[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO50700.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wb1C.bssp"
#ERROR : Can't open dsspfile "1tuiA.bssp"
#ERROR : Can't open dsspfile "1ob5A.bssp"
#ERROR : Can't open dsspfile "1eftA.bssp"
#ERROR : Can't open dsspfile "1b23P.bssp"
#ERROR : Can't open dsspfile "1exmA.bssp"
#ERROR : Can't open dsspfile "2c78A.bssp"
#ERROR : Can't open dsspfile "2c77A.bssp"
#ERROR : Can't open dsspfile "1lvaA.bssp"
#ERROR : Can't open dsspfile "1wb1B.bssp"
#ERROR : Can't open dsspfile "1wb3B.bssp"
#ERROR : Can't open dsspfile "2uwmB.bssp"
#ERROR : Can't open dsspfile "1ha3A.bssp"
#ERROR : Can't open dsspfile "2uwmA.bssp"
#ERROR : Can't open dsspfile "3ficZ.bssp"
#ERROR : Can't open dsspfile "1aipE.bssp"
#ERROR : Can't open dsspfile "1ha3B.bssp"
#ERROR : Can't open dsspfile "1aipA.bssp"
#ERROR : Can't open dsspfile "2plyB.bssp"
#ERROR : Can't open dsspfile "2plyA.bssp"
#ERROR : Can't open dsspfile "1wb3A.bssp"
#ERROR : Can't open dsspfile "1mj1A.bssp"
#ERROR : Can't open dsspfile "1wb2A.bssp"
#ERROR : Can't open dsspfile "1wb1A.bssp"
#ERROR : Can't open dsspfile "2dcuA.bssp"
#ERROR : Can't open dsspfile "1kjzA.bssp"
#ERROR : Can't open dsspfile "1kk1A.bssp"
#ERROR : Can't open dsspfile "1kk2A.bssp"
#ERROR : Can't open dsspfile "2d74A.bssp"
#ERROR : Can't open dsspfile "1kk3A.bssp"
#ERROR : Can't open dsspfile "1d2eA.bssp"
#ERROR : Can't open dsspfile "2plfA.bssp"
#ERROR : Can't open dsspfile "1wb1D.bssp"
#ERROR : Can't open dsspfile "1kk0A.bssp"
#ERROR : Can't open dsspfile "1ijeA.bssp"
#ERROR : Can't open dsspfile "1g7cA.bssp"
#ERROR : Can't open dsspfile "1f60A.bssp"
#ERROR : Can't open dsspfile "2b7cA.bssp"
#ERROR : Can't open dsspfile "1s0uA.bssp"
#ERROR : Can't open dsspfile "2ahoA.bssp"
#ERROR : Can't open dsspfile "3cw2B.bssp"
#ERROR : Can't open dsspfile "1skqA.bssp"
#ERROR : Can't open dsspfile "1jnyA.bssp"
#ERROR : Can't open dsspfile "1jnyB.bssp"
#ERROR : Can't open dsspfile "2qn6A.bssp"
#ERROR : Can't open dsspfile "1wsuB.bssp"
#ERROR : Can't open dsspfile "1wsuA.bssp"
#ERROR : Can't open dsspfile "1wsuD.bssp"
#ERROR : Can't open dsspfile "1xb2A.bssp"
#ERROR : Can't open dsspfile "1zunB.bssp"
#ERROR : Can't open dsspfile "2bvnA.bssp"
#ERROR : Can't open dsspfile "1ob2A.bssp"
#ERROR : Can't open dsspfile "2fx3A.bssp"
#ERROR : Can't open dsspfile "3fihZ.bssp"
#ERROR : Can't open dsspfile "1efcA.bssp"
#ERROR : Can't open dsspfile "1dg1G.bssp"
#ERROR : Can't open dsspfile "1d8tB.bssp"
#ERROR : Can't open dsspfile "1d8tA.bssp"
#ERROR : Can't open dsspfile "2bvnB.bssp"
#ERROR : Can't open dsspfile "1etuA.bssp"
#ERROR : Can't open dsspfile "2v9vA.bssp"
#ERROR : Can't open dsspfile "1zo1I.bssp"
#ERROR : Can't open dsspfile "1wsuC.bssp"
#ERROR : Can't open dsspfile "1efuA.bssp"
#ERROR : Can't open dsspfile "2hdnB.bssp"
#ERROR : Can't open dsspfile "1g7tA.bssp"
#ERROR : Can't open dsspfile "1g7sA.bssp"
#ERROR : Can't open dsspfile "2elfA.bssp"
#ERROR : Can't open dsspfile "2hcjB.bssp"
#ERROR : Can't open dsspfile "3degC.bssp"
#ERROR : Can't open dsspfile "2e1rA.bssp"
#ERROR : Can't open dsspfile "1r5bA.bssp"
#ERROR : Can't open dsspfile "1r5nA.bssp"
#ERROR : Can't open dsspfile "3i92A.bssp"
#ERROR : Can't open dsspfile "3i8sA.bssp"
#ERROR : Can't open dsspfile "3hyrA.bssp"
#ERROR : Can't open dsspfile "3i8xA.bssp"
#ERROR : Can't open dsspfile "3i8sB.bssp"
#ERROR : Can't open dsspfile "1zm4A.bssp"
#ERROR : Can't open dsspfile "2ywfA.bssp"
#ERROR : Can't open dsspfile "1u2rA.bssp"
#ERROR : Can't open dsspfile "2pjpA.bssp"
#ERROR : Can't open dsspfile "2p8xT.bssp"
#ERROR : Can't open dsspfile "2p8wT.bssp"
#ERROR : Can't open dsspfile "2npfA.bssp"
#ERROR : Can't open dsspfile "1n0vC.bssp"
#ERROR : Can't open dsspfile "1n0uA.bssp"
#ERROR : Can't open dsspfile "2ywgA.bssp"
#ERROR : Can't open dsspfile "1u0lA.bssp"
#ERROR : Can't open dsspfile "2h5eB.bssp"
#ERROR : Can't open dsspfile "2h5eA.bssp"
#ERROR : Can't open dsspfile "3i92C.bssp"
#ERROR : Can't open dsspfile "3i92B.bssp"
#ERROR : Can't open dsspfile "3hytC.bssp"
#ERROR : Can't open dsspfile "3cb4D.bssp"
#ERROR : Can't open dsspfile "2bv3A.bssp"
#ERROR : Can't open dsspfile "2ywhA.bssp"

## Summary of PDB Search
:635
    1e-38  31%  1wb1C  [c.37.1 - b.43.3 - b.44.1 - b.43.3] TRANSLATION ELONGATION
    2e-38  34%  1tuiA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    2e-38  34%  1ob5A  [x.x.x] ELONGATION FACTOR TU
    2e-38  34%  1eftA  [x.x.x] ELONGATION FACTOR TU
    2e-38  34%  1b23P  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    6e-38  34%  1exmA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU (EF-TU)
    6e-38  34%  2c78A  [x.x.x] ELONGATION FACTOR TU-A
    6e-38  34%  2c77A  [x.x.x] ELONGATION FACTOR TU-B
    5e-37  37%  1lvaA  [a.4.5 - a.4.5 - a.4.5 - a.4.5] SELENOCYSTEINE-SPECIFIC
    2e-35  32%  1wb1B  [c.37.1 - b.43.3 - b.44.1] TRANSLATION ELONGATION FACTOR SELB
    2e-35  32%  1wb3B  [c.37.1 - b.43.3 - b.44.1] TRANSLATION ELONGATION FACTOR SELB
    9e-35  40%  2uwmB  [x.x.x] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR
    3e-34  32%  1ha3A  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    4e-34  40%  2uwmA  [x.x.x] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR
    4e-34  33%  3ficZ  [x.x.x] ELONGATION FACTOR TU-A
    4e-34  33%  1aipE  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    7e-34  33%  1ha3B  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    1e-33  33%  1aipA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    2e-33  39%  2plyB  [x.x.x] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR
    2e-33  39%  2plyA  [x.x.x] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR
    2e-33  31%  1wb3A  [c.37.1 - b.43.3 - b.44.1 - b.43.3] TRANSLATION ELONGATION
    3e-33  32%  1mj1A  [i.1.1] ELONGATION FACTOR TU
    6e-33  31%  1wb2A  [c.37.1 - b.43.3 - b.44.1 - b.43.3] TRANSLATION ELONGATION
    2e-32  31%  1wb1A  [c.37.1 - b.43.3 - b.44.1 - b.43.3] TRANSLATION ELONGATION
    3e-32  34%  2dcuA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    8e-31  34%  1kjzA  [c.37.1 - b.43.3 - b.44.1] EIF2GAMMA
    1e-30  33%  1kk1A  [c.37.1 - b.43.3 - b.44.1] EIF2GAMMA
    1e-30  34%  1kk2A  [c.37.1 - b.43.3 - b.44.1] EIF2GAMMA
    1e-30  34%  2d74A  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    2e-30  34%  1kk3A  [c.37.1 - b.43.3 - b.44.1] EIF2GAMMA
    1e-27  27%  1d2eA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU (EF-TU)
    5e-27  39%  2plfA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    9e-27  30%  1wb1D  [c.37.1 - b.43.3 - b.44.1] TRANSLATION ELONGATION FACTOR SELB
    3e-24  36%  1kk0A  [c.37.1 - b.43.3 - b.44.1] EIF2GAMMA
    4e-24  34%  1ijeA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR 1-ALPHA
    4e-24  34%  1g7cA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR 1-ALPHA
    4e-24  34%  1f60A  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR EEF1A
    4e-24  34%  2b7cA  [x.x.x] ELONGATION FACTOR 1-ALPHA
    2e-23  50%  1s0uA  [c.37.1 - b.43.3 - b.44.1] TRANSLATION INITIATION FACTOR 2
    3e-23  39%  2ahoA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    6e-23  37%  3cw2B  [x.x.x] TRANSLATION INITIATION FACTOR 2 SUBUNIT GAMMA
    1e-22  33%  1skqA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR 1-ALPHA
    1e-22  33%  1jnyA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR 1-ALPHA
    4e-22  30%  1jnyB  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR 1-ALPHA
    6e-22  30%  2qn6A  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    4e-20  40%  1wsuB  [x.x.x] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR
    4e-20  40%  1wsuA  [x.x.x] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR
    7e-19  43%  1wsuD  [x.x.x] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR
    2e-17  26%  1xb2A  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU,
    5e-17  30%  1zunB  [x.x.x] SULFATE ADENYLATE TRANSFERASE, SUBUNIT
    1e-16  33%  2bvnA  [x.x.x] ELONGATION FACTOR TU
    7e-16  34%  1ob2A  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    7e-16  34%  2fx3A  [x.x.x] ELONGATION FACTOR TU
    7e-16  34%  3fihZ  [x.x.x] ELONGATION FACTOR TU
    7e-16  34%  1efcA  [c.37.1 - b.43.3 - b.44.1] PROTEIN (ELONGATION FACTOR)
    7e-16  34%  1dg1G  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    7e-16  34%  1d8tB  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    7e-16  34%  1d8tA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    4e-14  32%  2bvnB  [x.x.x] ELONGATION FACTOR TU
    1e-13  37%  1etuA  [x.x.x] ELONGATION FACTOR TU
    3e-13  29%  2v9vA  [x.x.x] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR
    4e-13  32%  1zo1I  [x.x.x] TRANSLATION INITIATION FACTOR 2
    8e-12  38%  1wsuC  [x.x.x] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR
    4e-11  31%  1efuA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    1e-10  33%  2hdnB  [x.x.x] ELONGATION FACTOR EF-TU
    3e-10  32%  1g7tA  [c.37.1 - b.43.3 - c.20.1 - b.43.3] TRANSLATION INITIATION
    3e-10  32%  1g7sA  [c.37.1 - b.43.3 - c.20.1 - b.43.3] TRANSLATION INITIATION
    3e-10  23%  2elfA  [x.x.x] PROTEIN TRANSLATION ELONGATION FACTOR 1A
    1e-09  32%  2hcjB  [x.x.x] PROTEIN CHAIN ELONGATION FACTOR EF-TU
    5e-08  33%  3degC  [x.x.x] GTP-BINDING PROTEIN LEPA
    2e-06  35%  2e1rA  [x.x.x] ELONGATION FACTOR 2
    5e-06  25%  1r5bA  [c.37.1 - b.43.3 - b.44.1] EUKARYOTIC PEPTIDE CHAIN RELEASE
    1e-05  27%  1r5nA  [c.37.1 - b.43.3 - b.44.1] EUKARYOTIC PEPTIDE CHAIN RELEASE
