[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO50573.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2j289.bssp"
#ERROR : Can't open dsspfile "2ffhA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "1jpnA.bssp"
#ERROR : Can't open dsspfile "1jpnB.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "1jpjA.bssp"
#ERROR : Can't open dsspfile "2ng1A.bssp"
#ERROR : Can't open dsspfile "2j7pB.bssp"
#ERROR : Can't open dsspfile "2j7pA.bssp"
#ERROR : Can't open dsspfile "1okkA.bssp"
#ERROR : Can't open dsspfile "1rj9B.bssp"
#ERROR : Can't open dsspfile "1ls1A.bssp"
#ERROR : Can't open dsspfile "1ffhA.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "1qzxA.bssp"
#ERROR : Can't open dsspfile "1qzwA.bssp"
#ERROR : Can't open dsspfile "2j37W.bssp"
#ERROR : Can't open dsspfile "2v3cC.bssp"
#ERROR : Can't open dsspfile "2v3cD.bssp"
#ERROR : Can't open dsspfile "1j8yF.bssp"
#ERROR : Can't open dsspfile "2qy9A.bssp"
#ERROR : Can't open dsspfile "1ftsA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "2og2A.bssp"
#ERROR : Can't open dsspfile "1vmaA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "1j8mF.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "2cnwE.bssp"
#ERROR : Can't open dsspfile "2q9bA.bssp"
#ERROR : Can't open dsspfile "2q9aA.bssp"
#ERROR : Can't open dsspfile "2q9bB.bssp"
#ERROR : Can't open dsspfile "2q9aB.bssp"
#ERROR : Can't open dsspfile "1okkD.bssp"
#ERROR : Can't open dsspfile "2j7pE.bssp"
#ERROR : Can't open dsspfile "2j7pD.bssp"
#ERROR : Can't open dsspfile "2cnwF.bssp"
#ERROR : Can't open dsspfile "2cnwD.bssp"
#ERROR : Can't open dsspfile "1rj9A.bssp"
#ERROR : Can't open dsspfile "1zu4A.bssp"
#ERROR : Can't open dsspfile "1zu5B.bssp"
#ERROR : Can't open dsspfile "1zu5A.bssp"
#ERROR : Can't open dsspfile "2iylD.bssp"
#ERROR : Can't open dsspfile "1hq1A.bssp"
#ERROR : Can't open dsspfile "1qb2B.bssp"
#ERROR : Can't open dsspfile "1qb2A.bssp"
#ERROR : Can't open dsspfile "1mfqC.bssp"
#ERROR : Can't open dsspfile "1dulA.bssp"
#ERROR : Can't open dsspfile "1wgwA.bssp"
#ERROR : Can't open dsspfile "2aeuA.bssp"
#ERROR : Can't open dsspfile "2aevA.bssp"
#ERROR : Can't open dsspfile "2yvuB.bssp"
#ERROR : Can't open dsspfile "2yvuA.bssp"
#ERROR : Can't open dsspfile "2jqeA.bssp"
#ERROR : Can't open dsspfile "2gksB.bssp"
#ERROR : Can't open dsspfile "2gksA.bssp"
#ERROR : Can't open dsspfile "2px0A.bssp"
#ERROR : Can't open dsspfile "1f3uA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"

## Summary of PDB Search
:446
    e-126  52%  2j289  [x.x.x] SIGNAL RECOGNITION PARTICLE 54
    e-113  52%  2ffhA  [a.24.13 - c.37.1 - a.36.1] PROTEIN (FFH)
    2e-85  54%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-85  54%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    6e-85  54%  1jpnA  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-84  53%  1jpnB  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-84  53%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-83  53%  1jpjA  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    6e-83  53%  2ng1A  [x.x.x] SIGNAL SEQUENCE RECOGNITION PROTEIN FFH
    2e-82  53%  2j7pB  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-82  53%  2j7pA  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    9e-82  53%  1okkA  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-81  54%  1rj9B  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    4e-81  54%  1ls1A  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-80  54%  1ffhA  [x.x.x] FFH
    1e-74  38%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-73  38%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-68  39%  1qzxA  [a.24.13 - c.37.1 - a.36.1] SIGNAL RECOGNITION 54 KDA PROTEIN
    2e-67  38%  1qzwA  [a.24.13 - c.37.1 - a.36.1] SIGNAL RECOGNITION 54 KDA PROTEIN
    3e-65  35%  2j37W  [x.x.x] SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN
    1e-61  35%  2v3cC  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    3e-61  35%  2v3cD  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-48  40%  1j8yF  [a.24.13 - c.37.1] SIGNAL RECOGNITION 54 KDA PROTEIN
    3e-46  39%  2qy9A  [x.x.x] CELL DIVISION PROTEIN FTSY
    3e-46  39%  1ftsA  [x.x.x] FTSY
    1e-45  35%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    3e-43  36%  2og2A  [x.x.x] PUTATIVE SIGNAL RECOGNITION PARTICLE RECEPTOR
    4e-43  42%  1vmaA  [a.24.13 - c.37.1] CELL DIVISION PROTEIN FTSY
    3e-42  38%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-42  38%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-42  38%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-41  35%  1j8mF  [a.24.13 - c.37.1] SIGNAL RECOGNITION 54 KDA PROTEIN
    3e-41  38%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    5e-37  36%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-36  37%  2cnwE  [x.x.x] CELL DIVISION PROTEIN FTSY
    4e-36  37%  2q9bA  [x.x.x] CELL DIVISION PROTEIN FTSY
    4e-36  37%  2q9aA  [x.x.x] CELL DIVISION PROTEIN FTSY
    1e-35  42%  2q9bB  [x.x.x] CELL DIVISION PROTEIN FTSY
    1e-35  42%  2q9aB  [x.x.x] CELL DIVISION PROTEIN FTSY
    1e-35  42%  1okkD  [a.24.13 - c.37.1] CELL DIVISION PROTEIN FTSY
    1e-35  42%  2j7pE  [x.x.x] CELL DIVISION PROTEIN FTSY
