't open dsspfile "1lbcA.bssp"
#ERROR : Can't open dsspfile "3h6wB.bssp"
#ERROR : Can't open dsspfile "3h6vB.bssp"
#ERROR : Can't open dsspfile "3h6uA.bssp"
#ERROR : Can't open dsspfile "3h6tC.bssp"
#ERROR : Can't open dsspfile "3h6tA.bssp"
#ERROR : Can't open dsspfile "2gfeA.bssp"
#ERROR : Can't open dsspfile "1ftlA.bssp"
#ERROR : Can't open dsspfile "1ftjB.bssp"
#ERROR : Can't open dsspfile "1ftjA.bssp"
#ERROR : Can't open dsspfile "3epeA.bssp"
#ERROR : Can't open dsspfile "3bfuC.bssp"
#ERROR : Can't open dsspfile "3bfuB.bssp"
#ERROR : Can't open dsspfile "3bbrA.bssp"
#ERROR : Can't open dsspfile "3b6wA.bssp"
#ERROR : Can't open dsspfile "3b6qA.bssp"
#ERROR : Can't open dsspfile "2uxaC.bssp"
#ERROR : Can't open dsspfile "2uxaB.bssp"
#ERROR : Can't open dsspfile "2uxaA.bssp"
#ERROR : Can't open dsspfile "1lbbA.bssp"
#ERROR : Can't open dsspfile "2i3vC.bssp"
#ERROR : Can't open dsspfile "2i3vA.bssp"
#ERROR : Can't open dsspfile "1vsoA.bssp"
#ERROR : Can't open dsspfile "2i3wA.bssp"
#ERROR : Can't open dsspfile "3dlnA.bssp"
#ERROR : Can't open dsspfile "1y20A.bssp"
#ERROR : Can't open dsspfile "1y1zA.bssp"
#ERROR : Can't open dsspfile "1y1mA.bssp"
#ERROR : Can't open dsspfile "1pbqA.bssp"
#ERROR : Can't open dsspfile "1pb7A.bssp"
#ERROR : Can't open dsspfile "2a5tA.bssp"
#ERROR : Can't open dsspfile "1pb9A.bssp"
#ERROR : Can't open dsspfile "1pb8A.bssp"
#ERROR : Can't open dsspfile "3gbaD.bssp"
#ERROR : Can't open dsspfile "3gbaC.bssp"
#ERROR : Can't open dsspfile "1ftkA.bssp"
#ERROR : Can't open dsspfile "2zntA.bssp"
#ERROR : Can't open dsspfile "2a5tB.bssp"
#ERROR : Can't open dsspfile "1ycjB.bssp"
#ERROR : Can't open dsspfile "1ycjA.bssp"
#ERROR : Can't open dsspfile "1txfA.bssp"
#ERROR : Can't open dsspfile "2qs4D.bssp"
#ERROR : Can't open dsspfile "2qs4A.bssp"
#ERROR : Can't open dsspfile "2pbwA.bssp"
#ERROR : Can't open dsspfile "3gbbA.bssp"
#ERROR : Can't open dsspfile "3gbaA.bssp"
#ERROR : Can't open dsspfile "2f36A.bssp"
#ERROR : Can't open dsspfile "2f34A.bssp"
#ERROR : Can't open dsspfile "3c31A.bssp"
#ERROR : Can't open dsspfile "2a5sA.bssp"
#ERROR : Can't open dsspfile "1s7yA.bssp"
#ERROR : Can't open dsspfile "1s50A.bssp"
#ERROR : Can't open dsspfile "3g3fB.bssp"
#ERROR : Can't open dsspfile "3g3gB.bssp"
#ERROR : Can't open dsspfile "3g3gA.bssp"
#ERROR : Can't open dsspfile "2i0cB.bssp"
#ERROR : Can't open dsspfile "2i0cA.bssp"
#ERROR : Can't open dsspfile "3g3iB.bssp"
#ERROR : Can't open dsspfile "3g3iA.bssp"
#ERROR : Can't open dsspfile "3g3hB.bssp"
#ERROR : Can't open dsspfile "3g3hA.bssp"
#ERROR : Can't open dsspfile "3g3jB.bssp"
#ERROR : Can't open dsspfile "3g3jA.bssp"
#ERROR : Can't open dsspfile "2v3uA.bssp"
#ERROR : Can't open dsspfile "3g3kB.bssp"
#ERROR : Can't open dsspfile "3g3kA.bssp"
#ERROR : Can't open dsspfile "1yaeC.bssp"
#ERROR : Can't open dsspfile "2rc9A.bssp"
#ERROR : Can't open dsspfile "2rc8B.bssp"
#ERROR : Can't open dsspfile "2rc7A.bssp"
#ERROR : Can't open dsspfile "2i0bC.bssp"
#ERROR : Can't open dsspfile "2i0bB.bssp"
#ERROR : Can't open dsspfile "2i0bA.bssp"
#ERROR : Can't open dsspfile "1yaeD.bssp"
#ERROR : Can't open dsspfile "1yaeA.bssp"
#ERROR : Can't open dsspfile "2v3tB.bssp"
#ERROR : Can't open dsspfile "1yaeB.bssp"
#ERROR : Can't open dsspfile "2v3tA.bssp"
#ERROR : Can't open dsspfile "1yaeE.bssp"

## Summary of PDB Search
:277
    5e-35  38%  3hv1B  [x.x.x] POLAR AMINO ACID ABC UPTAKE TRANSPORTER SUBSTRATE
    5e-35  38%  3hv1A  [x.x.x] POLAR AMINO ACID ABC UPTAKE TRANSPORTER SUBSTRATE
    2e-33  35%  1lstA  [c.94.1 (1lafE)] LYSINE, ARGININE, ORNITHINE-BINDING PROTEIN
    7e-31  35%  2q2aA  [x.x.x] ARTJ
    7e-31  35%  2pvuA  [x.x.x] ARTJ
    1e-30  35%  2q2cA  [x.x.x] ARTJ
    2e-30  35%  1hslA  [c.94.1] HISTIDINE-BINDING PROTEIN
    2e-29  29%  1wdnA  [c.94.1] GLUTAMINE BINDING PROTEIN
    2e-29  29%  1gggA  [c.94.1] GLUTAMINE BINDING PROTEIN
    6e-22  30%  2vhaA  [x.x.x] PERIPLASMIC BINDING TRANSPORT PROTEIN
    3e-20  29%  3i6vA  [x.x.x] PERIPLASMIC HIS/GLU/GLN/ARG/OPINE FAMILY-BINDING
    1e-19  30%  2ia4B  [x.x.x] PUTATIVE PERIPLASMIC BINDING TRANSPORT PROTEIN
    1e-19  30%  2ia4A  [x.x.x] PUTATIVE PERIPLASMIC BINDING TRANSPORT PROTEIN
    3e-17  28%  1xt8B  [x.x.x] PUTATIVE AMINO-ACID TRANSPORTER PERIPLASMIC
    3e-17  28%  1xt8A  [x.x.x] PUTATIVE AMINO-ACID TRANSPORTER PERIPLASMIC
    5e-17  25%  3delB  [x.x.x] ARGININE BINDING PROTEIN
    2e-15  31%  2ieeA  [x.x.x] PROBABLE ABC TRANSPORTER EXTRACELLULAR-BINDING
    7e-15  31%  2ieeB  [x.x.x] PROBABLE ABC TRANSPORTER EXTRACELLULAR-BINDING
    5e-13  25%  2o1mA  [x.x.x] PROBABLE AMINO-ACID ABC TRANSPORTER
    7e-13  23%  3h7mA  [x.x.x] SENSOR PROTEIN
    9e-13  25%  2v25A  [x.x.x] MAJOR CELL-BINDING FACTOR
    3e-12  26%  2pyyB  [x.x.x] IONOTROPIC GLUTAMATE RECEPTOR BACTERIAL
    3e-12  26%  2pyyA  [x.x.x] IONOTROPIC GLUTAMATE RECEPTOR BACTERIAL
    6e-12  24%  2o1mB  [x.x.x] PROBABLE AMINO-ACID ABC TRANSPORTER
    2e-08  27%  3fatB  [x.x.x] GLUTAMATE RECEPTOR 4
    2e-08  27%  3fatA  [x.x.x] GLUTAMATE RECEPTOR 4
    2e-08  27%  3fasA  [x.x.x] GLUTAMATE RECEPTOR 4
    3e-08  27%  2anjA  [x.x.x] GLUTAMATE RECEPTOR 2
    4e-08  26%  1p1wA  [c.94.1] GLUTAMATE RECEPTOR 2 PRECURSOR
    5e-08  26%  1y1mB  [x.x.x] GLUTAMATE [NMDA] RECEPTOR SUBUNIT ZETA 1
    5e-08  26%  1pbqB  [c.94.1] N-METHYL-D-ASPARTATE RECEPTOR SUBUNIT 1
    5e-08  26%  1p1qB  [c.94.1] GLUTAMATE RECEPTOR 2
    5e-08  26%  1p1oA  [c.94.1] GLUTAMATE RECEPTOR 2
    5e-08  26%  1p1nA  [c.94.1] GLUTAMATE RECEPTOR 2
    5e-08  26%  1lb9A  [c.94.1] GLUTAMATE RECEPTOR 2
    5e-08  26%  1lb8B  [c.94.1] GLUTAMATE RECEPTOR 2
    5e-08  26%  1lb8A  [c.94.1] GLUTAMATE RECEPTOR 2
    7e-08  26%  1xhyA  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  26%  1wvjA  [x.x.x] IONOTROPIC GLUTAMATE RECEPTOR 2
    7e-08  26%  1syiA  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  26%  2p2aB  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  26%  2p2aA  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  26%  1mqiA  [c.94.1] GLUTAMATE RECEPTOR 2
    7e-08  26%  1mqhA  [c.94.1] GLUTAMATE RECEPTOR 2
    7e-08  26%  1mm6B  [c.94.1] GLUTAMATE RECEPTOR 2
    7e-08  26%  1mm6A  [c.94.1] GLUTAMATE RECEPTOR 2
    7e-08  26%  1m5dA  [c.94.1] GLUTAMATE RECEPTOR 2
    7e-08  26%  1lbcC  [c.94.1] GLUTAMINE RECEPTOR 2
    7e-08  26%  1lbcB  [c.94.1] GLUTAMINE RECEPTOR 2
    7e-08  26%  1lbcA  [c.94.1] GLUTAMINE RECEPTOR 2
    7e-08  26%  3h6wB  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  26%  3h6vB  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  26%  3h6uA  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  26%  3h6tC  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  26%  3h6tA  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  27%  2gfeA  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  26%  1ftlA  [c.94.1] GLUTAMATE RECEPTOR SUBUNIT 2