    1e-05  29%  3i92A  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    2e-05  29%  3i8sA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    3e-05  28%  3hyrA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    5e-05  30%  3i8xA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    1e-04  29%  3i8sB  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    2e-04  34%  1zm4A  [x.x.x] ELONGATION FACTOR 2
    2e-04  31%  2ywfA  [x.x.x] GTP-BINDING PROTEIN LEPA
    2e-04  34%  1u2rA  [c.37.1 - b.43.3 - d.58.11 - d.14.1 - d.58.11] ELONGATION
    2e-04  29%  2pjpA  [x.x.x] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR
    2e-04  34%  2p8xT  [x.x.x] ELONGATION FACTOR 2
    2e-04  34%  2p8wT  [x.x.x] ELONGATION FACTOR 2
    2e-04  34%  2npfA  [x.x.x] ELONGATION FACTOR 2
    2e-04  33%  1n0vC  [c.37.1 - b.43.3 - d.58.11 - d.14.1 - d.58.11] ELONGATION
    2e-04  34%  1n0uA  [c.37.1 - b.43.3 - d.58.11 - d.14.1 - d.58.11] ELONGATION
    3e-04  30%  2ywgA  [x.x.x] GTP-BINDING PROTEIN LEPA
    3e-04  29%  1u0lA  [b.40.4 - c.37.1] PROBABLE GTPASE ENGC
    4e-04  29%  2h5eB  [x.x.x] PEPTIDE CHAIN RELEASE FACTOR RF-3
    4e-04  29%  2h5eA  [x.x.x] PEPTIDE CHAIN RELEASE FACTOR RF-3
    5e-04  29%  3i92C  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    5e-04  29%  3i92B  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    5e-04  31%  3hytC  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    5e-04  27%  3cb4D  [x.x.x] GTP-BINDING PROTEIN LEPA
    5e-04  30%  2bv3A  [x.x.x] ELONGATION FACTOR G
    8e-04  29%  2ywhA  [x.x.x] GTP-BINDING PROTEIN LEPA
:635

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKHIIIGTAGHVDHGKTLLIKTLTGMDTDRLKEEKERGISIELGFAQLKLPSGKQAGIVDVPGHEKFIKN
1wb1C           -KNINLGIFGHIDHGKTTLSKVLTEIASDKLPESQKRGITIDIGFSAFKLENYRIT-LVDAPGHADLIRA
1tuiA           --HVNVGTIGHVDHGKXXXVEVKDYGDIDKAPEERARGITINTAHVEYETAK-RHYSHVDCPGHADYIKN
1ob5A           --HVNVGTIGHVDHGKXXXVEVKDYGDIDKAPEERARGITINTAHVEYETAK-RHYSHVDCPGHADYIKN
1eftA           --HVNVGTIGHVDHGKXXXVEVKDYGDIDKAPEERARGITINTAHVEYETAK-RHYSHVDCPGHADYIKN
1b23P           --HVNVGTIGHVDHGKXXXVEVKDYGDIDKAPEERARGITINTAHVEYETAK-RHYSHVDCPGHADYIKN
1exmA           --HVNVGTIGHVDHGKXXXVEVKDYGDIDKAPEERARGITINTAHVEYETAK-RHYSHVDCPGHADYIKN
2c78A           --HVNVGTIGHVDHGKXXXVEVKDYGDIDKAPEERARGITINTAHVEYETAK-RHYSHVDCPGHADYIKN
2c77A           --HVNVGTIGHVDHGKXXXVEVKDYGDIDKAPEERARGITINTAHVEYETAK-RHYSHVDCPGHADYIKN
1lvaA           ----------------------------------------------------------------------
1wb1B           -KNINLGIFGHIDHGKTTLSKVLTEIASP---ESQKRGITIDIGFSAFKLENYRIT-LVDAPGHADLIRA
1wb3B           -KNINLGIFGHIDHGKTTLSKVLTEI----APESQKRGITIDIGFSAFKLENYRIT-LVDAPGHADLIRA
2uwmB           ----------------------------------------------------------------------
1ha3A           --HVNVGTIGHVDHGKXXXXXXXXXXXXXENPNVEVKDYGDIDKTAHVEYETAKRHSHVDCPGHADYIKN
2uwmA           ----------------------------------------------------------------------
3ficZ           --HVNVGTIGHVDHGKXXXXXXXXXXXXX------ENPAHVEYETAK------RHYSHVDCPGHADYIKN
1aipE           --HVNVGTIGHVDHGKXXXXXXXXXXXXX------ENPAHVEYETAK------RHYSHVDCPGHADYIKN
1ha3B           --HVNVGTIGHVDHGKXXXXXXXXXXXXX---ENPNAHVEYET--------AKRHYSHVDCPGHADYIKN
1aipA           --HVNVGTIGHVDHGKXXXXXXXXXXXXX------------ENPTAHVEYETAKRHSHVDCPGHADYIKN
2plyB           ----------------------------------------------------------------------
2plyA           ----------------------------------------------------------------------
1wb3A           -KNINLGIFGHIDHGKTTLSKVLT---------------EIAIGFSAFKLENYRIT-LVDAPGHADLIRA
1mj1A           -RHVNVGTIGHVDHGKXXXVEVKDYGDIDKAREERARGITINTAHVEYETAK-RHYSHVDCRGHADYIKN
1wb2A           -KNINLGIFGHIDHGKTTLSKVLT---------------EIASGFSAFKLENYRIT-LVDAPGHADLIRA
1wb1A           -KNINLGIFGHIDHGKTTLSKVLTEI----------------AGFSAFKLENYRIT-LVDAPGHADLIRA
2dcuA           -----IGMVGHVDHGKTTLTKALTGVWTDTHSEELRRGITIKIGFADAEIRRCSNCGFIDSPGHEALMTT
1kjzA           -----IGMVGHVDHGKTTLTKALTGVWTDH-SEELRRGITIKIGFADAEIRRCPNCGFIDAPGHEALMTT
1kk1A           -----IGMVGHVDHGKTTLTKALTGVWTD--SEELRRGITIKIGFADAEIRRCPNCGFIDAPGHEALMTT
1kk2A           -----IGMVGHVDHGKTTLTKALTGVWTD--SEELRRGITIKIGFADAEIRRCPNCGFIDAPGHEALMTT
2d74A           -----IGMVGHVDHGKTTLTKALTGVWTDTLR----RGITIKIGFADAEIRRCSNCGFIDSPGHEALMTT
1kk3A           -----IGMVGHVDHGKTTLTKALTGVWTD--SEELRRGITIKIGFADAEIRRCPNCGFIDAPGHEALMTT
1d2eA           --HVNVGTIGHVDHGXXXXXKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAH-TDCPGHADYVKN
2plfA           -----IGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIPSCKSCGFIDAPGHEVLMAT
1wb1D           --NINLGIFGHIDHGKTTLSKVLT---------------EIASTFSAFKLENYRITLVDDL------IRA
1kk0A           ---------GHVDHGKTTLTKALTGVWTDH-SEELRRGITIKIGFADAEIRRCPNCGFIDAPGHEAL--T
1ijeA           --HINVVVIGHVDSGKSTLIYKCGGIDKDKLKAERERGITIDIALWKFETPK-YQVTVIDAPGHRDFIKN
1g7cA           --HINVVVIGHVDSGKSTLIYKCGGIDKDKLKAERERGITIDIALWKFETPK-YQVTVIDAPGHRDFIKN
1f60A           --HINVVVIGHVDSGKSTLIYKCGGIDKDKLKAERERGITIDIALWKFETPK-YQVTVIDAPGHRDFIKN
2b7cA           --HINVVVIGHVDSGKSTLIYKCGGIDKDKLKAERERGITIDIALWKFETPK-YQVTVIDAPGHRDFIKN
1s0uA           -----IGMVGHVDHGKTSLTKALTGVWTDR-------GISIRLGYADCEIRKCPQCGFVDSPGHETLMAT
2ahoA           -----IGVVGHVDHGKTTLVQAITGIWTS--------GMTIKLGYAETNIPSCKSCGFIDAPGHEVLMAT
3cw2B           -----IGVVGHVDHGKTTLVQAITGIWTSTIKAETNIGVSCKKPEAYVTEPSCKSCGFIDAPGHEVLMAT
1skqA           --HLNLIVIGHVDHGKSTLVGRLL-MDRDRLKEE-------------MRFETKKYFTIIDAPGHRDFVKN
1jnyA           --HLNLIVIGHVDHGKSTLVGRLL-MDRDRLKEE-------------MRFETKKYFTIIDAPGHRDFVKN
1jnyB           --HLNLIVIGHVDHGKSTLVGRLL-MDRGFIDXXXXXXXXXXXXFARMRFETKKYFTIIDAPGHRDFVKN
2qn6A           -----IGVVGHVDHGKTTLVQAITGIWTLGYAETNI-GVSCKKPEAYVTEPSCKSCGFIDAPGHEVLMAT
1wsuB           ----------------------------------------------------------------------
1wsuA           ----------------------------------------------------------------------
1wsuD           ----------------------------------------------------------------------
1xb2A           --HVNVGTIGHVDHGXXXXXXXXXXXXXEHVEYST----------------AARHYAHTDCPGHADYVKN
1zunB           -------TCGNVDDGKSTLIGRLLHDDDLALLVDGLQAITIDVAYRYFSTAKRKFI-IADTPGHEQYTRN
2bvnA           --HVNVGTIGHVDHGXXXXXXXXXXXXXXXYGGEKARGITINTSHVEYDTPTRHYAH-VDCPGHADYVKN
1ob2A           --HVNVGTIGHVDHGXXXXXXXXXXXQIDNAPEEKARGITINTSHVEYDTPTRHYAH-VDCPGHADYVKN
2fx3A           --HVNVGTIGHVDHGXXXXXXXXXXXQIDNAPEEKARGITINTSHVEYDTPTRHYAH-VDCPGHADYVKN
3fihZ           --HVNVGTIGHVDHGXXXXXXXXXXXQIDNAPEEKARGITINTSHVEYDTPTRHYAH-VDCPGHADYVKN
1efcA           --HVNVGTIGHVDHGXXXXXXXXXXXQIDNAPEEKARGITINTSHVEYDTPTRHYAH-VDCPGHADYVKN
1dg1G           --HVNVGTIGHVDHGXXXXXXXXXXXQIDNAPEEKARGITINTSHVEYDTPTRHYAH-VDCPGHADYVKN
1d8tB           --HVNVGTIGHVDHGXXXXXXXXXXXQIDNAPEEKARGITINTSHVEYDTPTRHYAH-VDCPGHADYVKN
1d8tA           --HVNVGTIGHVDHGXXXXXXXXXXXQIDNAPEEKARGITINTSHVEYDTPTRHYAH-VDCPGHADYVKN
2bvnB           --HVNVGTIGHVDHGXXXXXXXXXXXXXXXYGA---RGITINTSHVEYDTPTRHYAH-VDCPGHADYVKN
1etuA           --HVNVGTIGHVDHGXXXXXXXXXXXXXXXY------GITINTSHVEYDTPTRHYAH-VDCPGHADYVKN
2v9vA           ----------------------------------------------------------------------
1zo1I           ----VVTIMGHVDHGKTSLLEYIR---STKVASGEAGGITQHIGAYHVETENG-MITFLDTPGHAAFTSM
1wsuC           ----------------------------------------------------------------------
1efuA           --HVNVGTIGHVDHGXXXXXXXXXXXXXXXYGGTSH---------VEYDTPTRHYAH-VDCPGHADYVKN
2hdnB           -------------------------------------GITINTSHVEYDTPTRHYAH-VDCPGHADYVKN
1g7tA           ----IVSVLGHVDHGKTTLLDHIRGSAVASRITQHIGATEIPMDVIELKKFSIRETFFIDTPGHEAFTTL
1g7sA           ----IVSVLGHVDHGKTTLLDHIRGSAVASRITQHIGATEIPMDVIELKKFSIRETFFIDTPGHEAFTTL
2elfA           ----------------------------------------------------------VDAHSYPKTLKS
2hcjB           -------------------------------------GITINTSHVEYDTPTRHYAHVD--PGHADYVKN
3degC           ----------HIDHGKSTLIIQICGGLSDREMEERERGITIKAQSVTLKASDGEQLNFIDTPGHVDFSYE
2e1rA           ----------HVDHGKSTLTDSLV-QRAGIISAAKERGITIEMSDEDVKEIKQKTDGLIDSPGHVDFSSE
1r5bA           -EHVNIVFIGHVDAGKSTLILFLTGMVDKRTMEKIEREAKERAYFET----EHRRFSLLDAPGASQADIG
1r5nA           -EHVNIVFIGHVDAGKSTLILFLTGMVDKRTMEKIEREATEHRRFSLLDAPGASQADI------------
3i92A           MKKLTIGLIGNPNSGKTTLFNQLTG---SRQRVGNWAGVTVERKEGQFS-TTDHQVTLVDLPGTYSLTQT
3i8sA           MKKLTIGLIGNPNSGKTTLFNQLTG---SRQRVGNWAGVTVERKEGQFS-TTDHQVTLVDLPGTYSLTTT
3hyrA           -KKLTIGLIGNPNSGKTTLFNQLTG---SRQRVGNWAGVTVERKEGQFS-TTDHQVTLVDLPGDEQIACH
3i8xA           MKKLTIGLIGNPNSGKTTLFNQLTG---SRQRVGNWAGVTVERKEGQFS-TTDHQVTLVDLPGDEQIACH
3i8sB           MKKLTIGLIGNPNSGKTTLFNQLTG---SRQRVGNWAGVTVERKEGQFS-TTDHQVTLVDLPGSQTSLDE
1zm4A           ----------HVDHGKSTLTDSLVGIISAGITI-KSTAISLEMSDEDVKEIKQKTDGLIDSPGHVDFSSE
2ywfA           ----------HVDHGKSTL--------ADRLLEYTGAGITVKMQFYKAKDGNTYKLHLIDTPGHVDFSYE
1u2rA           ----------HVDHGKSTLTDSLVGIISAGITI-KSTAISLEMSDEDVKEIKQKTDGLIDSPGHVDFSSE
2pjpA           ----------------------------------------------------------------------
2p8xT           ----------HVDHGKSTLTDSLVGIISAGITI-KSTAISLEMSDEDVKEIKQKTDGLIDSPGHVDFSSE
2p8wT           ----------HVDHGKSTLTDSLVGIISAGITI-KSTAISLEMSDEDVKEIKQKTDGLIDSPGHVDFSSE
2npfA           ----------HVDHGKSTLTDSLVGIISAGITI-KSTAISLEMSDEDVKEIKQKTDGLIDSPGHVDFSSE
1n0vC           ----------HVDHGKSTLTDSLVQISAAKGITIKSTAISLEMSDEDVKEIKQKTDGLIDSPGHVDFSSE
1n0uA           ----------HVDHGKSTLTDSLVGIISAGITI-KSTAISLEMSDEDVKEIKQKTDGLIDSPGHVDFSSE
2ywgA           ----------HVDHGKSTL--------ADRLLEYTG-AVKQAVRFYKAKDGNTYKLHLIDTPGHVDFSYE
1u0lA           --------------------------------------------------PDETGSGVIENVLHRK---N
2h5eB           ---------------------------------------------------------LLDTPGHEDFSED
2h5eA           ---------------------------------------------------------LLDTPGHEDFSED
3i92C           -KKLTIGLIGNPNSGKTTLFNQLTG---SRQRVGNWAGVTVERKEGQFS-TTDHQVTLVDLPGSQTSLDE
3i92B           -KKLTIGLIGNPNSGKTTLFNQLTG---SRQRVGNWAGVTVERKEGQFS-TTDHQVTLVDLPGSQTSLDE