    1e-35  42%  2j7pD  [x.x.x] CELL DIVISION PROTEIN FTSY
    1e-35  42%  2cnwF  [x.x.x] CELL DIVISION PROTEIN FTSY
    1e-35  42%  2cnwD  [x.x.x] CELL DIVISION PROTEIN FTSY
    4e-35  36%  1rj9A  [a.24.13 - c.37.1] SIGNAL RECOGNITION PROTEIN
    1e-32  32%  1zu4A  [x.x.x] FTSY
    1e-32  32%  1zu5B  [x.x.x] FTSY
    2e-32  36%  1zu5A  [x.x.x] FTSY
    8e-32  36%  2iylD  [x.x.x] CELL DIVISION PROTEIN FTSY
    2e-16  62%  1hq1A  [a.36.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    4e-13  38%  1qb2B  [a.36.1] HUMAN SIGNAL RECOGNITION PARTICLE 54 KD PROTEIN
    2e-12  38%  1qb2A  [a.36.1] HUMAN SIGNAL RECOGNITION PARTICLE 54 KD PROTEIN
    2e-12  42%  1mfqC  [a.36.1] SIGNAL RECOGNITION PARTICLE 54KDA PROTEIN
    3e-09  70%  1dulA  [a.36.1] SIGNAL RECOGNITION PARTICLE PROTEIN (FIFTY-FOUR
    9e-07  31%  1wgwA  [a.24.13] 'SIGNAL RECOGINITION PARTICLE 54
    3e-05  28%  2aeuA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    4e-05  28%  2aevA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    5e-05  50%  2yvuB  [x.x.x] PROBABLE ADENYLYL-SULFATE KINASE
    5e-05  50%  2yvuA  [x.x.x] PROBABLE ADENYLYL-SULFATE KINASE
    7e-05  26%  2jqeA  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    4e-04  37%  2gksB  [x.x.x] BIFUNCTIONAL SAT/APS KINASE
    4e-04  37%  2gksA  [x.x.x] BIFUNCTIONAL SAT/APS KINASE
    0.001  23%  2px0A  [x.x.x] FLAGELLAR BIOSYNTHESIS PROTEIN FLHF
    0.001  34%  1f3uA  [b.65.1] TRANSCRIPTION INITIATION FACTOR IIF, BETA
    0.001  38%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    0.001  38%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
:446

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFKGLGERLDEIFKSLKGKGRLTEDDVNHAMREVKMALLEADVNFKVVKEFVAQVKGRAVGQDVLESLSP
2j289           -FDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTP
2ffhA           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
2c04A           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
2c03B           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
1jpnA           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
1jpnB           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
2c03A           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
1jpjA           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
2ng1A           -FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
2j7pB           ----LSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
2j7pA           ----LSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
1okkA           ----LSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
1rj9B           ---------------LRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
1ls1A           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
1ffhA           -FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
3dm5A           ----LGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISK
3dm5B           ----LGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISK
1qzxA           -----------------------EKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
1qzwA           -----------------------EKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
2j37W           -------KITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
2v3cC           --------------------------IKEVIKDIQRALIQADVNVKLVLKMSKEIERRALEEKTPKGLSK
2v3cD           --------------------------IKEVIKDIQRALIQADVNVKLVLKMSKEIERRALEEKTPKGLSK
1j8yF           ---------DTVRKFLTGSSSY-DKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIER
2qy9A           ----------------------------------------ADVGVETTRKIITNLTEGASRKQ----LRD
1ftsA           ----------------------------------------ADVGVETTRKIITNLTEGASRKQ----LRD
3b9qA           -------------------------ETDRVLDELEEALLVSDFGPKITVRIVERLR-----EDIMSGLKS
2og2A           -------------------------ETDRVLDELEEALLVSDFGPKITVRIVERLR-----EDIMSGLKS
1vmaA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------VVDALREKIKQKLVGKKVRIGTDK
3dmdA           ----------------------------------------------VVDALREKIKQKLVGKKVRIGTDK
3dmdB           ----------------------------------------------VVDALREKIKQKLVGKKVRIGTDK
1j8mF           ---------DTVRKFLTGSSSY-DKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIER
3e70C           ----------------------------------------------VVDALREKIKQKLVGKKVRIGGKI
3dm9B           ----------------------------------------------VVDALREKIKQKLVGKKVRIGTDK
2cnwE           -----------------------------------------DVGLSATEEILQEVRGRAVKEKLVGMLEP
2q9bA           -----------------------------------------DVGLSATEEILQEV--RASGRKDLKEAVK
2q9aA           -----------------------------------------DVGLSATEEILQEV--RASGRKDLKEAVK
2q9bB           ----------------------------------------------------------------------
2q9aB           ----------------------------------------------------------------------
1okkD           ----------------------------------------------------------------------
2j7pE           ----------------------------------------------------------------------
2j7pD           ----------------------------------------------------------------------
2cnwF           ----------------------------------------------------------------------
