[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO50753.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2lbpA.bssp"
#ERROR : Can't open dsspfile "1usgA.bssp"
#ERROR : Can't open dsspfile "3hutA.bssp"
#ERROR : Can't open dsspfile "2livA.bssp"
#ERROR : Can't open dsspfile "1z15A.bssp"
#ERROR : Can't open dsspfile "3h5lB.bssp"
#ERROR : Can't open dsspfile "3h5lA.bssp"
#ERROR : Can't open dsspfile "3i45A.bssp"
#ERROR : Can't open dsspfile "3i09A.bssp"

## Summary of PDB Search
:394
    1e-31  28%  2lbpA  [x.x.x] LEUCINE-BINDING PROTEIN
    2e-30  27%  1usgA  [c.93.1] LEUCINE-SPECIFIC BINDING PROTEIN
    9e-30  27%  3hutA  [x.x.x] PUTATIVE BRANCHED-CHAIN AMINO ACID ABC
    9e-27  28%  2livA  [x.x.x] LEUCINE
    1e-26  28%  1z15A  [x.x.x] LEU/ILE/VAL-BINDING PROTEIN
    5e-11  26%  3h5lB  [x.x.x] PUTATIVE BRANCHED-CHAIN AMINO ACID ABC
    2e-10  26%  3h5lA  [x.x.x] PUTATIVE BRANCHED-CHAIN AMINO ACID ABC
    1e-09  25%  3i45A  [x.x.x] TWIN-ARGININE TRANSLOCATION PATHWAY SIGNAL
    5e-04  21%  3i09A  [x.x.x] PERIPLASMIC BRANCHED-CHAIN AMINO ACID-BINDING
:394

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKAADANEIVIGGNLELSGPVATFGTAMKNGAEMYFEEVN
2lbpA           ----------------------------------DIKVAVVGA---MSGPIAQWGIMEFNGAEQAIKDIN
1usgA           ----------------------------------DIKVAVVGA---MSGPIAQWGDMEFNGARQAIKDIN
3hutA           --------------------------------------LLLGYELPLTGANAAYGRVFQEAARLQLDRFN
2livA           ----------------------------------DIKVAVVGA---MSGPVAQYGDQEFTGAEQAVADIN
1z15A           ----------------------------------DIKVAVVGA---MSGPVAQYGDQEFTGAEQAVADIN
3h5lB           -------------------------------QAQSSDPVVIGCPAPLTGIVAADGIEFQRGIQMAADEIN
3h5lA           --------------------------------------VVIGCPAPLTGIVAADGIEFQRGIQMAADEIN
3i45A           ------------------------------------------GEINSYSQIPAFTLPYRNGWQLAVEQIN
3i09A           ----------------------------------------------------------QGGLEAIKAVAD


                         .         .         *         .         .         .         .:140
query           AAGGVLGKKIKFNVMDNKSDATEAANVATRLITQDKVVAVMGAATSGNTMGFMQVATDNKVPIITPSGTA
2lbpA           AKGGIKGDKLVGVEYDDACDPKQAVAVANKIVN-DGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATA
1usgA           AKGGIKGDKLVGVEYDDACDPKQAVAVANKIVN-DGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATN
3hutA           AAGGVGGRPVDILYADSRDDADQARTIARAFVDDPRVVGVLGDFSS--TVSAAGSIYGKEGPQLSPT---
2livA           AKGGIKGNKLQIAKYDDACDPKQXXXXXXXXXX-DGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATA
1z15A           AKGGIKGNKLQIVKYDDACDPKQXXXXXXXXXX-DGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATA
3h5lB           AVGGILGRPIELVFADTQSKGVDVVQSAQRLIDRDNASALIAGYNLENGTALHDVAADAGVIAMHANTVA
3h5lA           AVGGILGRPIELVFADTQSKGVDVVQSAQRLIDRDNASALIAGYNLENGTALHDVAADAGVIAMHANTVA
3i45A           AAGGLLGRPLEVISRDDGGDPGKAVTAAQELLTRHGVHALAGTFLSHVGLAVSDFARQRKVLFM-----A
3i09A           FGGKVNGKPIEVVYADHQNKADIAASKA-REWDRGGLDLLVGGTNSATALS-NQVAAEKKKVYINIGAGA