    7e-08  26%  1ftjB  [c.94.1] GLUTAMATE RECEPTOR SUBUNIT 2
    7e-08  26%  1ftjA  [c.94.1] GLUTAMATE RECEPTOR SUBUNIT 2
    7e-08  27%  3epeA  [x.x.x] GLUTAMATE RECEPTOR 4,GLUTAMATE RECEPTOR
    7e-08  26%  3bfuC  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  26%  3bfuB  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  26%  3bbrA  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  26%  3b6wA  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-08  26%  3b6qA  [x.x.x] GLUTAMATE RECEPTOR 2
    9e-08  26%  2uxaC  [x.x.x] GLUTAMATE RECEPTOR SUBUNIT GLUR2-FLIP
    9e-08  26%  2uxaB  [x.x.x] GLUTAMATE RECEPTOR SUBUNIT GLUR2-FLIP
    9e-08  26%  2uxaA  [x.x.x] GLUTAMATE RECEPTOR SUBUNIT GLUR2-FLIP
    9e-08  26%  1lbbA  [c.94.1] GLUTAMINE RECEPTOR 2
    1e-07  26%  2i3vC  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-07  26%  2i3vA  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-07  23%  1vsoA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    1e-07  26%  2i3wA  [x.x.x] GLUTAMATE RECEPTOR SUBUNIT 2
    2e-07  27%  3dlnA  [x.x.x] GLUTAMATE RECEPTOR 3
    3e-07  25%  1y20A  [x.x.x] GLUTAMATE [NMDA] RECEPTOR SUBUNIT ZETA 1
    3e-07  25%  1y1zA  [x.x.x] GLUTAMATE [NMDA] RECEPTOR SUBUNIT ZETA 1
    3e-07  25%  1y1mA  [x.x.x] GLUTAMATE [NMDA] RECEPTOR SUBUNIT ZETA 1
    3e-07  25%  1pbqA  [c.94.1] N-METHYL-D-ASPARTATE RECEPTOR SUBUNIT 1
    3e-07  25%  1pb7A  [c.94.1] N-METHYL-D-ASPARTATE RECEPTOR SUBUNIT 1
    3e-07  25%  2a5tA  [x.x.x] N-METHYL-D-ASPARTATE RECEPTOR NMDAR1-4A SUBUNIT
    3e-07  25%  1pb9A  [c.94.1] N-METHYL-D-ASPARTATE RECEPTOR SUBUNIT 1
    3e-07  25%  1pb8A  [c.94.1] N-METHYL-D-ASPARTATE RECEPTOR SUBUNIT 1
    3e-07  23%  3gbaD  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    3e-07  23%  3gbaC  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    1e-06  23%  1ftkA  [c.94.1] GLUTAMATE RECEPTOR SUBUNIT 2
    2e-06  25%  2zntA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    2e-06  28%  2a5tB  [x.x.x] N-METHYL-D-ASPARTATE RECEPTOR NMDAR2A SUBUNIT
    2e-06  23%  1ycjB  [x.x.x] IONOTROPIC GLUTAMATE RECEPTOR 5
    2e-06  23%  1ycjA  [x.x.x] IONOTROPIC GLUTAMATE RECEPTOR 5
    2e-06  23%  1txfA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    2e-06  23%  2qs4D  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    2e-06  23%  2qs4A  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    2e-06  23%  2pbwA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    2e-06  23%  3gbbA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    2e-06  23%  3gbaA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    2e-06  23%  2f36A  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    2e-06  23%  2f34A  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    2e-06  23%  3c31A  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    3e-06  28%  2a5sA  [x.x.x] N-METHYL-D-ASPARTATE RECEPTOR NMDAR2A SUBUNIT
    4e-06  25%  1s7yA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    4e-06  25%  1s50A  [x.x.x] GLUTAMATE RECEPTOR 6
    4e-06  25%  3g3fB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    5e-06  25%  3g3gB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    5e-06  25%  3g3gA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    6e-06  25%  2i0cB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    6e-06  25%  2i0cA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    6e-06  24%  3g3iB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    6e-06  24%  3g3iA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    6e-06  25%  3g3hB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    6e-06  25%  3g3hA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    8e-06  24%  3g3jB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    8e-06  24%  3g3jA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    1e-05  29%  2v3uA  [x.x.x] GLUTAMATE RECEPTOR DELTA-2 SUBUNIT
    1e-05  24%  3g3kB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    1e-05  24%  3g3kA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    2e-05  22%  1yaeC  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    2e-05  24%  2rc9A  [x.x.x] GLUTAMATE [NMDA] RECEPTOR SUBUNIT 3A
    2e-05  24%  2rc8B  [x.x.x] GLUTAMATE [NMDA] RECEPTOR SUBUNIT 3A
    2e-05  24%  2rc7A  [x.x.x] GLUTAMATE [NMDA] RECEPTOR SUBUNIT 3A
    2e-05  25%  2i0bC  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    2e-05  25%  2i0bB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    2e-05  25%  2i0bA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    3e-05  22%  1yaeD  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    3e-05  22%  1yaeA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    3e-05  29%  2v3tB  [x.x.x] GLUTAMATE RECEPTOR DELTA-2 SUBUNIT SYNONYM
    4e-05  24%  1yaeB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    5e-05  35%  2v3tA  [x.x.x] GLUTAMATE RECEPTOR DELTA-2 SUBUNIT SYNONYM
    7e-05  23%  1yaeE  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
:277

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTEKNTLDQIKEKGVIVAGLDDTFAPMGYRDE
3hv1B           ---------------------------------------TQKDQWQTYTKEKKIKIGFDATFVP-GYEEK
3hv1A           ---------------------------------------TQKDQWQTYTKEKKIKIGFDATFVP-GYEEK
1lstA           --------------------------------------------------------GTDTTYAPFSSKDA
2q2aA           --------------------------------------------------KKKVVVGTDAAFAPFEYM-Q
2pvuA           --------------------------------------------------KKKVVVGTDAAFAPFEYM-Q
2q2cA           -----------------------------------------------------VVVGTDAAFAPFEYM-Q
1hslA           --------------------------------------------------------GTDPTYAPFESKNA
1wdnA           -----------------------------------------------------LVVATDTAFVPFEFK-Q
1gggA           -----------------------------------------------------LVVATDTAFVPFEFK-Q
2vhaA           ------------------------------------------STLDKIAKNGVIVVGHRESSVPFSYYDN
3i6vA           --------------------------------------------------------GTEGAYPPYNFIND
2ia4B           ------------------------------------------STLDKIAKNGVIVVGHRESSVPFSYYDN
2ia4A           ------------------------------------------STLDKIAKNGVIVVGHRESSVPFSYYDN
1xt8B           ------------------------------------------NSLDKIKQNGVVRIGVFGDKPPFGYVDE
1xt8A           ------------------------------------------NSLDKIKQNGVVRIGVFGDKPPFGYVDE
3delB           ------------------------------------------------------IVGTNATYPPFEFVDK
2ieeA           ---------------------------------------------EQIKDKGKIVVATSGTLYPTSYHDT
2ieeB           ---------------------------------------------EQIKDKGKIVVATSGTLYPTSYHD-
2o1mA           -----------------------------------------------------ITVGTGTQFPNICFIDE
3h7mA           -----------------------------------------------------IVVGGDRDYPPYEFIDQ
2v25A           --------------------------------------------LESIKSKGQLIVGVKNDVPHYALLDQ