2cnwD           ----------------------------------------------------------------------
1rj9A           -----------------------------------------DVGLSATEEILQEV--RASGRKDLKEAVK
1zu4A           -------------------------------------LIQTDMGMKMVLKVSNLVRKKTKRDTSFENIKD
1zu5B           -------------------------------------LIQTDMGMKMVLKVSNLVRKKTKRDTSFENIKD
1zu5A           ----------------------------------------------------------------------
2iylD           --------------------------------------------------------GLSATEEILQEVSG
1hq1A           ----------------------------------------------------------------------
1qb2B           ----------------------------------------------------------------------
1qb2A           ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
1wgwA           ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
2aeuA           ----------------------------------------------------------------------
2aevA           ----------------------------------------------------------------------
2yvuB           ----------------------------------------------------------------------
2yvuA           ----------------------------------------------------------------------
2jqeA           ----------------------------------------------------------------------
2gksB           ----------------------------------------------------------------------
2gksA           ----------------------------------------------------------------------
2px0A           ----------------------------------------------------------------------
1f3uA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AQQVIKIVRDELTELLGGTQAKINLSPKPPTIIMLVGLQGAGKTTTAGKLAKLLSKQGRRPLMVAGDIYR
2j289           GQEFVKIVRNELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLEKHKKKVLVVSADVYR
2ffhA           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
2c04A           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
2c03B           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
1jpnA           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
1jpnB           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
2c03A           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
1jpjA           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
2ng1A           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
2j7pB           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
2j7pA           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
1okkA           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
1rj9B           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
1ls1A           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
1ffhA           AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
3dm5A           KEHIIKIVYEELTKFLGTEAKPIEIKEKP-TILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWR
3dm5B           KEHIIKIVYEELTKFLGTEAKPIEIKEKP-TILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWR
1qzxA           KEWFISIVYDELSKLFGGDKEP-NVNPKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYR
1qzwA           KEWFISIVYDELSKLFGGDKEP-NVNPKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYR
2j37W           RKMIQHAVFKELVKLVDGVKA---WTPTKGNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFR
2v3cC           KEHIIKIVYXXXXXXXXXXXXXXXXNPKKQNVILLVGIQGSGKTTTAAKLARYIQKRGLKPALIAADTYR
2v3cD           KEHIIKIVYXXXXXXXXXXXXXXXXNPKKQNVILLVGIQGSGKTTTAAKLARYIQKRGLKPALIAADTYR
1j8yF           REWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMLVGVQG----TTAGKLAYFYKKKGFKVGLVGADVYR
2qy9A           AEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFR
1ftsA           AEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFR
3b9qA           GSEIKDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDTFR
2og2A           GSEIKDALKESVLEMLA-KKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDTFR
1vmaA           ---------------------KLNVPPEPPFVIMVVGVNGTGKTTSCGKLAKMFVDEGKSVVLAAADTFR
3dmdC           GKIIEEAVKEAVSEILE-TSRRIDLKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFR
3dmdA           GKIIEEAVKEAVSEILE-TSRRIDLKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFR
3dmdB           GKIIEEAVKEAVSEILE-TSRRIDLKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFR
1j8mF           REWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMXXXXXXXXXXXXXXXXXYFYKKKGFKVGLVGADVYR
3e70C           IEEAVKEAVSEILE----TSRRIDLKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFR
3dm9B           GKIIEEAVKEAVSEILETSRREIRKAEKP--YVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFR
2cnwE           DER-----RATLRKLGFNPQKPKPVEPKXXXXXXXXXXXXX-KTTTIAKLGRYYQNLGKKVMFCAGDTFR
2q9bA           EKLVGMLEPDERR----ATLRKLGFNPQKPKPVXXXXXXXXXKTTTIAKLGRYYQNLGKKVMFCAGDTFR
2q9aA           EKLVGMLEPDERR----ATLRKLGFNPQKPKPVXXXXXXXXXKTTTIAKLGRYYQNLGKKVMFCAGDTFR
2q9bB           ------------------------------------------KTTTIAKLGRYYQNLGKKVMFCAGDTFR
2q9aB           ------------------------------------------KTTTIAKLGRYYQNLGKKVMFCAGDTFR
1okkD           ------------------------------------------KTTTIAKLGRYYQNLGKKVMFCAGDTFR
2j7pE           ------------------------------------------KTTTIAKLGRYYQNLGKKVMFCAGDTFR
2j7pD           ------------------------------------------KTTTIAKLGRYYQNLGKKVMFCAGDTFR
