[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO49938.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e26A.bssp"
#ERROR : Can't open dsspfile "3e25A.bssp"
#ERROR : Can't open dsspfile "1na0A.bssp"
#ERROR : Can't open dsspfile "2kc7A.bssp"
#ERROR : Can't open dsspfile "1na3A.bssp"
#ERROR : Can't open dsspfile "2fo7A.bssp"
#ERROR : Can't open dsspfile "2avpA.bssp"
#ERROR : Can't open dsspfile "3fp4A.bssp"
#ERROR : Can't open dsspfile "2j9qB.bssp"
#ERROR : Can't open dsspfile "2j9qA.bssp"
#ERROR : Can't open dsspfile "1fchB.bssp"
#ERROR : Can't open dsspfile "1fchA.bssp"
#ERROR : Can't open dsspfile "2c0mC.bssp"
#ERROR : Can't open dsspfile "2c0mA.bssp"
#ERROR : Can't open dsspfile "2c0lA.bssp"
#ERROR : Can't open dsspfile "1w3bA.bssp"
#ERROR : Can't open dsspfile "1na0A.bssp"
#ERROR : Can't open dsspfile "2fo7A.bssp"

## Summary of PDB Search
:640
    7e-08  40%  3e26A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    7e-08  40%  3e25A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-06  31%  1na0A  [k.38.1] DESIGNED PROTEIN CTPR3
    2e-06  34%  2kc7A  [x.x.x] BFR218_PROTEIN
    3e-06  36%  1na3A  [k.38.1] DESIGNED PROTEIN CTPR2
    6e-06  29%  2fo7A  [x.x.x] SYNTHETIC CONSENSUS TPR PROTEIN
    1e-05  35%  2avpA  [x.x.x] SYNTHETIC CONSENSUS TPR PROTEIN
    2e-04  44%  3fp4A  [x.x.x] TPR REPEAT-CONTAINING PROTEIN YHR117W
    6e-04  36%  2j9qB  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    6e-04  36%  2j9qA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    6e-04  36%  1fchB  [a.118.8] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    6e-04  36%  1fchA  [a.118.8] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    6e-04  36%  2c0mC  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    6e-04  36%  2c0mA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    6e-04  36%  2c0lA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    8e-04  25%  1w3bA  [a.118.8] UDP-N-ACETYLGLUCOSAMINE--PEPTIDE
    2e-05  29%  1na0A  [k.38.1] DESIGNED PROTEIN CTPR3(query 251->361)
    1e-05  28%  2fo7A  [x.x.x] SYNTHETIC CONSENSUS TPR PROTEIN(query 208->352)
:640

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xGNRISLCMIVKNEEGNIRRCLASVTGVVNEIIVVDTGSTDNTCKIAREMGARIYSFEWNNNFSDARNFS
3e26A           -GRTISVVLPALNEEATIESVIDSISGLVDELIVLDSGSTDDTEIRAIASGARVVSREQRPGKGEALWRS
3e25A           -GRTISVVLPALNEEATIESVIDSISGLVDELIVLDSGSTDDTEIRAIASGARVVSREQRPGKGEALWRS
1na0A           ----------------------------------------------------------------------
2kc7A           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
3fp4A           ----------------------------------------------------------------------
2j9qB           ----------------------------------------------------------------------
2j9qA           ----------------------------------------------------------------------
1fchB           ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LAKATGDWILFLDADxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e26A           LAATSGDIVVFIDSD-------------------------------------------------------
3e25A           LAATSGDIVVFIDSD-------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2kc7A           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
3fp4A           ----------------------------------------------------------------------
2j9qB           ----------------------------------------------------------------------
2j9qA           ----------------------------------------------------------------------
1fchB           ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLHIIQKEMVENPGNYLLKYHY
3e26A           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2kc7A           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
3fp4A           ----------------------------------------------------------------------
2j9qB           ----------------------------------------------------------------------
2j9qA           ----------------------------------------------------------------------
1fchB           ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
1w3bA           -------------------------------------------------IHHFEKAVTLDP-NFLDAYNL
1na0A           ----------------------------------------------------------------------
2fo7A           -------------------------------------------------------------------YNL