2pyyB           ----------------------------------------------------------------------
2pyyA           ----------------------------------------------------------------------
2o1mB           -----------------------------------------------------ITVGTGTQFPNICFIDE
3fatB           ----------------------------------------------------------------------
3fatA           ----------------------------------------------------------------------
3fasA           ----------------------------------------------------------------------
2anjA           ----------------------------------------------------------------------
1p1wA           ----------------------------------------------------------------------
1y1mB           ----------------------------------------------------------------------
1pbqB           ----------------------------------------------------------------------
1p1qB           ----------------------------------------------------------------------
1p1oA           ----------------------------------------------------------------------
1p1nA           ----------------------------------------------------------------------
1lb9A           ----------------------------------------------------------------------
1lb8B           ----------------------------------------------------------------------
1lb8A           ----------------------------------------------------------------------
1xhyA           ----------------------------------------------------------------------
1wvjA           ----------------------------------------------------------------------
1syiA           ----------------------------------------------------------------------
2p2aB           ----------------------------------------------------------------------
2p2aA           ----------------------------------------------------------------------
1mqiA           ----------------------------------------------------------------------
1mqhA           ----------------------------------------------------------------------
1mm6B           ----------------------------------------------------------------------
1mm6A           ----------------------------------------------------------------------
1m5dA           ----------------------------------------------------------------------
1lbcC           ----------------------------------------------------------------------
1lbcB           ----------------------------------------------------------------------
1lbcA           ----------------------------------------------------------------------
3h6wB           ----------------------------------------------------------------------
3h6vB           ----------------------------------------------------------------------
3h6uA           ----------------------------------------------------------------------
3h6tC           ----------------------------------------------------------------------
3h6tA           ----------------------------------------------------------------------
2gfeA           ----------------------------------------------------------------------
1ftlA           ----------------------------------------------------------------------
1ftjB           ----------------------------------------------------------------------
1ftjA           ----------------------------------------------------------------------
3epeA           ----------------------------------------------------------------------
3bfuC           ----------------------------------------------------------------------
3bfuB           ----------------------------------------------------------------------
3bbrA           ----------------------------------------------------------------------
3b6wA           ----------------------------------------------------------------------
3b6qA           ----------------------------------------------------------------------
2uxaC           ----------------------------------------------------------------------
2uxaB           ----------------------------------------------------------------------
2uxaA           ----------------------------------------------------------------------
1lbbA           ----------------------------------------------------------------------
2i3vC           ----------------------------------------------------------------------
2i3vA           ----------------------------------------------------------------------
1vsoA           ----------------------------------------------------------------------
2i3wA           ----------------------------------------------------------------------
3dlnA           ----------------------------------------------------------------------
1y20A           ----------------------------------------------------------------------
1y1zA           ----------------------------------------------------------------------
1y1mA           ----------------------------------------------------------------------
1pbqA           ----------------------------------------------------------------------
1pb7A           ----------------------------------------------------------------------
2a5tA           ----------------------------------------------------------------------
1pb9A           ----------------------------------------------------------------------
1pb8A           ----------------------------------------------------------------------
3gbaD           ----------------------------------------------------------------------
3gbaC           ----------------------------------------------------------------------
1ftkA           ----------------------------------------------------VVTTILESPYVMMKKMLE
2zntA           ----------------------------------------------------------------------
2a5tB           ----------------------------------------------------------------------
1ycjB           ----------------------------------------------------------------------
1ycjA           ----------------------------------------------------------------------
1txfA           ----------------------------------------------------------------------
2qs4D           ----------------------------------------------------------------------
2qs4A           ----------------------------------------------------------------------
2pbwA           ----------------------------------------------------------------------
3gbbA           ----------------------------------------------------------------------
3gbaA           ----------------------------------------------------------------------
2f36A           ----------------------------------------------------------------------
2f34A           ----------------------------------------------------------------------
3c31A           ----------------------------------------------------------------------
2a5sA           ----------------------------------------------------------------------
1s7yA           ----------------------------------------------------------------------