2cnwF           ------------------------------------------KTTTIAKLGRYYQNLGKKVMFCAGDTFR
2cnwD           ------------------------------------------KTTTIAKLGRYYQNLGKKVMFCAGDTFR
1rj9A           EKLVGMLEPDERR----ATLRKLGFNPQKPKPVXXXXXXXXXKTTTIAKLGRYYQNLGKKVMFCAGDTFR
1zu4A           A-----LVESLYQAYTDNDWYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFR
1zu5B           A--LVESLYQAYTD--NDWTYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFR
1zu5A           ---------------------RIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFR
2iylD           RKDLKEAVKEKLVGMLDATLRKLGFNPQKPVXXXXXXXXXXXKTTTIAKLGRYYQNLGKKVMFCAGDT--
1hq1A           ----------------------------------------------------------------------
1qb2B           ----------------------------------------------------------------------
1qb2A           ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
1wgwA           RKMIQHAVFKELVKV-------------------------------------------------------
2aeuA           ----------------------------------------------------------------------
2aevA           ----------------------------------------------------------------------
2yvuB           -------------------------------VVWLTGLPGSGKTTIATRLADLLQKEGYRVEVLDGD---
2yvuA           -------------------------------VVWLTGLPGSGKTTIATRLADLLQKEGYRVEVLDGD---
2jqeA           ----------------------------------------------------------------------
2gksB           --------RPEVAEILAETYVPKH---KQGFCVWLTGLPCAGKSTIAEILATMLQARGRKVTLLDGDVVR
2gksA           --------RPEVAEILAETYVPKH---KQGFCVWLTGLPCAGKSTIAEILATMLQARGRKVTLLDGDVVR
2px0A           ---------------------------------------------------------------ITTDTYR
1f3uA           ----------------------------------------------------------------------
2dwoA           --------------------------PNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYR
2axnA           --------------------------PNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYR


                         +         .         .         .         .         *         .:210
query           PAAIKQLQVLGDQLNIPVFSMGQENPVKIAQSAVEQANSTGRDLVIIDTAGRLHINEELMDELANIKSTV
2j289           PAAIKQLETLAEQVGVDFFDVGQK-PVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASI
2ffhA           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
2c04A           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
2c03B           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
1jpnA           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
1jpnB           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
2c03A           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
1jpjA           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
2ng1A           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
2j7pB           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
2j7pA           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
1okkA           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
1rj9B           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
1ls1A           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
1ffhA           PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
3dm5A           PGAYHQLRQLLDRYHIEVFGNPQEDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQISNVI
3dm5B           PGAYHQLRQLLDRYHIEVFGNPQEDAIKLAKEGVDYFKSKGVDIIIVDTAGR-HKEDKALIEMKQISNVI
1qzxA           PAAYDQLLQLGNQIGVQVYEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRYGXXXXXXXXXXXXYDVL
1qzwA           PAAYDQLLQLGNQIGVQVYEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRYGXXXXXXXXXXXXYDVL
2j37W           AGAFDQLKQNATKARIPFYSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAI
2v3cC           PAAYEQLKQLAEKIHVPIYGTRTKSPVDIVKEGMEKFKKA--DVLIIDTAGRHKEEKGLLEEMKQIKEIT
2v3cD           PAAYEQLKQLAEKIHVPIYGTRTKSPVDIVKEGMEKFKKA--DVLIIDTAGRHKEEKGLLEEMKQIKEIT
1j8yF           PAAXXXXXXXXXXIGVPVYGEGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEELLEEMKNIYEAI
2qy9A           AAAVEQLQVWGQRNNIPVIAQHTADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVM
1ftsA           AAAVEQLQVWGQRNNIPVIAQHTADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVM
3b9qA           AAASDQLEIWAERTGCEIVVAEKAKAATVLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLMEELIACKKAV
2og2A           AAASDQLEIWAERTGIVVAEGDKAKAATVLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLMEELIACKKAV
1vmaA           AAAIEQLKIWGERVGATVISHSEXXXXXXXXXXXXXXXXRNKDVVIIDTAGRLHTKKNLMEELRKVHRVV
3dmdC           AGAIEQLEEHAKRIGVKVIKHSYADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVT
3dmdA           AGAIEQLEEHAKRIGVKVIKHSYADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVT
3dmdB           AGAIEQLEEHAKRIGVKVIKHSYADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVT
1j8mF           PAAXXXXXXXXXXIGVPVYGEGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEELLEEMKNIYEAI
3e70C           AGAIEQLEEHAKRIGVKVIKHSYADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVT
3dm9B           AGAIEQLEEHAKRIGVKVIKHSYADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLDEK--KIARVT
2cnwE           AAGGTQLSEWGKRLSIPVIQ-GPEDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