3hytC           -KKLTIGLIGNPNSGKTTLFNQLTG---SRQRVRKEGQFS----------TTDHQVTLVDLPGTEQIACH
3cb4D           ------------------------------------------------------QLNFIDTPGHVDFSYE
2bv3A           -----IGIAAHIDAGKTTTTERILYY-TGRIHK---RGITITAAVTTC-FWKDHRINIIDAPGHVDFTIE
2ywhA           ----------HVDHGKSTLADRLLEY-TGAVKMQAVRM------FYKAKDGNTYKLHLIDTPGHVDFSYE


                         .         .         *         .         .         .         .:140
query           MLAGVGGIDLVLLVIAADEGVMPQTKEHVDIIQLLQVKKGIVVLTKIDMVDEEWLSLVTEEIREYLKDTV
1wb1C           VVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPI-IVVITKSDNAGTEEIKRTEMIMKSILQSTH
1tuiA           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDELLDLVEMEVRDLLNQYE
1ob5A           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDELLDLVEMEVRDLLNQYE
1eftA           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDELLDLVEMEVRDLLNQYE
1b23P           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDELLDLVEMEVRDLLNQYE
1exmA           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDELLDLVEMEVRDLLNQYE
2c78A           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDELLDLVEMEVRDLLNQYE
2c77A           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDELLDLVEMEVRDLLNQYE
1lvaA           ----------------------------------------------------------------------
1wb1B           VVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPI-IVVITKSDNAGTEEIKRTEMIMKSILQSTH
1wb3B           VVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPI-IVVITKSDNAGTEEIKRTEMIMKSILQSTH
2uwmB           ----------------------------------------------------------------------
1ha3A           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDELLDLVEMEVRDLLNQYE
2uwmA           ----------------------------------------------------------------------
3ficZ           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDELLDLVEMEVRDLLNQYE
1aipE           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDELLDLVEMEVRDLLNQYE
1ha3B           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDELLDLVEMEVRDLLNQYE
1aipA           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDELLDLVEMEVRDLLNQYE
2plyB           ----------------------------------------------------------------------
2plyA           ----------------------------------------------------------------------
1wb3A           VVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPI-IVVITKSDNAGTEEIKRTEMIMKSILQSTH
1mj1A           MITGAAQMDGAILVVSAADGRMRQTREHILLARQVGVRYIVVFMNKVDMVDDELLDLVEMEVRDLLRGSA
1wb2A           VVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPI-IVVITKSDNAGTEEIKRTEMIMKSILQSTH
1wb1A           VVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPI-IVVITKSDNAGTEEIKRTEMIMKSILQSTH
2dcuA           MLAGASLMDGAILVIAANEPCRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTV
1kjzA           MLAGASLMDGAILVIAANEPCRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTV
1kk1A           MLAGASLMDGAILVIAANEPCRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTV
1kk2A           MLAGASLMDGAILVIAANEPCRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTV
2d74A           MLAGASLMDGAILVIAANEPCRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTV
1kk3A           MLAGASLMDGAILVIAANEPCRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTV
1d2eA           MITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQDSXXXXXXXXXXXXXXXXF
2plfA           MLSGAALMDGAILVVAANEPFQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTW
1wb1D           VVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPI-IVVITKSDNAGTEEIKRTEMIMKSILQSTH
1kk0A           TLAGAS-LDGAILVIAANEPCRPQTREHL-ALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTV
1ijeA           MITGTSQADCAILIIAGGVGEFEQTREHALLAFTLGVRQLIVAVNKMDSVDESRFQEIVKETSNFIKKVG
1g7cA           MITGTSQADCAILIIAGGVGEFEQTREHALLAFTLGVRQLIVAVNKMDSVDESRFQEIVKETSNFIKKVG
1f60A           MITGTSQADCAILIIAGGVGEFEQTREHALLAFTLGVRQLIVAVNKMDSVDESRFQEIVKETSNFIKKVG
2b7cA           MITGTSQADCAILIIAGGVGEFEQTREHALLAFTLGVRQLIVAVNKMDSVDESRFQEIVKETSNFIKKVG
1s0uA           MLSGASLMDGAILVIAANEPCQPQTKEHLMALEILGIDKIIIVQNKIDLVDEKQAEENYEQIKEFVKGT-
2ahoA           MLSGAALMDGAILVVAANEPFQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTW
3cw2B           MLSGAALMDGAILVVAANEPFQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTW
1skqA           MITGASQADAAILVVSAKKGVEGQTREHIILAKTMGLDQLIVAVNKMDLTDEKRYKEIVDQVSKFMRSYG
1jnyA           MITGASQADAAILVVSAKKGVEGQTREHIILAKTMGLDQLIVAVNKMDLTDEKRYKEIVDQVSKFMRSYG
1jnyB           MITGASQADAAILVVSAKKGVEGQTREHIILAKTMGLDQLIVAVNKMDLTDEKRYKEIVDQVSKFMRSYG
2qn6A           MLSGAALMDGAILVVAANEPFQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTW
1wsuB           ----------------------------------------------------------------------
1wsuA           ----------------------------------------------------------------------
1wsuD           ----------------------------------------------------------------------
1xb2A           -ITGTAPLDGCILVVAANDGP-PQTREHLLLARQIGVEHVVVYVNKADAVQDSXXXXXXXXXXXXXXXFG
1zunB           A-TGASTCDLAIILVDARYGVQTQTRRHSYIASLLGIKHIVVAINKLNGFDER----VFESIKDYLKPSA
2bvnA           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK------------------------
1ob2A           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK------------------------
2fx3A           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK------------------------
3fihZ           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK------------------------
1efcA           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK------------------------
1dg1G           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK------------------------
1d8tB           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK------------------------
1d8tA           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK------------------------
2bvnB           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK------------------------
1etuA           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK------------------------
2v9vA           ----------------------------------------------------------------------
1zo1I           RARGAQATDIVVLVVAADDGVMPQTIEAIQ-HXXXXXXXXXXXXNKIDKPEAD-PDRVKNELSQYLPEEW
1wsuC           ----------------------------------------------------------------------
1efuA           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK------------------------
2hdnB           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK------------------------
1g7tA           RKRGGALADLAILIVDINEGFKPQTQEALNILRMYRTKQDIQVQQKLDTKVYELVGKLHEEGFESERDRV
1g7sA           RKRGGALADLAILIVDINEGFKPQTQEALNILRMYRTKQDIQVQQKLDTKVYELVGKLHEEGFESERDRV
2elfA           LITALNISDIAVLCIPP-QGLDAHTGECIIALDLLGFKHGIIALTRSDSTHHA-IDELKAKLKVITSGTV
2hcjB           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK------------------------
3degC           VSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEV-VPVLNKIDLPAAD-----PERVAEEIEDIV
2e1rA           VTAALRVTDGALVVVDTIEGVCVQT-ETVLRQALGERIKPVVVINKVDRALLE-LQVSKEDLYQTFARTV
1r5bA           VLV----ISXXXXXXXXXXXXXXQTREHAVLARTQGINHLVVVINKMDEPSVQWLSMFLRRVAGYNSKT-
1r5nA           ---GVLVISXXXXXXXXXXXXXXQTREHAVLARTQGINHLVVVINKMDEPSVQWLSMFLRRVAGYNSKT-
3i92A           SLDESGDADLLINVVDASN----LERNLYLTLQLLELGPCIVALNMLDIAEKQNIRIEIDALSARL----
3i8sA           SLDESGDADLLINVVDASN----LERNLYLTLQLLELGPCIVALNMLDIAEKQNIRIEIDALSARL----
3hyrA           YILS-GDADLLINVVDASN----LERNLYLTLQLLELGIPCIVALNLDIAEKQNIRIEIDALSARL----
3i8xA           YILS-GDADLLINVVDASN----LERNLYLTLQLLELGPCIVALNMLDIAEKQNIRIEIDALSARL----
3i8sB           QIACSGDADLLINVVDASN----LERNLYLTLQLLELGPCIVALNMLDIAEKQNIRIEIDALSARL----
1zm4A           VTAALRVTDGALVVVDTIEGVCVQT-ETVLRQALGERIKPVVVINKVDRALLE-LQVSKEDLYQTFARTV
2ywfA           VSRALAACEGALLLIDASQGIEAQTVANF----WKAVEQDLVIIPVINKID-------------------
1u2rA           VTAALRVTDGALVVVDTIEGVCVQT-ETVLRQALGERIKPVVVINKVDRALLE-LQVSKEDLYQTFARTV
2pjpA           ----------------------------------------------------------------------
2p8xT           VTAALRVTDGALVVVDTIEGVCVQT-ETVLRQALGERIKPVVVINKVDRALLE-LQVSKEDLYQTFARTV
2p8wT           VTAALRVTDGALVVVDTIEGVCVQT-ETVLRQALGERIKPVVVINKVDRALLE-LQVSKEDLYQTFARTV
2npfA           VTAALRVTDGALVVVDTIEGVCVQT-ETVLRQALGERIKPVVVINKVDRALLE-LQVSKEDLYQTFARTV
1n0vC           VTAALRVTDGALVVVDTIEGVCVQT-ETVLRQALGERIKPVVVINKVDRALLE-LQVSKEDLYQTFARTV
1n0uA           VTAALRVTDGALVVVDTIEGVCVQT-ETVLRQALGERIKPVVVINKVDRALLE-LQVSKEDLYQTFARTV
2ywgA           VSRALAACEGALLLIDASQGIEAQTVANF----WKAVEQDLVIIPVINKID-------------------
1u0lA           LLTKVANVDQVILVVTVK---MPETSTYIIDKFLVLAEKNVMVINKMDLYDEDDLRKVRE-----LEEIY
2h5eB           TYRTLTAVDCCLMVIDAAKGVEDRTRKLMEVTRL----RDTPILTFMNKLDRD-----------------
2h5eA           TYRTLTAVDCCLMVIDAAKGVEDRTRKLMEVTRL----RDTPILTFMNKLDRD-----------------
3i92C           QIACSGDADLLINVVDASN----LERNLYLTLQLLELGPCIVALNMLDIAEKQNIRIEIDALSARL----
3i92B           QIACSGDADLLINVVDASN----LERNLYLTLQLLELGPCIVALNMLDIAEKQNIRIEIDALSARL----
3hytC           YILS-GDADLLINVVDASN----LERNLYLTLQLLELGPCIVALNMLDIAEKQNIRIEIDALSARL----
3cb4D           VSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEV-VPVLNKIDLPAAD-----PERVAEEIEDIV
2bv3A           VERSMRVLDGAIVVFDSSQGVEPQSE--------------------------------------------
2ywhA           VSRALAACEGALLLIDASQGIEAQTVANF----WKAVEQDLVIIPVINKID-------------------


                         +         .         .         .         .         *         .:210
query           LSEAPVVPVSSTTKQGIPQLLDLIDQFVDDTEERNSSGKLRLPIDRXXXXXXXXXXXXXXXXXXRVSTGD
1wb1C           LKNSSIIPISAKTGFGVDELKNLIITTLNNAEIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGD
1tuiA           FDEVPVIRGSAKTKRGIWELLDAIDEYI-PTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
1ob5A           FDEVPVIRGSAKTKRGIWELLDAIDEYI-PTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
1eftA           FDEVPVIRGSAKTKRGIWELLDAIDEYI-PTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
1b23P           FDEVPVIRGSAKTKRGIWELLDAIDEYI-PTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
1exmA           FDEVPVIRGSAKTRRGIWELLDAIDEYI-PTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
2c78A           FDEVPVIRGSAKTRRGIWELLDAIDEYI-PTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
2c77A           FDEVPVIRGSAKTRRGIWELLDAIDEYI-PTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
1lvaA           ----------------------------------------------------------------------
1wb1B           LKNSSIIPISAKTGFGVDELKNLIITTLNNAEIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGD
1wb3B           LKNSSIIPISAKTGFGVDELKNLIITTLNNAEIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGD
2uwmB           ----------------------------------------------------------------------
1ha3A           FDEVPVIRGSAKTRRGIWELLDAIDEYI-PTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
2uwmA           ----------------------------------------------------------------------
3ficZ           FDEVPVIRGSAKTRRGIWELLDAIDEYI-PTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
1aipE           FDEVPVIRGSAKTRRGIWELLDAIDEYI-PTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
1ha3B           FDEVPVIRGSAKTRRGIWELLDAIDEYI-PTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
1aipA           FDEVPVIRGSAKTRRGIWELLDAIDEYI-PTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
2plyB           ----------------------------------------------------------------------
2plyA           ----------------------------------------------------------------------
1wb3A           LKNSSIIPISAKTGFGVDELKNLIITTLNNAEIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGD
1mj1A           LLALEEMHKNRKTKRGIWELLDAIDEYI-RTRVRDVDKRFLMRVEDVFTITGRGTVATGRIERGKVKVGD
1wb2A           LKNSSIIPISAKTGFGVDELKNLIITTLNNAEIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGD
1wb1A           LKNSSIIPISAKTGFGVDELKNLIITTLNNAEIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGD
2dcuA           AENAPIIPISALHGANIDVLVKAIEEFI-PTPKRDSNKPPKMLVLRTPPEKLVGGVLDGSIVQGKLKVGD
1kjzA           AENAPIIPISALHGANIDVLVKAIEDFIPTPKDPNKPPKMLVSFDVNKPGKLVGGVLDGSIVQGKLKVGD
1kk1A           AENAPIIPISALHGANIDVLVKAIEDFIPTPKDPNKPPKMLVSFDVNKPGKLVGGVLDGSIVQGKLKVGD
1kk2A           AENAPIIPISALHGANIDVLVKAIEDFI-PTPKRDPNKPPKMLVLRVNKPGLVGGVLDGSIVQGKLKVGD
2d74A           AENAPIIPISALHGANIDVLVKAIEEFI-PTPKRDSNKPPKMLVLRTPPEKLVGGVLDGSIVQGKLKVGD
1kk3A           AENAPIIPISALHGANIDVLVKAIEDFI-PTPKRDPNKPPKMLVLRKPGEKLVGGVLGGSIVQGKLKVGD
1d2eA           GEETPIIVGSALCAKSVQKLLDAVDTYI-PVPTRDLEKPFLLPVESVYSIPGRGTVVTGTLERGILKKGD
2plfA           AENVPIIPVSALHKINIDSLIEGIEEYI------------------------------------------
1wb1D           LKNSSIIPISAKTGFGVDELKNLIITTLNNAEIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGD
1kk0A           AENAPIIPISALHGANIDVLVKAIEDFIPTPKDPNKPPKLVLRSFDVNKPXXXXXXXXXSIVQGKLKVGD
1ijeA           YNPVPFVPISGETKAGVVKLLEAIDAI--EQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGM
1g7cA           YNPVPFVPISGETKAGVVKLLEAIDAI--EQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGM
1f60A           YNPVPFVPISGETKAGVVKLLEAIDAI--EQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGM
2b7cA           YNPVPFVPISGETKAGVVKLLEAIDAI--EQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGM
1s0uA           ----------------------------------------------------------------------
2ahoA           AENVPIIPVSALHKINIDSLIEGIEEYI------------------------------------------
3cw2B           AENVPIIPVSALHKINIDSLIEGIEEYI------------------------------------------
1skqA           FNTNKVVPVVAPSGDNIPTLEEYLDQL--ELPPKPVDKPLRIPIQDVYSISGVGTVPVGRVESGVLKVGD
1jnyA           FNTNKVVPVVAPSGDNIPTLEEYLDQL--ELPPKPVDKPLRIPIQDVYSISGVGTVPVGRVESGVLKVGD
1jnyB           FNTNKVVPVVAPSGDNIPTLEEYLDQL--ELPPKPVDKPLRIPIQDVYSISGVGTVPVGRVESGVLKVGD
2qn6A           AENVPIIPVSALHKINIDSLIEGIEEYI-KTPYRDLSQKPVMLVIRIIQGLFKVDQEIKVLPGLRVEKQG
1wsuB           ----------------------------------------------------------------------
1wsuA           ----------------------------------------------------------------------
1wsuD           ----------------------------------------------------------------------
1xb2A           YEETPIIVGSALCAKSVQKLLDAVDTYI-PVPTRDLEKPFLLPVESVYSIPGRGTVVTGTLERGILKKGD
1zunB           LKGDNVVNKSERSPWYAGQSLEILET-VEIASDRNYTD-LRFPVQYVNRPNLNFRGFAGTLASGIVHKGD
2bvnA           ----------------------------------------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
1etuA           ----------------------------------------------------------------------
2v9vA           ----------------------------------------------------------------------
1zo1I           GGESQFVHVSAKAGTGIDELLDAI----------------------------------------------
1wsuC           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2hdnB           ----------------------------------------------------------------------
1g7tA           ASQVSIIPISAITGEGIPELLTML----------------------------------------------
1g7sA           ASQVSIIPISAITGEGIPELLTML----------------------------------------------
2elfA           LQDWECISLNTNKSEGVDELKARINEVAEKIEAENASLPARIFIDHAFNVTCVVLGVVKQGIS---KDKD
2hcjB           ----------------------------------------------------------------------
3degC           IDATDAVRCSAKTGVGVQDVLE------------------------------------------------
2e1rA           ESVNVIV---------------------------------------------------------------
1r5bA           --DVKYMPVSAYTGQNVPSLLEYLDSMTH--LERKVNAPFIMPI--ASKYKDLGTILEGKIEAGSIKKNS
1r5nA           --DVKYMPVSAYTGQNVPSLLEYLDSMTH--LERKVNAPFIMPI--ASKYKDLGTILEGKIEAGSIKKNS
3i92A           --GCPVIPLVSTRGRGIEALKLAIDRY-------------------------------------------
3i8sA           --GCPVIPLVSTRGRGIEALKLAIDRY-------------------------------------------
3hyrA           --GCPVIPLVSTRGRGIEALKLAIDRY-------------------------------------------
3i8xA           --GCPVIPLVSTRGRGIEALKLAIDRY-------------------------------------------
3i8sB           --GCPVIPLVSTRGRGIEALKLAIDRY-------------------------------------------
1zm4A           ESVNVIV---------------------------------------------------------------
2ywfA           ----------------------------------------------------------------------
1u2rA           ESVNVIV---------------------------------------------------------------
2pjpA           ----------------------------------------------------------------------
2p8xT           ESVNVIV---------------------------------------------------------------
2p8wT           ESVNVIV---------------------------------------------------------------
2npfA           ESVNVIV---------------------------------------------------------------
1n0vC           ESVNVIV---------------------------------------------------------------
1n0uA           ESVNVIV---------------------------------------------------------------
2ywgA           ----------------------------------------------------------------------
1u0lA           SGLYPIVKTSAKTGMGIEELKEYLKGKISTMAGLSGVGKSSL----------------------------
2h5eB           ----------------------------------------------------------------------
2h5eA           ----------------------------------------------------------------------
3i92C           --GCPVIPLVSTRGRGIEALKLAIDRY-------------------------------------------
3i92B           --GCPVIPLVSTRGRGIEALKLAIDRY-------------------------------------------
3hytC           --GCPVIPLVSTRGRGIEALKLAIDRY-------------------------------------------
3cb4D           IDATDAVRCSAKTGVGVQDVLE------------------------------------------------
2bv3A           ----------------------------------------------------------------------
2ywhA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TVEIMPLGTVSRVRSIQVHGKKVEQARAGQRTAVNIIGVEVEEVKRGSVLVTPNSVEPSHRMDVKFLLLE
1wb1C           ELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISD
1tuiA           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVERGQVLAKPGSITPHTKFEASVYILK
1ob5A           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVERGQVLAKPGSITPHTKFEASVYILK
1eftA           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLK
1b23P           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVERGQVLAKPGSITPHTKFEASVYILK
1exmA           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLK
2c78A           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLK
2c77A           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLK
1lvaA           ----------------------------------------------------------------------
1wb1B           ELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISD
1wb3B           ELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISD
2uwmB           ----------------------------------------------------------------------
1ha3A           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLK
2uwmA           ----------------------------------------------------------------------
3ficZ           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLK
1aipE           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLK
1ha3B           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLK
1aipA           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLK
2plyB           ----------------------------------------------------------------------
2plyA           ----------------------------------------------------------------------
1wb3A           ELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISD
1mj1A           EVEIVGLARETRVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVERGQVLAKRGSITRHTKFEASVYILK