1s50A           ----------------------------------------------------------------------
3g3fB           ----------------------------------------------------------------------
3g3gB           ----------------------------------------------------------------------
3g3gA           ----------------------------------------------------------------------
2i0cB           ----------------------------------------------------------------------
2i0cA           ----------------------------------------------------------------------
3g3iB           ----------------------------------------------------------------------
3g3iA           ----------------------------------------------------------------------
3g3hB           ----------------------------------------------------------------------
3g3hA           ----------------------------------------------------------------------
3g3jB           ----------------------------------------------------------------------
3g3jA           ----------------------------------------------------------------------
2v3uA           ----------------------------------------------------------------------
3g3kB           ----------------------------------------------------------------------
3g3kA           ----------------------------------------------------------------------
1yaeC           ------------------------------------------NITDSLSNRSLIVTTLEEPYVLFKKSDK
2rc9A           ----------------------------------------------------------------------
2rc8B           ----------------------------------------------------------------------
2rc7A           ----------------------------------------------------------------------
2i0bC           ----------------------------------------------------------------------
2i0bB           ----------------------------------------------------------------------
2i0bA           ----------------------------------------------------------------------
1yaeD           ------------------------------------------NITDSLSNRSLIVTTLEEPYVLFKKSDK
1yaeA           ------------------------------------------NITDSLSNRSLIVTTLEEPYVLFKKSDK
2v3tB           ----------------------------------------------------------------------
1yaeB           ------------------------------------------NITDSLSNRSLIVTTLEEPYVLFKKSDK
2v3tA           ----------------------------------------------------------------------
1yaeE           ------------------------------------------NITDSLSNRSLIVTTLEEPYVLFKKSDK


                         .         .         *         .         .         .         .:140
query           SNKLVGFDIDMGEEMAKRLGVKIQWQPTQWDGIIMALDSKRFDIILSGMTVTEERKKSINFSVPYVGDGQ
3hv1B           DGSYIGFDIDLANAVFKLYGIDVEWQAIDWDK-ETELKNGTIDLIWNGYSVTDERKQSADFTEPYVNE-Q
3hv1A           DGSYIGFDIDLANAVFKLYGIDVEWQAIDWDK-ETELKNGTIDLIWNGYSVTDERKQSADFTEPYVNE-Q
1lstA           KGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADS
2q2aA           KGKIVGFDVDLLDAVMKAAGLDYELKNIGWDPLFASLQSKEVDMGISGITITDERKQSYDFSDPYFEATQ
2pvuA           KGKIVGFDVDLLDAVMKAAGLDYELKNIGWDPLFASLQSKEVDMGISGITITDERKQSYDFSDPYFEATQ
2q2cA           KGKIVGFDVDLLDAVMKAAGLDYELKNIGWDPLFASLQSKEVDMGISGITITDERKQSYDFSDPYFEATQ
1hslA           QGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADS
1wdnA           GDLYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGL
1gggA           GDLYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGL
2vhaA           QQKVVGYSQDYSEAVKKKLNLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAAFSDTIFVVGT
3i6vA           AGEVDGFERELGDELCKRAGLTCEWVKNDWDSIIPNLVSGNYDTIIAGMSITDERDEVIDFTQNY-----
2ia4B           QQKVVGYSQDYSEAVKKKLNLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAAFSDTIFVVGT
2ia4A           QQKVVGYSQDYSEAVKKKLNLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAAFSDTIFVVGT
1xt8B           KGNNQGYDIALAKRIAKELENKVQFVLVEAANRVEFLKSNKVDIILANFTQTPQRAEQVDFCSPYMKVAL
1xt8A           KGNNQGYDIALAKRIAKELENKVQFVLVEAANRVEFLKSNKVDIILANFTQTPQRAEQVDFCSPYMKVAL
3delB           RGEVVGFDIDLAREISNKLGKTLDVREFSFDALILNLKQHRIDAVITGMSITPSRLKEI-LMIPYYGEKH
2ieeA           SDKLTGYEVEVVREAAKRLGLKVEFK----EGILTAVNSGQVDAAANDIDVTKDREEKFAFSTPYYSYGT
2ieeB           TDKLTGYEVEVVREAAKRLGLKVEFK----EGILTAVNSGQVDAAANDIDVTKDREEKFAFSTPYKYSYG
2o1mA           KGDLTGYDVELIKELDKRLPHYKFTFKTEFSNLLVSLGQHKVDIVAHQEKSKEREKKFLFNKVAYNHFPL
3h7mA           NGKPAGYNVELTRAIAEVMGMTVEFRLGAWSEMFSALKSGRVDV-LQGISWSEKRARQIDFTPPHTIVYH
2v25A           ATEIKGFEVDVAKLLAKSIKIKLVAVNAKTRGPL--LDNGSVDAVIATFTITPERKRIYNFSEPYYQDAI
2pyyB           -SNLSGFSIDLWRSIATQIGIESKLEYSSVPELISAIKDNKVNLGIAAISITAEREQNFDFSLPIFASGL
2pyyA           -SNLSGFSIDLWRSIATQIGIESKLEYSSVPELISAIKDNKVNLGIAAISITAEREQNFDFSLPIFASGL
2o1mB           KGDLTGYDVELIKELDKRLPHYKFTFKTEFSNLLVSLGQHKVDIVAHQEKSKEREKKFLFNKVAYNHFPL
3fatB           NDKYEGYCVDLASEIAKHIGIKYKIAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGI
3fatA           NDKYEGYCVDLASEIAKHIGIKYKIAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGI
3fasA           NDKYEGYCVDLASEIAKHIGIKYKIAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGI
2anjA           -----GYCVDLAAEIAKHCGFKYKWGARDWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1p1wA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITYVREEVIDFSKPFMSLGI
1y1mB           -----GFCIDLLIKLARTMNFKFGTQEKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
1pbqB           -----GFCIDLLIKLARTMNFKFGTQEKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
1p1qB           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1p1oA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1p1nA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1lb9A           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITYVREEVIDFSKPFMSLGI
1lb8B           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITYVREEVIDFSKPFMSLGI
1lb8A           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITYVREEVIDFSKPFMSLGI
1xhyA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1wvjA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1syiA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
2p2aB           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
2p2aA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1mqiA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1mqhA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1mm6B           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1mm6A           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1m5dA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1lbcC           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1lbcB           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1lbcA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3h6wB           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3h6vB           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3h6uA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3h6tC           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3h6tA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