2q9bA           AAGGTQLSEWGKRLSIPVIQ-GPEDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
2q9aA           AAGGTQLSEWGKRLSIPVIQ-GPEDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
2q9bB           AAGGTQLSEWGKRLSIPVIQ-GPEDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
2q9aB           AAGGTQLSEWGKRLSIPVIQ-GPEDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
1okkD           AAGGTQLSEWGKRLSIPVIQ-GPEDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
2j7pE           AAGGTQLSEWGKRLSIPVIQ-GPEDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
2j7pD           AAGGTQLSEWGKRLSIPVIQ-GPEDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
2cnwF           AAGGTQLSEWGKRLSIPVIQ-GPEDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
2cnwD           AAGGTQLSEWGKRLSIPVIQ-GPEDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
1rj9A           AAGGTQLSEWGKRLSIPVIQ-GPEDSAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
1zu4A           AGATQQLEELNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKII
1zu5B           AGATQQLEELNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKII
1zu5A           AGATQQLEELNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKII
2iylD           ----TQLSEWGKRLSIPVIQ-GPEDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
1hq1A           ----------------------------------------------------------------------
1qb2B           ----------------------------------------------------------------------
1qb2A           ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
1wgwA           ----------------------------------------------------------------------
2aeuA           ----------------------------------EILNKIDKDTLVIITGSTMDLKVIELENFKKVINTA
2aevA           ----------------------------------EILNKIDKDTLVIITGSTMDLKVIELENFKKVINTA
2yvuB           ----------------------------------------------------------------------
2yvuA           ----------------------------------------------------------------------
2jqeA           ----------------------------------------------------------------------
2gksB           ----------------------------------------------------------------------
2gksA           ----------------------------------------------------------------------
2px0A           IAAVEQLKTYAELLQAPL-------EVCYTKEEFQQAKESEYDHVFVDTAGRNFKDPQYIDELKETIPFE
1f3uA           --------------------------VKVPKYLSQQAKASGRGEVIAKTQGRTEVSFTLNEDLANIHSVS
2dwoA           REAVKQ----------------------------------------------------------------
2axnA           REAVKQ----------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RPHEILLVVDAMTGQEAVNVADTFNQKLGLDGIVMTKLDGDARGGAALSVRKVTGTPIKFAGMGEKLDAL
2j289           NPVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEAL
2ffhA           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
2c04A           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
2c03B           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
1jpnA           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
1jpnB           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
2c03A           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
1jpjA           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
2ng1A           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
2j7pB           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
2j7pA           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
1okkA           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
1rj9B           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
1ls1A           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAG------GL
1ffhA           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAG-------L
3dm5A           HPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDI
3dm5B           HPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDI
1qzxA           KPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDEL
1qzwA           KPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDEL
2j37W           QPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDF
2v3cC           NPDEIILVIDGTIGQQAGIQAKAFKEAVGIGSIIVTKLDGSAKGGGALSAVAETKAPIKFIGIGEGIDDL
2v3cD           NPDEIILVIDGTIGQQAGIQAKAFKEAVGIGSIIVTKLDGSAKGGGALSAVAETKAPIKFIGIGEGIDDL
1j8yF           KPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDEL
2qy9A           KPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDL
1ftsA           KPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDL
3b9qA           APNEILLVLDGNTGLNMLPQAREFNEVVGITGLILTKLDGSARGGCVVSVVEELGIPVKFIGVGEAVEDL
2og2A           APNEILLVLDGNTGLNMLPQAREFNEVVGITGLILTKLDGSARGGCVVSVVEELGIPVKFIGVGEAVEDL
1vmaA           KPHETLLVIDATTGQNGLVQAKIFKEAVNVTGIILTKLDGTAKGGITLAIARELGIPIKFIGVGEKAEDL
3dmdC           KPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDL
3dmdA           KPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDL
3dmdB           KPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDL
1j8mF           KPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDEL
3e70C           KPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDL
3dm9B           KPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDL
2cnwE           EPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