                         .         .         .         +         .         .         .:280
query           GVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHY
3e26A           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2kc7A           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
3fp4A           ----------------------------------------------------------------------
2j9qB           -------------------------------------------NGNQSEEAVAAYRRALELQPGYIRSRY
2j9qA           -------------------------------------------NGNQSEEAVAAYRRALELQPGYIRSRY
1fchB           -------------------------------------------NGNQSEEAVAAYRRALELQPGYIRSRY
1fchA           -------------------------------------------NGNQSEEAVAAYRRALELQPGYIRSRY
2c0mC           -------------------------------------------NGNQSEEAVAAYRRALELQPGYIRSRY
2c0mA           -------------------------------------------NGNQSEEAVAAYRRALELQPGYIRSRY
2c0lA           -------------------------------------------NGNQSEEAVAAYRRALELQPGYIRSRY
1w3bA           GNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNL----ACVYYEQGLIDLAIDTYRRAIELQPHFPDAYC
1na0A           ----------------------------------------AYYKQGDYDEAIEYYQKALELDPNNAEAWY
2fo7A           GNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGN----AYYKQGDYDEAIEYYQKALELDPRSAEAWY


                         .         *         .         .         .         .         +:350
query           YGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRD
3e26A           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2kc7A           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
3fp4A           ----------------------------------------------------------------------
2j9qB           NLGISCINLGAHREAVEHFLEAL-----------------------------------------------
2j9qA           NLGISCINLGAHREAVEHFLEAL-----------------------------------------------
1fchB           NLGISCINLGAHREAVEHFLEAL-----------------------------------------------
1fchA           NLGISCINLGAHREAVEHFLEAL-----------------------------------------------
2c0mC           NLGISCINLGAHREAVEHFLEAL-----------------------------------------------
2c0mA           NLGISCINLGAHREAVEHFLEAL-----------------------------------------------
2c0lA           NLGISCINLGAHREAVEHFLEAL-----------------------------------------------
1w3bA           NLANALKEKGSVAEAEDCYNTALRLC---PTHAD--------SLNNLANIKREQGNIEEAVRLYRKALEV
1na0A           NLGNAYYKQGDYDEAIEYYQKAL---ELDPNNA--------EAWYNLGNAYYKQGDYDEAIEYYQKALEL
2fo7A           NLGNAYYKQGDYDEAIEYYQKALELDP-----------RSAEAWYNLGNAYYKQGDYDEAIEYYQKALEL


                         .         .         .         .         *         .         .:420
query           NPGFQPALERIIKILKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e26A           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2kc7A           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
3fp4A           ----------------------------------------------------------------------
2j9qB           ----------------------------------------------------------------------
2j9qA           ----------------------------------------------------------------------
1fchB           ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
1w3bA           FPEFAAAHSNLASVLQ------------------------------------------------------
1na0A           DPNNAEAKQNL-----------------------------------------------------------
2fo7A           DP--------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e26A           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2kc7A           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
3fp4A           ----------------------------------------------------------------------
2j9qB           ----------------------------------------------------------------------
2j9qA           ----------------------------------------------------------------------
1fchB           ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLDIIRLYH
3e26A           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
1na0A           --------------------------------------------------------------------YY
2kc7A           --------------------------------------------------------------LKTIKELI
1na3A           --------------------------------------------------------------------YY
2fo7A           --------------------------------------------------------------------YY
2avpA           --------------------------------------------------------------------YY
3fp4A           ----------------------------------------------------------------------
2j9qB           ----------------------------------------------------------------------
2j9qA           ----------------------------------------------------------------------
1fchB           ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYxxxx
3e26A           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
1na0A           KQGDYDEAIEYYQKALELDNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAY----
2kc7A           NQGDIENALQALEEFLQTEPVGEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSP--------------
1na3A           KQGDYDEAIEYYQKALELDNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPN----------------
2fo7A           KQGDYDEAIEYYQKALELDRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAY----
2avpA           KQGDYDEAIEYYQKALELDRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDP-----------------
3fp4A           ------------QAYAVQLKNRGNHFFTAK------NFNEAIKYYQYAIELDPNEPVFYSNISACY----
2j9qB           ----------------------------------------------------------------------
2j9qA           ----------------------------------------------------------------------
1fchB           ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxx
3e26A           ----------
3e25A           ----------
1na0A           ----------
2kc7A           ----------
1na3A           ----------
2fo7A           ----------
2avpA           ----------
3fp4A           ----------
2j9qB           ----------
2j9qA           ----------
1fchB           ----------
1fchA           ----------
2c0mC           ----------
2c0mA           ----------
2c0lA           ----------
1w3bA           ----------
1na0A           ----------
2fo7A           ----------