2gfeA           -----GYCVDLAAEIAKHCGFKYKLEDTKWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1ftlA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1ftjB           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1ftjA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3epeA           NDKYEGYCVDLASEIAKHIGIKYKIAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGI
3bfuC           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3bfuB           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3bbrA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3b6wA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3b6qA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
2uxaC           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
2uxaB           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
2uxaA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1lbbA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
2i3vC           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
2i3vA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1vsoA           NDRFEGYCLDLLKELSNILGFDVKLVPAQWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
2i3wA           -----GYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3dlnA           -----GYCVDLAYEIAKHVRIKYKLETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGI
1y20A           ----------------------------EWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
1y1zA           ----------------------------EWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
1y1mA           ----------------------------EWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
1pbqA           ----------------------------EWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
1pb7A           ----------------------------EWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
2a5tA           ----------------------------EWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
1pb9A           ----------------------------EWNGMMGELLSGQADMIVAPLTINTERAQYIEFSKPFKYQGL
1pb8A           ----------------------------EWNGMMGELLSGQADMIVAPLTINTERAQYIEFSKPFKYQGL
3gbaD           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
3gbaC           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
1ftkA           GNRYEGYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
2zntA           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
2a5tB           -----------------------------WNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGI
1ycjB           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
1ycjA           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
1txfA           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
2qs4D           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
2qs4A           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
2pbwA           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
3gbbA           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
3gbaA           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
2f36A           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
2f34A           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
3c31A           NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
2a5sA           -----------------------------WNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGI
1s7yA           ----------------------------QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
1s50A           ----------------------------QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
3g3fB           ----------------------------QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
3g3gB           ----------------------------QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
3g3gA           ----------------------------QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
2i0cB           ----------------------------QWNGMVRELIDHKADLAVAPLAITCVREKVIDFSKPFMTLGI
2i0cA           ----------------------------QWNGMVRELIDHKADLAVAPLAITCVREKVIDFSKPFMTLGI
3g3iB           NDRFEGYCIDLLRELSTHLGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGI
3g3iA           NDRFEGYCIDLLRELSTHLGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGI
3g3hB           ----------------------------QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
3g3hA           ----------------------------QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
3g3jB           NDRFEGYCIDLLRELSTHLGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGI
3g3jA           NDRFEGYCIDLLRELSTHLGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGI
2v3uA           --KYQGFSIDVLDALSNYLGFNYEQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSV
3g3kB           NDRFEGYCIDLLRELSTHLGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGI
3g3kA           NDRFEGYCIDLLRELSTHLGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGI
1yaeC           NDRFEGYCIDLLRELSTILGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
2rc9A           -----GYCIDLLEQLAEDMNFDFDWKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFSTSL
2rc8B           -----GYCIDLLEQLAEDMNFDFDWKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFSTSL
2rc7A           -----GYCIDLLEQLAEDMNFDFDWKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFSTSL
2i0bC           ----------------------------QWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGI
2i0bB           ----------------------------QWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGI
2i0bA           ----------------------------QWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGI
1yaeD           NDRFEGYCIDLLRELSTILGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
1yaeA           NDRFEGYCIDLLRELSTILGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
2v3tB           --KYQGFSIDVLDALSNYLGFNYEQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRY--DYS
1yaeB           NDRFEGYCIDLLRELSTILGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
2v3tA           --KYQGFSIDVLDALSNYLGFNYEGSPT-WNGLVGELVFKRADIGISALTITPDRENVVDFTTRY-----
1yaeE           NDRFEGYCIDLLRELSTILGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI


                         +         .         .         .         .         *         .:210
query           IMVVKKGTTGFNTAADLKGKVVGTQAGSSGEEAVKKVEGIKEVKLYKTYPEAFTDLQIGRIPVVVCDRIT
3hv1B           VLVTKK-SSGIDSVAG-AGKTLGAQAGSSGYDALKDVVANQKVVQYSTFTQALIDLNSGRIDGLLIDRVY
3hv1A           VLVTKK-SSGIDSVAG-AGKTLGAQAGSSGYDALKDVVANQKVVQYSTFTQALIDLNSGRIDGLLIDRVY
1lstA           RLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANRTKGV-DVVAYANQDLIYSDLTAGRLDAALQDEVA
2q2aA           VILVKQGSPVKN-ALDLKGKTIGVQNATTGQEAAEKLFGKPHIKKFETTVVAIMELLNGGVDAVITDNAV
2pvuA           VILVKQGSPVKN-ALDLKGKTIGVQNATTGQEAAEKLFGKPHIKKFETTVVAIMELLNGGVDAVITDNAV