2q9bA           EPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
2q9aA           EPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
2q9bB           EPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
2q9aB           EPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
1okkD           EPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
2j7pE           EPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
2j7pD           EPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
2cnwF           EPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
2cnwD           EPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
1rj9A           EPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
1zu4A           QPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDL
1zu5B           QPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDL
1zu5A           QPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDL
2iylD           EPKEVWLVLDAVTGQ--LEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
1hq1A           ----------------------------------------------------------------------
1qb2B           ----------------------------------------------------------------------
1qb2A           ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
1wgwA           ----------------------------------------------------------------------
2aeuA           KNKEAIVFVDDASG---ARVRLLFNQKLGADLVVTSKLMEGPRGGL-LAGKKELVDKIYIEGTKFGLEAQ
2aevA           KNKEAIVFVDDASG---ARVRLLFNQKLGADLVVTTDLMEGPRGGL-LAGKKELVDKIYIEGTKFGLEAQ
2yvuB           ----------------------------------------------------------------------
2yvuA           ----------------------------------------------------------------------
2jqeA           ----------------------------------------------------------------------
2gksB           ----------------------------------------------------------------------
2gksA           ----------------------------------------------------------------------
2px0A           SSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNV---
1f3uA           APREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAE-------------------------------
2dwoA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EPFYPDRMADRILGMGDVLTLIEKAQANFDAEQAAKLNKKIRQADFNLEDFLEQMQQVKKLGPLEQVLGM
2j289           EPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLKKGDFDLNDFLEQLRQMKNMGGMASLMGK
2ffhA           EPFYPERLAGRILGMGDVASLAE----------------KVRAAELSLEDFLKQMQNLKRLGPFSEILGL
2c04A           EPFYPERLAGRILGMGDV----------------------------------------------------
2c03B           EPFYPERLAGRILGMGDV----------------------------------------------------
1jpnA           EPFYPERLAGRILGMGD-----------------------------------------------------
1jpnB           EPFYPERLAGRILGMG------------------------------------------------------
2c03A           EPFYPERLAGRILGMG------------------------------------------------------
1jpjA           EPFYPERLAGRILGM-------------------------------------------------------
2ng1A           EPFYPERLAGRILGM-------------------------------------------------------
2j7pB           EPFYPERLAGRILGM-------------------------------------------------------
2j7pA           EPFYPERLAGRILGM-------------------------------------------------------
1okkA           EPFYPERLAGRILG--------------------------------------------------------
1rj9B           EPFYPERLAGRILGMG------------------------------------------------------
1ls1A           EPFYPERLAGRILGMG------------------------------------------------------
1ffhA           EPFYPERLAGRILGMG------------------------------------------------------
3dm5A           EPFDPPRFVSRLLGLGDIQXXXXXXXXXXXXXXXXXXXXRFLRGKFTLKDMYAQLEAMRKMGPI------
3dm5B           EPFDPPRFVSRLLGLGDIQXXXXXXXXXXXXXXXXXXXXRFLRGKFTLKDMYAQLEAMRKMGP-------
1qzxA           ETFNAKRFVSRILGMGDIESILEKVKG---LEEYDKIQKKME--DLTLRDVYAQIIALRKMGPLSKVLQH
1qzwA           ETFNAKRFVSRILGMGDIESILEKVKG---LEEYDKIQKKMEKGKLTLRDVYAQIIALRKMGPLSKVLQH
2j37W           EPFKTQPFISKLLGMGDIEGLIDKVELKLDDNEA--LIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGM
2v3cC           EPFDPKKFISRLLGMGDLESLLEKAEDMVD-EKTEESIDAIMRGKFTLNELMTQLEAIENM---------
2v3cD           EPFDPKKFISRLLGMGDLESLLEKAEDMVD-EKTEESIDAIMRGKFTLNELMTQLEAI------------
1j8yF           EVFNPRRFVARL----------------------------------------------------------
2qy9A           RPFKAD----------------------------------------------------------------
1ftsA           RPFKAD----------------------------------------------------------------
3b9qA           QPFDPEAFVNAI----------------------------------------------------------
2og2A           QPFDPEAFVNAI----------------------------------------------------------
1vmaA           RPFDPEAFVEVLL---------------------------------------------------------
3dmdC           RPFEKEWFLERIFG--------------------------------------------------------
3dmdA           RPFEKEWFLERIFG--------------------------------------------------------
3dmdB           RPFEKEWFLERIFG--------------------------------------------------------
1j8mF           EVFNPRRFVARL----------------------------------------------------------
3e70C           RPFEKEWFLERIFG--------------------------------------------------------
