[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO50036.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2k9sA.bssp"
#ERROR : Can't open dsspfile "1ti9A.bssp"
#ERROR : Can't open dsspfile "1bl0A.bssp"

## Summary of PDB Search
:240
    3e-08  27%  2k9sA  [x.x.x] ARABINOSE OPERON REGULATORY PROTEIN
    4e-06  22%  1ti9A  [i.11.1 (1xs9A)] MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARA
    4e-06  22%  1bl0A  [a.4.1 - a.4.1] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE
:240

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2k9sA           ----------------------------------------------------------------------
1ti9A           ----------------------------------------------------------------------
1bl0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2k9sA           ----------------------------------------------------------------------
1ti9A           ----------------------------------------------------------------------
1bl0A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xIQYVQNHYQEKISLEYLAALEHYNPSYYCQWFQKKTGLSPLAFIQKLRLEKAKYLLINTDFSLLRIAQE
2k9sA           --QYISDHLADS-NFDIASVAQHVSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLSTTRMPIATVGRN
1ti9A           -LDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAER
1bl0A           -LDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAER


                         .         .         .         +         .         .         .:280
query           VGYEQQSSLARLFRQKEGMSASDYRxxxxx
2k9sA           VGFDDQLYFSRVFKKCTGASPSEFR-----
1ti9A           YGFESQQTLTRTFKNYFDVPPHKYR-----
1bl0A           YGFESQQTLTRTFKNYFDVPPHKYR-----