1wb2A           ELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISD
1wb1A           ELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISD
2dcuA           EIEIRPEPITTEIVSLQAGGQFVEEAYPGGLVG---IGTKLDDLMAGNVVGKPGKLPPVWTDXXXXXXXE
1kjzA           EIEIRPEPITTEIVSLQAGGQFVEEAYPG-----GLVGVGTKDLMAGNVVGKPGKLPPVWDSXXXXXXXE
1kk1A           EIEIRPEPITTEIVSLQAGGQFVEEAYPG-----GLVGVGTKDLMAGNVVGKPGKLPPXXXXXXXXXXXX
1kk2A           EIEIRPEPITTEIVSLQAGGQFVEEAYPG-----GLVGVGTKDLMAGNVVGKPGKLPPXXXXXXXXXXXX
2d74A           EIEIRPEPITTEIVSLQAGGQFVEEAYPGGLVG---IGTKLDDLMAGNVVGKPGKLPPVWTDXXXXXXXE
1kk3A           EIEIRPEPITTEIVSLQAGGQFVEEAYPG-----GLVGVGTKDLMAGNVVGKPGKLPPXXXXXXXXXXXX
1d2eA           ECEF--LGHSKNIRTIEMFHKSLDRAEAGDNLGALVRGLKREDLRRGLVMAKPGSIQPHQKVEAQVYILT
2plfA           ----------------------------------------------------------------------
1wb1D           ELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISD
1kk0A           EIEIRPEPITTEIVSLQAGGQFVEEAYPGGLVGV---GTKLDPYLAGNVVGKPGKLPPVWDSXXXXXXXE
1ijeA           VVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNV---------------------
1g7cA           VVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNV---------------------
1f60A           VVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNV---------------------
2b7cA           VVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNV---------------------
1s0uA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1skqA           KIVFMPAGKVGEVRSIETHHTKMDKAEPGDNIGFNVRGVEKKDIKRGDVVGHPNN---------------
1jnyA           KIVFMPAGKVGEVRSIETHHTKMDKAEPGDNIGFNVRGVEKKDIKRGDVVGHPNN---------------
1jnyB           KIVFMPAGKVGEVRSIETHHTKMDKAEPGDNIGFNVRGVEKKDIKRGDVVGHPNN---------------
2qn6A           KVSYEPIFT--KISSIRFGDEEFKEAKPGGLVAIGTYSLTKADNLLGSIITLADAEVPLWNIRIKYNLLE
1wsuB           ----------------------------------------------------------------------
1wsuA           ----------------------------------------------------------------------
1wsuD           ----------------------------------------------------------------------
1xb2A           ECEF--LGHSKNIRTIEFH-KSLDRAEAGDNLGALVRGLKREDLRRG-LVAKPGSIQPHQKVEAQVYILT
1zunB           EIVVLPSGKSSRVKSIVTFEGELEQAGPGQ--AVTLTEDEI-DISRGDLLVHADNVP---QVSDAFDALV
2bvnA           ----------STCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
1ob2A           ----------STCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
2fx3A           ----------STCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
3fihZ           ----------STCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
1efcA           ----------STCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
1dg1G           ----------STCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
1d8tB           ----------STCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
1d8tA           ----------STCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
2bvnB           ----------STCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
1etuA           ----------------------------------------------------------------------
2v9vA           ----------------------------------------------------------------------
1zo1I           ----------------------------------------------------------------------
1wsuC           ----------------------------------------------------------------------
1efuA           ----------STCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
2hdnB           ----------STCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
1g7tA           ----------------------------------------------------------------------
1g7sA           ----------------------------------------------------------------------
2elfA           KTKIFPLDRDIEIRSIQSHDVDIDSAPAGTRVG-RLKNVQAKDIERGFIISDKEIVTTDYTLE---CTVS
2hcjB           ----------STCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
3degC           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
1r5bA           NVLVMPINQTLEVTAIYDEAEEISSSICGDQVRLRVRG-DDSDVQTGYVLTTKNPVHATTRFIAQIAILE
1r5nA           NVLVMPINQTLEVTAIYDEAEEISSSICGDQVRLRVRG-DDSDVQTGYVLTTKNPVHATTRFIAQIAILE
3i92A           ----------------------------------------------------------------------
3i8sA           ----------------------------------------------------------------------
3hyrA           ----------------------------------------------------------------------
3i8xA           ----------------------------------------------------------------------
3i8sB           ----------------------------------------------------------------------
1zm4A           ----------------------------------------------------------------------
2ywfA           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2pjpA           ----------------------------------------------------------------------
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
2ywgA           ----------------------------------------------------------------------
1u0lA           ----------------------------------------------------------------------
2h5eB           ----------------------------------------------------------------------
2h5eA           ----------------------------------------------------------------------
3i92C           ----------------------------------------------------------------------
3i92B           ----------------------------------------------------------------------
3hytC           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
2ywhA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SAEKPLKNRARVRLYLGTDEILGRVRLLDREEIEPNQEAYVQLELEERGIAGKGDRFVIRSYSPMRTIGG
1wb1C           IFKYNLTPKMKVHLNVGKKVTFGKTNIILNEVISGNEYAF---ELEEKVLAEVGDRVLIRLDLPPTTIGH
1tuiA           KEETGFFTGYRPQFYFRTTDVTGVVRLPQGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
1ob5A           KEETGFFTGYRPQFYFRTTDVTGVVRLPQGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
1eftA           KEETGFFSGYRPQFYFRTTDVTGVVRLPQGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
1b23P           KEETGFFTGYRPQFYFRTTDVTGVVRLPQGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
1exmA           KEETGFFSGYRPQFYFRTTDVTGVVQLPPGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
2c78A           KEETGFFSGYRPQFYFRTTDVTGVVQLPPGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
2c77A           KEETGFFSGYRPQFYFRTTDVTGVVQLPPGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
1lvaA           ----------------------------------------------------------------------
1wb1B           IFKYNLTPKMKVHLNVGKKVTFGKTNIILNEVISGNEYAF---ELEEKVLAEVGDRVLIRLDLPPTTIGH
1wb3B           IFKYNLTPKMKVHLNVGKKVTFGKTNIILNEVISGNEYAF---ELEEKVLAEVGDRVLIRLDLPPTTIGH
2uwmB           ----------------------------------------------------------------------
1ha3A           KEETGFFSGYRPQFYFRTTDVTGVVQLPPGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
2uwmA           ----------------------------------------------------------------------
3ficZ           KEETGFFSGYRPQFYFRTTDVTGVVQLPPGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
1aipE           KEETGFFSGYRPQFYFRTTDVTGVVQLPPGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
1ha3B           KEETGFFSGYRPQFYFRTTDVTGVVQLPPGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
1aipA           KEETGFFSGYRPQFYFRTTDVTGVVQLPPGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
2plyB           ----------------------------------------------------------------------
2plyA           ----------------------------------------------------------------------
1wb3A           IFKYNLTPKMKVHLNVGKKVTFGKTNIILNEVISGNEYAF---ELEEKVLAEVGDRVLIRLDLPPTTIGH
1mj1A           KEETGFFTGYRRQFYFRTTDVTGVVRLRQGEMVMRGDNVTFTVELIKRVALEEGLRFAIREGG--RTVGA
1wb2A           IFKYNLTPKMKVHLNVGKKVTFGKTNIILNEVISGNEYAF---ELEEKVLAEVGDRVLIRLDLPPTTIGH
1wb1A           IFKYNLTPKMKVHLNVGKKVTFGKTNIILNEVISGNEYAF---ELEEKVLAEVGDRVLIRLDLPPTTIGH
2dcuA           LNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIE--------LKLQIPVCAEPGERVAISRQSRWRLIGY
1kjzA           LKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIE--------VKLQIPVCAEPGDRVAISRQSRWRLIGY
1kk1A           XKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIE--------VKLQIPVCAEPGDRVAISRQSRWRLIGY
1kk2A           XKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIE--------VKLQIPVCAEPGDRVAISRQSRWRLIGY
2d74A           LNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIE--------LKLQIPVCAEPGERVAISRQSRWRLIGY
1kk3A           XKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIE--------VKLQIPVCAEPGDRVAISRQSRWRLIGY
1d2eA           KEEKPFVSHFMPVMFSLTWDMACRIILPPGKELAPGEDLKLTLILRQPMILEKGQRFTLRDGN--RTIGT
2plfA           ----------------------------------------------------------------------
1wb1D           IFKYNLTPKMKVHLNVGM-LIVPAVAVPFKKENIINEYAF---ELEEKVLAEVGDRVLIRLDLPPTTIGH
1kk0A           LKVEPIKRKEVLLLNVGTAR-TGLVTGLGKDEIE--------VKLQIPVCAEPGDRVAISRQSRWRLIGY
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1s0uA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1skqA           ----------------------------------------------------------------------
1jnyA           ----------------------------------------------------------------------
1jnyB           ----------------------------------------------------------------------
2qn6A           RVVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIE------------------------------------
1wsuB           ----------------------------------------------------------------------
1wsuA           ----------------------------------------------------------------------
1wsuD           ----------------------------------------------------------------------
1xb2A           KEEKPFVSHFPV-FSLTWDAC--RIILPPGKELAPGEDLKLTLILRQ-PILEKGQRFTLRDGN--RTIGT