3dm9B           RPFEKEWFLERIFG--------------------------------------------------------
2cnwE           QPFDPEAFVEALL---------------------------------------------------------
2q9bA           QPFDPEAFVEALL---------------------------------------------------------
2q9aA           QPFDPEAFVEALL---------------------------------------------------------
2q9bB           QPFDPEAFVEALL---------------------------------------------------------
2q9aB           QPFDPEAFVEALL---------------------------------------------------------
1okkD           QPFDPEAFVEALL---------------------------------------------------------
2j7pE           QPFDPEAFVEALL---------------------------------------------------------
2j7pD           QPFDPEAFVEALL---------------------------------------------------------
2cnwF           QPFDPEAFVEALL---------------------------------------------------------
2cnwD           QPFDPEAFVEALL---------------------------------------------------------
1rj9A           QPFDPEAFVEALL---------------------------------------------------------
1zu4A           LAFDIDQ---------------------------------------------------------------
1zu5B           LAFDIDQ---------------------------------------------------------------
1zu5A           LAFDIDQ---------------------------------------------------------------
2iylD           QPFDPEAFVEALL---------------------------------------------------------
1hq1A           ---------------------------------------------FDLNDFLEQLRQ-------------
1qb2B           ---------------------------------------------FTLRDMYEQFQNIMKMGPFSQILGM
1qb2A           ---------------------------------------------FTLRDMYEQFQNIMKMGPFSQILGM
1mfqC           -----------------------------------------KHGQFTLRDMYEQFQNIMKMGPFSQILGM
1dulA           ----------------------------------------------------------------------
1wgwA           ----------------------------------------------------------------------
2aeuA           PPLLAGYRALKNFNLERIRKAFERAK-NFDLSKIEKLNKELKAIDDNINIVYER----------------
2aevA           PPLLAGYRALKNFNLERIRKAFERAK-NFDLSKIEKLNKELKAIDDNINIVYER----------------
2yvuB           ----------------------------------------------------------------------
2yvuA           ----------------------------------------------------------------------
2jqeA           ----------------------------------------MEKGTFTLKDIYKQIEAMNKMGPVRKIFEM
2gksB           ----------------------------------------------------------------------
2gksA           ----------------------------------------------------------------------
2px0A           ----------------------------------------------------------------------
1f3uA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IPGMGKLTKQLKDQQLDGKELAQVEAIIYSMTVWERHHPEKIDGSRKKRIARGSGTRVQDVNQLLKQFEQ
2j289           LPGMGQIPDNVK-SQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDD
2ffhA           LPGVPQGLK------VDEKAIKRLEAIVLSMTPEERKDPRILNGSRRKRIAKGSGTSVQEVNRFIKAFEE
2c04A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1jpnA           ----------------------------------------------------------------------
1jpnB           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1jpjA           ----------------------------------------------------------------------
2ng1A           ----------------------------------------------------------------------
2j7pB           ----------------------------------------------------------------------
2j7pA           ----------------------------------------------------------------------
1okkA           ----------------------------------------------------------------------
1rj9B           ----------------------------------------------------------------------
1ls1A           ----------------------------------------------------------------------
1ffhA           ----------------------------------------------------------------------
3dm5A           --------------SIGEERLKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQ
3dm5B           --------------SIGEERLKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQ
1qzxA           IPGLGMLPTPSEDQLKIGEEIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGXXXXXXXXXXXWYNN
1qzwA           IPGLGMLPTPSEDQLKIGEEIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGXXXXXXXXXXXWYNN
2j37W           IPGFG------TDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTRIQRVARGSGVSTRDVQELLTQYTK
2v3cC           ---------------LTEAKIKKYKVIISSMTKEERENPXXXXXXXXXXXXXXXXTTENDVREVLRYYET
2v3cD           --------------ELTEAKIKKYKVIISSMTKEERENPXXXXXXXXXXXXXXXXTTENDVREVLRYYET
1j8yF           ----------------------------------------------------------------------
2qy9A           ----------------------------------------------------------------------
1ftsA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2og2A           ----------------------------------------------------------------------
1vmaA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
1j8mF           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2cnwE           ----------------------------------------------------------------------
2q9bA           ----------------------------------------------------------------------
2q9aA           ----------------------------------------------------------------------