                         +         .         .         .         .         *         .:210
query           LEVTVDPNTKKVRDYVFRTCFIDPFQGIVMANFATNDLKAKTAVLYVDNQSPYAKGLAQFFKDSFIKQGG
2lbpA           PELT-----QRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQ-YGEGLARSVQDGLKAANA
1usgA           PELT-----QRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQ-YGEGLARSVQDGLKAANA
3hutA           ---AAHPDYIKISPWQFRAITTPAFEGPNNAAWIGDGF---TSVAVIGVTTDWGLSSAQAFRKAFELRGG
2livA           PELTA-------RGYILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQ-YGEGLARAVQDGLKKGNA
1z15A           PELTA-------RGYILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQ-YGEGLARAVQDGLKKGNA
3h5lB           VH---DEMVKSDPDRYWGTFQYDPPETLYGGGFLLKDIRPNNKIAIITGPGIYSVNIANAIRDGAGEYGY
3h5lA           VH---DEMVKSDPDRYWGTFQYDPPETLYGGGFLLKDIRPNNKIAIITGPGIYSVNIANAIRDGAGEYGY
3i45A           SEPLTDALTEKGNRYTYRSTYMQXXXXXXXXXKLPITRWATIAPNYEYGQSAVAR-----FKELLLAARP
3i09A           DTLTNEQCTPYTVHYAYDTALAKGTGSAVVK-------QGGKTWFFLTADYAFGKALEKNTADVVKANGG


                         .         .         .         +         .         .         .:280
query           KIVGEEAFMPEDQDFKATLTKIKGLNPDVIYVPAYYEPVGKIVKQGREIGITVPFLGGDGWDSPKLPEIA
2lbpA           NVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIA
1usgA           NVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIA
3hutA           AVVVNEEVPPGNRRFDDVIDEIEDEAPQAIYLAA-YEDAAPFLRALRARGSALPVYGSSALYSPKFIDL-
2livA           NVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIA
1z15A           NVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIA
3h5lB           DVSLFETVAIPVSDWGPTLAKLRADPPAVIVVTHFY----------------------------------
3h5lA           DVSLFETVAIPVSDWGPTLAKLRADPPAVIVVTHFY----------------------------------
3i45A           EVVAEQWPALYKLDAGPTVQALQQAEPEGLFNVLFGADLPKFVREGRVRGLVVSMLTGE----PEYLNPL
3i09A           KVLGEVRHPLSASDFSSFLLQAQSSKAQILGLANAGGDTVNAIKAAKEFGITKTKLAALLFDVHALGETT


                         .         *         .         .         .         .         +:350
query           GGAALNNTYFSNHYSSQKDDPEIKGFVEKYQAKFGQVPDTFAALGYDTAVLLVDAIKRSEDASPEKIKEA
2lbpA           GDAAEGMLVTMPKRYDQ--DPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKD
1usgA           GDAAEGMLVTMPKRYDQ--DPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKD
3hutA           GGPAVEGVRLATAFVLGASDPVVVEFVSAYETLYGAIPTLFAAHGYDAVGILAAVGRAGPEVTRESLRDA
2livA           GESA--EGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDD--PAEIAKY
1z15A           GESA--EGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDD--PAEIAKY
3h5lB           ----------------------------------------------------------------------
3h5lA           ----------------------------------------------------------------------
3i45A           KDEAPEGWIVTGYPWYDIDTAPHRAFVEAYRARWKEDPFVGSLVGYNTLTAMAVAFEKAGGTESETLVET
3i09A           QGLVLTDSWYWNR------DQASRQWAQRYFAK--KKPSSLQAADYSSVTTYLKAVQAAGSTDSDKVAQL


                         .         .         .         .         *         .         .:420
query           LANAKDVQAITGKLSFDENHNPIKGAVILEMKDGKQVxxxxxxx
2lbpA           L-KANGANTVIGPLNWDE--------------------------
1usgA           L-KANGANTVIGPLNWDE--------------------------
3hutA           LAATDRYAGVTGITRFDETRETTKILTRLVVREG----------
2livA           L-KANSVDTVMGPLTWDE--------------------------
1z15A           L-KANSVDTVMGPLTWDE--------------------------
3h5lB           --------------------------------------------
3h5lA           --------------------------------------------
3i45A           L---KDMAFSTGPLSFASDHQSTMGAWVTALRDGKGV-------
3i09A           KKKIDDFYA-----------------------------------