1zunB           WAEEPLPGK-KYDIKRATSYVPGSIHRVDVNTLEEGPASSLQLNEIGRVKVSLDAPIALDGYSSNRTTGA
2bvnA           KDETPFFKGYRPQFYFRTTDVTGTIELPEGEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
1ob2A           KDETPFFKGYRPQFYFRTTDVTGTIELPEGEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
2fx3A           KDETPFFKGYRPQFYFRTTDVTGTIELPEGEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
3fihZ           KDETPFFKGYRPQFYFRTTDVTGTIELPEGEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
1efcA           KDETPFFKGYRPQFYFRTTDVTGTIELPEGEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
1dg1G           KDETPFFKGYRPQFYFRTTDVTGTIELPEGEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
1d8tB           KDETPFFKGYRPQFYFRTTDVTGTIELPEGEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
1d8tA           KDETPFFKGYRPQFYFRTTDVTGTIELPEGEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
2bvnB           KDETPFFKGYRPQFYFRTTDVTGTIELPEGEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
1etuA           ----------------------------------------------------------------------
2v9vA           ----------------------------------------------------------------------
1zo1I           ----------------------------------------------------------------------
1wsuC           ----------------------------------------------------------------------
1efuA           KDETPFFKGYRPQFYFRTTDVTGTIELPEGEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
2hdnB           KDETPFFKGYRPQFYFRTTDVTGTIELPEGEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
1g7tA           ----------------------------------------------------------------------
1g7sA           ----------------------------------------------------------------------
2elfA           KFTKKIEPASVLHLFVGLQSEPVRVELVDGNEVEPGSTCVLELSGNKKLAYSKQDRFLL-----------
2hcjB           KDETPFFKGYRPQFYFRTTDVTGTIELPEGEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
3degC           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
1r5bA           ----------------------------------------------------------------------
1r5nA           ----------------------------------------------------------------------
3i92A           ----------------------------------------------------------------------
3i8sA           ----------------------------------------------------------------------
3hyrA           ----------------------------------------------------------------------
3i8xA           ----------------------------------------------------------------------
3i8sB           ----------------------------------------------------------------------
1zm4A           ----------------------------------------------------------------------
2ywfA           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2pjpA           ----------------------------------------------------------------------
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
2ywgA           ----------------------------------------------------------------------
1u0lA           ----------------------------------------------------------------------
2h5eB           ----------------------------------------------------------------------
2h5eA           ----------------------------------------------------------------------
3i92C           ----------------------------------------------------------------------
3i92B           ----------------------------------------------------------------------
3hytC           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
2ywhA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GVVIEPNAPKHKRYRSEVLEGLATKEKGTPEELVNQLLAGKQGLFSPEEIIEATGLAGDDLKISIEKLQS
1wb1C           GLIEEFKPIKDLNIKKEVLEGKVKIDKGTVIDGLAQSKVAAEKLIGEEISIEGKDIVG------------
1tuiA           GVV-------------------------------------------------------------------
1ob5A           GVV-------------------------------------------------------------------
1eftA           GVV-------------------------------------------------------------------
1b23P           GVV-------------------------------------------------------------------
1exmA           GVV-------------------------------------------------------------------
2c78A           GVV-------------------------------------------------------------------
2c77A           GVV-------------------------------------------------------------------
1lvaA           ---------------------------GSPEKILAQIIQEREGL----DWQEAATRASLSLEETRKLLQS
1wb1B           GLIEE-----------------------------------------------------------------
1wb3B           GLIEE-----------------------------------------------------------------
2uwmB           ----------------------------------------------------------------------
1ha3A           GVV-------------------------------------------------------------------
2uwmA           ----------------------------------------------------------------------
3ficZ           GVV-------------------------------------------------------------------
1aipE           GVV-------------------------------------------------------------------
1ha3B           GVV-------------------------------------------------------------------
1aipA           GVV-------------------------------------------------------------------
2plyB           ----------------------------------------------------------------------
2plyA           ----------------------------------------------------------------------
1wb3A           GLIEEFKPIKDLNIKKEVLEGKVKIDKGTVIDGLAQSKVAAEKLIGEEISIEGKDIVG------------
1mj1A           GVV-------------------------------------------------------------------
1wb2A           GLIEEFKPIKDLNIKKEVLEGKVKIDKGTVIDGLAQSKVAAEKLIGEEISIEGKDIVG------------
1wb1A           GLIEEFKPIKDLNIKKEVLEGKVKIDKGTVIDGLAQSKVAAEKLIGEEISIEGKDIVG------------
2dcuA           GIIKE-----------------------------------------------------------------
1kjzA           GIIKE-----------------------------------------------------------------
1kk1A           GIIKE-----------------------------------------------------------------
1kk2A           GIIKE-----------------------------------------------------------------
2d74A           GIIKE-----------------------------------------------------------------
1kk3A           GIIKE-----------------------------------------------------------------
1d2eA           GLVTDTPA--------------------------------------------------------------
2plfA           ----------------------------------------------------------------------
1wb1D           GLIEE-----------------------------------------------------------------
1kk0A           GIIKE-----------------------------------------------------------------
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1s0uA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1skqA           ----------------------------------------------------------------------
1jnyA           ----------------------------------------------------------------------
1jnyB           ----------------------------------------------------------------------
2qn6A           ----------------------------------------------------------------------
1wsuB           ----------------------------------------------------------------------
1wsuA           ----------------------------------------------------------------------
1wsuD           ----------------------------------------------------------------------
1xb2A           GLVTDTPATEEDK---------------------------------------------------------
1zunB           FIVID-----------------------------------------------------------------
2bvnA           GVV-------------------------------------------------------------------
1ob2A           GVV-------------------------------------------------------------------
2fx3A           GVV-------------------------------------------------------------------
3fihZ           GVV-------------------------------------------------------------------
1efcA           GVV-------------------------------------------------------------------
1dg1G           GVV-------------------------------------------------------------------
1d8tB           GVV-------------------------------------------------------------------
1d8tA           GVV-------------------------------------------------------------------
2bvnB           GVV-------------------------------------------------------------------
1etuA           ----------------------------------------------------------------------
2v9vA           ---------------------------GSPEKILAQIIQEHREGLDWQEAATRASLSLEETRKLLQSMAA
1zo1I           ----------------------------------------------------------------------
1wsuC           ----------------------------------------------------------------------
1efuA           GVV-------------------------------------------------------------------
2hdnB           GVV-------------------------------------------------------------------
1g7tA           ----------------------------------------------------------------------
1g7sA           ----------------------------------------------------------------------
2elfA           ----------------------------------------------------------------------
2hcjB           GVV-------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
1r5bA           ----------------------------------------------------------------------
1r5nA           ----------------------------------------------------------------------
3i92A           ----------------------------------------------------------------------
3i8sA           ----------------------------------------------------------------------
3hyrA           ----------------------------------------------------------------------
3i8xA           ----------------------------------------------------------------------
3i8sB           ----------------------------------------------------------------------