2q9bB           ----------------------------------------------------------------------
2q9aB           ----------------------------------------------------------------------
1okkD           ----------------------------------------------------------------------
2j7pE           ----------------------------------------------------------------------
2j7pD           ----------------------------------------------------------------------
2cnwF           ----------------------------------------------------------------------
2cnwD           ----------------------------------------------------------------------
1rj9A           ----------------------------------------------------------------------
1zu4A           ----------------------------------------------------------------------
1zu5B           ----------------------------------------------------------------------
1zu5A           ----------------------------------------------------------------------
2iylD           ----------------------------------------------------------------------
1hq1A           ----------------DDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDD
1qb2B           IPGFG------TDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTRIQRVARGSGVSTRDVQELLTQYTK
1qb2A           IPGFG------TDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTRIQRVARGSGVSTRDVQELLTQYTK
1mfqC           IPGMARLKKSMNDQELDSTDGAKVFS----------KQPGRI-----QRVARGSGVSTRDVQELLTQYTK
1dulA           ------------------------EAIINSTK--ERAKPEIIKGSRKRRIAAGSG-QVQDVNRLLKQFDD
1wgwA           ----------------------------------------------------------------------
2aeuA           ----------------------------------------------------------------------
2aevA           ----------------------------------------------------------------------
2yvuB           ----------------------------------------------------------------------
2yvuA           ----------------------------------------------------------------------
2jqeA           LPGLG-LKVDNDVMEMTQEKMKKFRVIMDSMTEEELLNPKXXXXXXXXXXXXXXGTSPQEVKELL-----
2gksB           ----------------------------------------------------------------------
2gksA           ----------------------------------------------------------------------
2px0A           ----------------------------------------------------------------------
1f3uA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TRKMMKQISNMxxxxxxxxxxxxxxx
2j289           MQRMMKKM------------------
2ffhA           MKALMKSL------------------
2c04A           --------------------------
2c03B           --------------------------
1jpnA           --------------------------
1jpnB           --------------------------
2c03A           --------------------------
1jpjA           --------------------------
2ng1A           --------------------------
2j7pB           --------------------------
2j7pA           --------------------------
1okkA           --------------------------
1rj9B           --------------------------
1ls1A           --------------------------
1ffhA           --------------------------
3dm5A           MKKLFKSMN-----------------
3dm5B           MKKLFKSMN-----------------
1qzxA           MNRLLKMV------------------
1qzwA           MNRLLKMV------------------
2j37W           FAQMVKKMGGI---------------
2v3cC           TKNAIDKL------------------
2v3cD           TKNAIDKL------------------
1j8yF           --------------------------
2qy9A           --------------------------
1ftsA           --------------------------
3b9qA           --------------------------
2og2A           --------------------------
1vmaA           --------------------------
3dmdC           --------------------------
3dmdA           --------------------------
3dmdB           --------------------------
1j8mF           --------------------------
3e70C           --------------------------
3dm9B           --------------------------
2cnwE           --------------------------
2q9bA           --------------------------
2q9aA           --------------------------
2q9bB           --------------------------
2q9aB           --------------------------
1okkD           --------------------------
2j7pE           --------------------------
2j7pD           --------------------------
2cnwF           --------------------------
2cnwD           --------------------------
1rj9A           --------------------------
1zu4A           --------------------------
1zu5B           --------------------------
1zu5A           --------------------------
2iylD           --------------------------
1hq1A           MQRMMKKM------------------
1qb2B           FAQMVKKM------------------
1qb2A           FAQMV---------------------
1mfqC           FAQMVKKMGGI---------------
1dulA           QRK-----------------------
1wgwA           --------------------------
2aeuA           --------------------------
2aevA           --------------------------
2yvuB           --------------------------
2yvuA           --------------------------
2jqeA           --------------------------
2gksB           --------------------------
2gksA           --------------------------
2px0A           --------------------------
1f3uA           --------------------------
2dwoA           --------------------------
2axnA           --------------------------