2q2cA           VILVKQGSPVKN-ALDLKGKTIGVQNATTGQEAAEKLFGKPHIKKFETTVVAIMELLNGGVDAVITDNAV
1hslA           RLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEPKGI-EIVSYQGQDNIYSDLTAGRIDAAFQDEVA
1wdnA           LVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPN
1gggA           LVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPN
2vhaA           RLLTKKGGD-IKDFADLKGKAVVVTSGTTSEVLLNKLNEEQKMNMRKDHGDSFRTLESGRAVAFMMDDLA
3i6vA           IPPTASSYVATSDGADLSGIVAAIQAGYIAESGATLVE-------FATPEETIAAVRNGEADAVFADRDY
2ia4B           RLLTKKG-GDIKDFADLKGKAVVVTSGTTSEVLLNKLNEEQKNRIIKDHGDSFRTLESGRAVAFDDALLA
2ia4A           RLLTKKG-GDIKDFADLKGKAVVVTSGTTSEVLLNKLNEEQKNRIIKDHGDSFRTLESGRAVAFDDALLA
1xt8B           GVAVPK-DSNITSVEDLKDKTLLLNKGTTADAFTQNYPNIKTLK-YDQNTETFAALMDKRGDALSHDNTL
1xt8A           GVAVPK-DSNITSVEDLKDKTLLLNKGTTADAFTQNYPNIKTLK-YDQNTETFAALMDKRGDALSHDNTL
3delB           LVLVFKGENK-HPLPLTQYRSVAVQTGTYQEAYLQSLSEV-HIRSFDSTLEVLMEVMHGKSPVAVLEPSI
2ieeA           AIVRKDDLSGIXXXXXXXXXXXXXXXXXVYEVARK--YGAKEV-IYATNEQYLKDVANGRTDVILNDYYL
2ieeB           TAIVRKD--------DLSGXXXXXXXXXXXVYEVARKYGAKEV-IYATNEQYLKDVANGRTDVILNDYYL
2o1mA           KITVLQNNDTIRGIEDLKGKRVITSATSNGALVLKKWNEDNGRPFEIAYEETANQLKSGRADATISTPFA
3h7mA           AIFARRDSPPAAGLEDLRGRKVALHRDGIMHEYLAERGYGKDLVLTPTPADALRLLAAGGCDYAVVAMVP
2v25A           GLLVLK-EKKYKSLADMKGANIGVXXXXXXXXXXXXXXXXXDVKFFPDYPSIKAALDAKRVDAFSVDKSI
2pyyB           QIMVRNG--DIRSIDDLPGKVVXXXXXXXXXXYLRE-HHISVLEVPK-IEEAYKALQTKKADAVVFDAPV
2pyyA           QIMVRNG--DIRSIDDLPGKVVXXXXXXXXXXYLRE-HHISVLEVPK-IEEAYKALQTKKADAVVFDAPV
2o1mB           KITVLQNNDTIRGIEDLKGKRVITSAGALVLKKWNEDNG-RPFEIAYEANETANQLKSGRADATISTPFA
3fatB           SIMIKKGTP-IESAEDLAKQAYGTLDSGSTKEFFRRSKIAVYEKMW-TYPSVFTRTTAEGVARVRKSKST
3fatA           SIMIKKGTP-IESAEDLAKQAYGTLDSGSTKEFFRRSKIAVYEKMW-TYPSVFTRTTAEGVARVRKSKST
3fasA           SIMIKKGTP-IESAEDLAKQAYGTLDSGSTKEFFRRSKIAVYEKMW-TYPSVFTRTTAEGVARVRKSKST
2anjA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1p1wA           SIMIKKGTP-IESAEDLSKQAYGTTDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1y1mB           TILVKKGTTGINRLRNPSDKFIYATVKQSSVDIYRQVERHMEKHNYESAAEAIQAVRDNKLHAFIWDSAV
1pbqB           TILVKKGTTGINRLRNPSDKFIYATVKQSSVDIYRQVERHMEKHNYESAAEAIQAVRDNKLHAFIWDSAV
1p1qB           SIMIKKGTP-IESAEDLSKQAYGTTDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1p1oA           SIMIKKGTP-IESAEDLSKQAYGTTDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1p1nA           SIMIKKGTP-IESAEDLSKQAYGTTDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1lb9A           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1lb8B           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1lb8A           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1xhyA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAFLLEST
1wvjA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1syiA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAFLLEST
2p2aB           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
2p2aA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1mqiA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1mqhA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1mm6B           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1mm6A           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1m5dA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAFLLEST
1lbcC           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1lbcB           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1lbcA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
3h6wB           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
3h6vB           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
3h6uA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
3h6tC           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
3h6tA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
2gfeA           SIMIKKGTP-IESAEDLSKQAYGTLDDGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1ftlA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1ftjB           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1ftjA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
3epeA           SIMIKKGTP-IESAEDLAKQAYGTLDSGSTKEFFRRSKIAVYEKMW-TYPSVFTRTTAEGVARVRKSKST
3bfuC           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
3bfuB           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
3bbrA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
3b6wA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTSAEGVARVRKSKGKYAYLLEST
3b6qA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTAAEGVARVRKSKGKYAYLLEST
2uxaC           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
2uxaB           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
2uxaA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1lbbA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
2i3vC           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
2i3vA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
1vsoA           SILYRKGTP-IDSADDL-AKQTKIEYGAVRDGSTSKISTYEKMWAFMSSSALVKNSDEGIQRVLTTDEST
2i3wA           SIMIKKGTP-IESAEDLSKQAYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
3dlnA           SIMIKKGTP-IESAEDLAKQAYGTLDSGSTKEFFRRSKIAVYEKMWSAEPSVFTKTTADGVARVRKSKST
1y20A           TILVKKGTTGINRLRNPSDKFIYATVKQSSVDIYRQVERHMEKHNYESAAEAIQAVRDNKLHAFIWDSAV
1y1zA           TILVKKGTTGINRLRNPSDKFIYATVKQSSVDIYRQVERHMEKHNYESAAEAIQAVRDNKLHAFIWDSAV
1y1mA           TILVKKGTTGINRLRNPSDKFIYATVKQSSVDIYRQVERHMEKHNYESAAEAIQAVRDNKLHAFIWDSAV
1pbqA           TILVKKGTTGINRLRNPSDKFIYATVKQSSVDIYRQVERHMEKHNYESAAEAIQAVRDNKLHAFIWDSAV
1pb7A           TILVKKGTTGINRLRNPSDKFIYATVKQSSVDIYRQVERHMEKHNYESAAEAIQAVRDNKLHAFIWDSAV
2a5tA           TILVKKGTTGINRLRNPSDKFIYATVKQSSVDIYRQVERHMEKHNYESAAEAIQAVRDNKLHAFIWDSAV
1pb9A           TILVKKGTTGINRLRNPSDKFIYATVKQSSVDIYRQVERHMEKHNYESAAEAIQAVRDNKLHAFIWDSAV
1pb8A           TILVKKGTTGINRLRNPSDKFIYATVKQSSVDIYRQVERHMEKHNYESAAEAIQAVRDNKLHAFIWDSAV
3gbaD           SILYRKGTP-IDSADDLAKQKIEYGAVRDGSTMTSKISTYEKMWAFMSSRQSASDEGIQRVDYALLMEST
3gbaC           SILYRKGTP-IDSADDLAKQKIEYGAVRDGSTMTSKISTYEKMWAFMSSRQSASDEGIQRVDYALLMEST
1ftkA           SIMIKESAEDLSKQTEI---AYGTLDSGSTKEFFRRMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
2zntA           SILYRKGTP-IDSADDLAKQTYGAVRDGSTMTFFKKSKISTYEKMWQTALVRNSDEGIQRVDYALLMEST
2a5tB           SVMVSRGTTGFQRPHDYSPPFFGTVPNGSTERNIR--NNYPYMHQYMTVEDALVSLKTGKLDAFIYD-AA
1ycjB           SILYRKGTP-IDSADDL-AKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALRVLTTDEST
1ycjA           SILYRKGTP-IDSADDL-AKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALRVLTTDEST
1txfA           SILYRKGTP-IDSADDL-AKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALRVLTTDEST
2qs4D           SILYRKGTP-IDSADDL-AKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALRVLTTDEST
2qs4A           SILYRKGTP-IDSADDL-AKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALRVLTTDEST
2pbwA           SILYRKGTP-IDSADDL-AKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALRVLTTDEST
3gbbA           SILYRKGTP-IDSADDL-AKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALRVLTTDEST
3gbaA           SILYRKGTP-IDSADDL-AKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALRVLTTDEST
2f36A           SILYRKGTP-IDSADDL-AKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALRVLTTDEST
2f34A           SILYRKGTP-IDSADDL-AKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALRVLTTDEST
3c31A           SILYRKGTP-IDSADDL-AKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALRVLTTDEST
2a5sA           SVMVSRGTTGFQRPHDYSPPFFGTVPNGSTERNIR--NNYPYMHQYMTVEDALVSLKTGKLDAFIYD-AA
1s7yA           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
1s50A           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
3g3fB           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
3g3gB           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKRSKI-STYDKMWAFMSSRRQSVLVIQRVL
3g3gA           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKRSKI-STYDKMWAFMSSRRQSVLVIQRVL
2i0cB           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
2i0cA           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
3g3iB           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
3g3iA           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
3g3hB           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKRSKI-STYDKMWAFMSSRRQSVLVIQRVL
3g3hA           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKRSKI-STYDKMWAFMSSRRQSVLVIQRVL
3g3jB           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKRSKI-STYDKMWAFMSSRRQSVLVIQRVL
3g3jA           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKRSKI-STYDKMWAFMSSRRQSVLVIQRVL
2v3uA           GVLLRRGTS-------------------------------------------------------------
3g3kB           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKRSKI-STYDKMWAFMSSRRQSVLVIQRVL
3g3kA           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKRSKI-STYDKMWAFMSSRRQSVLVIQRVL
1yaeC           SILYRKPDSADDLAKQTKIEYGAVEDGAT-------MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
2rc9A           GILVRTRGTELSGIHDPKGFRFGTVRESSAEDYVR--QSFPEMHEYPATPDGVQYLKNDKLDAFIMDKAL
2rc8B           GILVRTRGTELSGIHDPKGFRFGTVRESSAEDYVR--QSFPEMHEYPATPDGVQYLKNDKLDAFIMDKAL
2rc7A           GILVRTRGTELSGIHDPKGFRFGTVRESSAEDYVR--QSFPEMHEYPATPDGVQYLKNDKLDAFIMDKAL
2i0bC           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
2i0bB           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
2i0bA           SILYRKGTP-IDSADDL-AKQTKIEYGAVEDGAT--MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
1yaeD           SILYRKIDSADDLAKQTKIEYGAVEDGAT-------MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
1yaeA           SILYRKIDSADDLAKQTKIEYGAVEDGAT-------MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
2v3tB           VGVLLRRGTSIQSLQDLSKQTYGTVLDSAVYQHVRK----------------------------------
1yaeB           SILYRK--PNIDSADDL-AKQTKIEYGAVEDGAT--MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL
2v3tA           ----------------------------------------------------------------------
1yaeE           SILYRKPI----DSADDLAKQTKIEYGAVEDGAT--MTFFKKSKI-STYDKMWAFMSSRRQSVLVIQRVL


                         .         .         .         +         .         .         .:280
query           ASHYISKRADTYEIVGEKITDEPLAIGLRKSDPELKEAIDNVLNEMKKDGTLTKISMKWFNRDITVK
3hv1B           ANYYLEKSGDQYN-VPAGYEGESFAVGARKVDKTLIKKINQGFETLYKNGEFQKISNKWFGEDV---
3hv1A           ANYYLEKSGDQYN-VPAGYEGESFAVGARKVDKTLIKKINQGFETLYKNGEFQKISNKWFGEDV---
1lstA           ASEGFLKQGKEYAFAGPSVKDDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNV---
2q2aA           ANEYVKNNPNKKLQVIENFASEYYGMIFPKNS-ELKAKVDEALKNVINSGKYTEIYKKWFGKE----
2pvuA           ANEYVKNNPNKKLQVIENFASEYYGMIFPKNS-ELKAKVDEALKNVINSGKYTEIYKKWFGKE----
2q2cA           ANEYVKNNPNKKLQVIENFASEYYGMIFPKNS-ELKAKVDEALKNVINSGKYTEIYKKWFGKE----
1hslA           ASEGFLKQGKDYKFGGPAVKDEKLGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDV---
1wdnA           ILYFIKTAGNQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTE----
1gggA           ILYFIKTAGNQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTE----
2vhaA           GERAKAKKPDNWDIVGKPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPK
3i6vA           LVPIVAESGELMFXXXXXXXXXXXXXXXRESDGELRGKFDAAITSMKEDGTLNTMIKKWFGEDAAV-
2ia4B           GERAKAKKPDNWDIVGKPQSQEAYGC-LRKDDPQFKK-LDDTIAQVQTSGEAEKWFDKWFKNPIPPK
2ia4A           GERAKAKKPDNWDIVGKPQSQEAYGC-LRKDDPQFKK-LDDTIAQVQTSGEAEKWFDKWFKNPIPPK
1xt8B           LFAWVKDHPDFKMGIKELGNKDVIAPAVKKGDKELKEFIDNLIIKLGQE------------------
1xt8A           LFAWVKDHPDFKMGIKELGNKDVIAPAVKKGDKELKEFIDNLIIKLGQE------------------
3delB           AQVVLK----DFPALSTATIDLPYGIGVASDRPALALKIEAAVQEIRKEGVLAELEQKW--------
2ieeA           QTLALAAFPDLNITIHPDIKYPNKQALVKKSNAALQK--KNEALKESKDGSLTKLSKQFFNKDVSKK
2ieeB           QTLALAAFPDLNITIHPDIKYPNKQALVKKSNAALQK--KNEALKESKDGSLTKLSKQFFNKDVSKK
2o1mA           VDFQNKTSTIKEKTVGNVLSNAKVYF-FNKNEQTLSDDIDKALQEIIDDGTLKRLSLKWLGDD----
3h7mA           GMYIIRENRLTNLVVARSIAAQRYGYAVRQGDAELLARFSEGLAILRKTGQYEAIRAKW--------
2v25A           LLGYVD---DKSEILPDSFEPQSYGIVTKKDDPAFAKYVDDFVKEHKNE--IDALAKKW--------
2pyyB           LLFYAANEGGKVEIVGSILREESYGIILPNNSP-YRKPINQALLNLKENGTYQSLYDKWFD------
2pyyA           LLFYAANEGGKVEIVGSILREESYGIILPNNSP-YRKPINQALLNLKENGTYQSLYDKWFD------
2o1mB           VDFQNKTSTIKEKTVGNVLSNAKVYF-FNKNEQTLSDDIDKALQEIIDDGTLKRLSLKW--------
3fatB           MNEYIEQRCDTMK-VGGNLDSKGYGVATPKGS-SLRTPVNLAVLKLSEAGVLDKLKNKWW-------
3fatA           MNEYIEQRCDTMK-VGGNLDSKGYGVATPKGS-SLRTPVNLAVLKLSEAGVLDKLKNKWW-------
3fasA           MNEYIEQRCDTMK-VGGNLDSKGYGVATPKGS-SLRTPVNLAVLKLSEAGVLDKLKNKWW-------
2anjA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1p1wA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1y1mB           LEFEASQKCDLV-TTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTW--------
1pbqB           LEFEASQKCDLV-TTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTW--------
1p1qB           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1p1oA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1p1nA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1lb9A           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1lb8B           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1lb8A           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1xhyA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1wvjA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1syiA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
2p2aB           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