1zm4A           ----------------------------------------------------------------------
2ywfA           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2pjpA           ----------------------------------------------------------------------
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
2ywgA           ----------------------------------------------------------------------
1u0lA           ----------------------------------------------------------------------
2h5eB           ----------------------------------------------------------------------
2h5eA           ----------------------------------------------------------------------
3i92C           ----------------------------------------------------------------------
3i92B           ----------------------------------------------------------------------
3hytC           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
2ywhA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EQQVKCIPVDKKSLYIAQFTYNKWRQEIKSMVINYHREYPLREGYPKEELRSRKFPFINNKHFQYLLQAM
1wb1C           ----------------------------------------------------------------------
1tuiA           ----------------------------------------------------------------------
1ob5A           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1exmA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1lvaA           AAQVTLLRVENDLYAISTERYQAWWQAVTRALEEFHSRYPLRPGLAREELRSRYFSRLPARVYQALLEEW
1wb1B           ----------------------------------------------------------------------
1wb3B           ----------------------------------------------------------------------
2uwmB           --------------------YQAWWQAVTRALEEFHSRYPLRPGLAREELRSRYFSRLPARVYQALLEEW
1ha3A           ----------------------------------------------------------------------
2uwmA           -----------------------WWQAVTRALEEFHSRYPLRPGLAREELRSRYFSRLPARVYQALLEEW
3ficZ           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
1ha3B           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2plyB           --------------------YQAWWQAVTRALEEFHSRYPLRPGLAREELRSRYFSRLPARVYQALLEEW
2plyA           --------------------YQAWWQAVTRALEEFHSRYPLRPGLAREELRSRYFSRLPARVYQALLEEW
1wb3A           ----------------------------------------------------------------------
1mj1A           ----------------------------------------------------------------------
1wb2A           ----------------------------------------------------------------------
1wb1A           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
1kjzA           ----------------------------------------------------------------------
1kk1A           ----------------------------------------------------------------------
1kk2A           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
1kk3A           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
2plfA           ----------------------------------------------------------------------
1wb1D           ----------------------------------------------------------------------
1kk0A           ----------------------------------------------------------------------
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1s0uA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1skqA           ----------------------------------------------------------------------
1jnyA           ----------------------------------------------------------------------
1jnyB           ----------------------------------------------------------------------
2qn6A           ----------------------------------------------------------------------
1wsuB           ----------------------------------------------------------------------
1wsuA           ----------------------------------------------------------------------
1wsuD           ----------------------------------------------------------------------
1xb2A           ----------------------------------------------------------------------
1zunB           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
1etuA           ----------------------------------------------------------------------
2v9vA           AGQVTLLRVENDLYAISTERYQAWWQAVTRALEEFHSRYPLRPGLAREELRSRYFSRLPARVYQALLEEW
1zo1I           ----------------------------------------------------------------------
1wsuC           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2hdnB           ----------------------------------------------------------------------
1g7tA           ----------------------------------------------------------------------
1g7sA           ----------------------------------------------------------------------
2elfA           ----------------------------------------------------------------------
2hcjB           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
1r5bA           ----------------------------------------------------------------------
1r5nA           ----------------------------------------------------------------------
3i92A           ----------------------------------------------------------------------
3i8sA           ----------------------------------------------------------------------
3hyrA           ----------------------------------------------------------------------
3i8xA           ----------------------------------------------------------------------
3i8sB           ----------------------------------------------------------------------
1zm4A           ----------------------------------------------------------------------
2ywfA           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2pjpA           ----------------------------------------------------------------------
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
2ywgA           ----------------------------------------------------------------------
1u0lA           ----------------------------------------------------------------------
2h5eB           ----------------------------------------------------------------------
2h5eA           ----------------------------------------------------------------------
3i92C           ----------------------------------------------------------------------
3i92B           ----------------------------------------------------------------------
3hytC           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
2ywhA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EIDGLLKLHDKTLALAEFTGELSGSQQKLVQDMICAIQEGNFQPPSWVEVVKKFRLKDAESQEYLQYFLR
1wb1C           ----------------------------------------------------------------------
1tuiA           ----------------------------------------------------------------------
1ob5A           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1exmA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1lvaA           SREGRLQLAANTVALAGFTPSFSETQKKLLKDLEDKYRVSRWQPPSFKEVAGSFNLDPSELEELLHYLVR
1wb1B           ----------------------------------------------------------------------
1wb3B           ----------------------------------------------------------------------
2uwmB           SREGRLQLAANTVALAGFTPSFSETQKKLLKDLEDKYRVSRWQPPSFKEVAGSFNLDPSELEELLHYLVR
1ha3A           ----------------------------------------------------------------------
2uwmA           SREGRLQLAANTVALAGFTPSFSETQKKLLKDLEDKYRVSRWQPPSFKEVAGSFNLDPSELEELLHYLVR
3ficZ           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
1ha3B           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2plyB           SREGRLQLAANTVALAGFTPSFSETQKKLLKDLEDKYRVSRWQPPWVKEVAGSFNLDPSELEELLHYLVR
2plyA           SREGRLQLAANTVALAGFTPSFSETQKKLLKDLEDKYRVSRWQPPWVKEVAGSFNLDPSELEELLHYLVR
1wb3A           ----------------------------------------------------------------------
1mj1A           ----------------------------------------------------------------------
1wb2A           ----------------------------------------------------------------------
1wb1A           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
1kjzA           ----------------------------------------------------------------------
1kk1A           ----------------------------------------------------------------------
1kk2A           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
1kk3A           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
2plfA           ----------------------------------------------------------------------
1wb1D           ----------------------------------------------------------------------
1kk0A           ----------------------------------------------------------------------
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1s0uA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1skqA           ----------------------------------------------------------------------
1jnyA           ----------------------------------------------------------------------
1jnyB           ----------------------------------------------------------------------
2qn6A           ----------------------------------------------------------------------
1wsuB           ----------------------SETQKKLLKDLEDKYRVSRWQPPSFKEVAGSFNLDPSELEELLHYLVR
1wsuA           ----------------------SETQKKLLKDLEDKYRVSRWQPPSFKEVAGSFNLDPSELEELLHYLVR
1wsuD           ----------------------SETQKKLLKDLEDKYRVSRWQPPSFKEVAGSFNLDPSELEELLHYLVR
1xb2A           ----------------------------------------------------------------------
1zunB           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
1etuA           ----------------------------------------------------------------------
2v9vA           SREGRLQLAANTVALAGFT---------------------------------------------------
1zo1I           ----------------------------------------------------------------------
1wsuC           ---------------------------KLLKDLEDKYRVSRWQPPSFKEV----------AEELLHYLVR
1efuA           ----------------------------------------------------------------------
2hdnB           ----------------------------------------------------------------------
1g7tA           ----------------------------------------------------------------------
1g7sA           ----------------------------------------------------------------------
2elfA           ----------------------------------------------------------------------
2hcjB           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
1r5bA           ----------------------------------------------------------------------
1r5nA           ----------------------------------------------------------------------
3i92A           ----------------------------------------------------------------------
3i8sA           ----------------------------------------------------------------------
3hyrA           ----------------------------------------------------------------------
3i8xA           ----------------------------------------------------------------------
3i8sB           ----------------------------------------------------------------------
1zm4A           ----------------------------------------------------------------------
2ywfA           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2pjpA           --------------------------------------------PWWVRDLAKETGTDEQAMRLLRQAAQ
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
2ywgA           ----------------------------------------------------------------------
1u0lA           ----------------------------------------------------------------------
2h5eB           ----------------------------------------------------------------------
2h5eA           ----------------------------------------------------------------------
3i92C           ----------------------------------------------------------------------
3i92B           ----------------------------------------------------------------------
3hytC           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
2ywhA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           TGQLVKLSDDELYYTADRYQQAKTKIVEYLKENKEISVAQTRDLLKTSRKFTLPLLETMDRERLTRRVGD
1wb1C           ----------------------------------------------------------------------
1tuiA           ----------------------------------------------------------------------
1ob5A           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1exmA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1lvaA           EGVLVKI-NDEFYWHRQALGEAR-EVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGD
1wb1B           ----------------------------------------------------------------------
1wb3B           ----------------------------------------------------------------------
2uwmB           EGVLVKI-NDEFYWHRQALGEAR-EVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGD
1ha3A           ----------------------------------------------------------------------
2uwmA           EGVLVKI-NDEFYWHRQALGEAR-EVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGD
3ficZ           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
1ha3B           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2plyB           EGVLVKI-NDEFYWHRQALGEAR-EVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGD
2plyA           EGVLVKI-NDEFYWHRQALGEAR-EVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGD
1wb3A           ----------------------------------------------------------------------
1mj1A           ----------------------------------------------------------------------
1wb2A           ----------------------------------------------------------------------
1wb1A           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
1kjzA           ----------------------------------------------------------------------
1kk1A           ----------------------------------------------------------------------
1kk2A           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
1kk3A           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
2plfA           ----------------------------------------------------------------------
1wb1D           ----------------------------------------------------------------------
1kk0A           ----------------------------------------------------------------------
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1s0uA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1skqA           ----------------------------------------------------------------------
1jnyA           ----------------------------------------------------------------------
1jnyB           ----------------------------------------------------------------------
2qn6A           ----------------------------------------------------------------------
1wsuB           EGVLVKIND-EFYWHRQALGEAR-EVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGD
1wsuA           EGVLVKIND-EFYWHRQALGEAR-EVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGD
1wsuD           EGVLVKIND-EFYW----HRQALGEAREVIKNLAPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGD
1xb2A           ----------------------------------------------------------------------
1zunB           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
1etuA           ----------------------------------------------------------------------
2v9vA           ----------------------------------------------------------------------
1zo1I           ----------------------------------------------------------------------
1wsuC           EGVLVKIND-EFYWHRQALGEAR-EVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRK---
1efuA           ----------------------------------------------------------------------
2hdnB           ----------------------------------------------------------------------
1g7tA           ----------------------------------------------------------------------
1g7sA           ----------------------------------------------------------------------
2elfA           ----------------------------------------------------------------------
2hcjB           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
1r5bA           ----------------------------------------------------------------------
1r5nA           ----------------------------------------------------------------------
3i92A           ----------------------------------------------------------------------
3i8sA           ----------------------------------------------------------------------
3hyrA           ----------------------------------------------------------------------
3i8xA           ----------------------------------------------------------------------
3i8sB           ----------------------------------------------------------------------
1zm4A           ----------------------------------------------------------------------
2ywfA           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2pjpA           QGIITAIVKDR-YYRNDRIVEFANMIRDLDQECGSTCAADFRDRLGVGRKLAIQILEYFDRIGFTRRRGN
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
2ywgA           ----------------------------------------------------------------------
1u0lA           ----------------------------------------------------------------------
2h5eB           ----------------------------------------------------------------------
2h5eA           ----------------------------------------------------------------------
3i92C           ----------------------------------------------------------------------
3i92B           ----------------------------------------------------------------------
3hytC           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
2ywhA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           NRVLV
1wb1C           -----
1tuiA           -----
1ob5A           -----
1eftA           -----
1b23P           -----
1exmA           -----
2c78A           -----
2c77A           -----
1lvaA           KRVVV
1wb1B           -----
1wb3B           -----
2uwmB           KRVVV
1ha3A           -----
2uwmA           KRVVV
3ficZ           -----
1aipE           -----
1ha3B           -----
1aipA           -----
2plyB           KRVVV
2plyA           KRVVV
1wb3A           -----
1mj1A           -----
1wb2A           -----
1wb1A           -----
2dcuA           -----
1kjzA           -----
1kk1A           -----
1kk2A           -----
2d74A           -----
1kk3A           -----
1d2eA           -----
2plfA           -----
1wb1D           -----
1kk0A           -----
1ijeA           -----
1g7cA           -----
1f60A           -----
2b7cA           -----
1s0uA           -----
2ahoA           -----
3cw2B           -----
1skqA           -----
1jnyA           -----
1jnyB           -----
2qn6A           -----
1wsuB           KRVVV
1wsuA           KRVVV
1wsuD           KRVVV
1xb2A           -----
1zunB           -----
2bvnA           -----
1ob2A           -----
2fx3A           -----
3fihZ           -----
1efcA           -----
1dg1G           -----
1d8tB           -----
1d8tA           -----
2bvnB           -----
1etuA           -----
2v9vA           -----
1zo1I           -----
1wsuC           -----
1efuA           -----
2hdnB           -----
1g7tA           -----
1g7sA           -----
2elfA           -----
2hcjB           -----
3degC           -----
2e1rA           -----
1r5bA           -----
1r5nA           -----
3i92A           -----
3i8sA           -----
3hyrA           -----
3i8xA           -----
3i8sB           -----
1zm4A           -----
2ywfA           -----
1u2rA           -----
2pjpA           DHLL-
2p8xT           -----
2p8wT           -----
2npfA           -----
1n0vC           -----
1n0uA           -----
2ywgA           -----
1u0lA           -----
2h5eB           -----
2h5eA           -----
3i92C           -----
3i92B           -----
3hytC           -----
3cb4D           -----
2bv3A           -----
2ywhA           -----