2p2aA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1mqiA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1mqhA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1mm6B           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1mm6A           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1m5dA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1lbcC           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLSEQGLLDKLKNKWW-------
1lbcB           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLSEQGLLDKLKNKWW-------
1lbcA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLSEQGLLDKLKNKWW-------
3h6wB           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLSEQGLLDKLKNKWW-------
3h6vB           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLSEQGLLDKLKNKWW-------
3h6uA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLSEQGLLDKLKNKWW-------
3h6tC           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLSEQGLLDKLKNKWW-------
3h6tA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLSEQGLLDKLKNKWW-------
2gfeA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1ftlA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1ftjB           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1ftjA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
3epeA           MNEYTEQRCDTMK-VGGNLDSKGYGVATPKGS-SLRTPVNLAVLKLSEAGVLDKLKNKWW-------
3bfuC           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
3bfuB           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
3bbrA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLSEQGLLDKLKNKWW-------
3b6wA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
3b6qA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
2uxaC           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLRTPVNLAVLKLSEQGVLDKLKNKWW-------
2uxaB           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLRTPVNLAVLKLSEQGVLDKLKNKWW-------
2uxaA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLRTPVNLAVLKLSEQGVLDKLKNKWW-------
1lbbA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLDEQGLLDKLKNKWW-------
2i3vC           MNEYIEQRCDTMK-VGCNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
2i3vA           MNEYIEQRCDTMK-VGCNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
1vsoA           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
2i3wA           MNEYIEQRCDTMK-VGGNLDCKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
3dlnA           MNEYIEQRCDTMK-VGGNLDSKGYGVATPKGS-ALGTPVNLAVLKLSEQGILDKLKNKWW-------
1y20A           LEFEASQKCDLV-TTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTW--------
1y1zA           LEFEASQKCDLV-TTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTW--------
1y1mA           LEFEASQKCDLV-TTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTW--------
1pbqA           LEFEASQKCDLV-TTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTW--------
1pb7A           LEFEASQKCDLV-TTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTW--------
2a5tA           LEFEASQKCDLV-TTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTW--------
1pb9A           LEFEASQKCDLV-TTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTW--------
1pb8A           LEFEASQKCDLV-TTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTW--------
3gbaD           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
3gbaC           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
1ftkA           MNEYIEQRCDTMK-VGGNLDSKGYGIATPKGS-SLGNAVNLAVLKLNEQGLLDKLKNKWW-------
2zntA           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
2a5tB           VLNYKAGRDEGCKLVGYIFATTGYGIALQKGSP-WKRQIDLALLQFVGDGEMEELETLW--------
1ycjB           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
1ycjA           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
1txfA           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
2qs4D           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
2qs4A           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
2pbwA           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
3gbbA           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
3gbaA           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
2f36A           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
2f34A           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
3c31A           SIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
2a5sA           VLNYKAGRDEGCKLVGYIFATTGYGIALQKGSP-WKRQIDLALLQFVGDGEMEELETLW--------
1s7yA           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
1s50A           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
3g3fB           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
3g3gB           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
3g3gA           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
2i0cB           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAICQLQEEGKLHMMKEKWW-------
2i0cA           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAICQLQEEGKLHMMKEKWW-------
3g3iB           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITLAILKLQEEGKLHMMKEKWW-------
3g3iA           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITLAILKLQEEGKLHMMKEKWW-------
3g3hB           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITLAILKLQEEGKLHMMKEKWW-------
3g3hA           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITLAILKLQEEGKLHMMKEKWW-------
3g3jB           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITLAILKLQEEGKLHMMKEKWW-------
3g3jA           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITLAILKLQEEGKLHMMKEKWW-------
2v3uA           -------------------------------------------------------------------
3g3kB           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITLAILKLQEQGKLHMMKEKWW-------
3g3kA           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITLAILKLQEQGKLHMMKEKWW-------
1yaeC           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
2rc9A           LDYEVSIDADCKLLVGKPFAIEGYGIGLPPNSP-LTSNISELISQYKSHGFMDVLHDKWY-------
2rc8B           LDYEVSIDADCKLLVGKPFAIEGYGIGLPPNSP-LTSNISELISQYKSHGFMDVLHDKWY-------
2rc7A           LDYEVSIDADCKLLVGKPFAIEGYGIGLPPNSP-LTSNISELISQYKSHGFMDVLHDKWY-------
2i0bC           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITLAILKLQEQGKLHMMKEKWW-------
2i0bB           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITLAILKLQEQGKLHMMKEKWW-------
2i0bA           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITLAILKLQEQGKLHMMKEKWW-------
1yaeD           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
1yaeA           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
2v3tB           -------------------------------------------------------------------
1yaeB           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------
2v3tA           -------------------------------------------------------------------
1yaeE           TSDYVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKWW-------