[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO50877.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d54D.bssp"
#ERROR : Can't open dsspfile "1t3tA.bssp"
#ERROR : Can't open dsspfile "2vxoB.bssp"
#ERROR : Can't open dsspfile "2vxoA.bssp"
#ERROR : Can't open dsspfile "3efeF.bssp"
#ERROR : Can't open dsspfile "3efeD.bssp"
#ERROR : Can't open dsspfile "3efeC.bssp"
#ERROR : Can't open dsspfile "3efeB.bssp"
#ERROR : Can't open dsspfile "3efeA.bssp"

## Summary of PDB Search
:233
    2e-45  49%  3d54D  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE 1
    3e-15  38%  1t3tA  [d.284.1 - a.5.10 - d.79.4 - d.139.1 - d.79.4 - d.139.1 -
    4e-05  35%  2vxoB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    6e-05  39%  2vxoA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    8e-04  24%  3efeF  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    8e-04  24%  3efeD  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    8e-04  24%  3efeC  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    8e-04  24%  3efeB  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    8e-04  24%  3efeA  [x.x.x] THIJ/PFPI FAMILY PROTEIN
:233

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxVVVFPGSNCDADCLHAIKTVTGQPVDYIWHKSGSVDGYDCIVLPGGFSYGDYLRCGAVARFSPVMS
3d54D           ----VVVYPGSNCDRDAYHALE-INGFEPSYVG-LDDKLDDYELIILPGGFSYGDYLRPGAVXXXXXXXX
1t3tA           -----------------------------------------FHALVACGGFSYGDVLGAGEGWAKSILFN
2vxoB           ----------------------------------------GFRAIIISGGPN-------SVYAEDAPWFD
2vxoA           ----------------------------------------------------------------------
3efeF           -------------------------------------TLESKDLLILPGGTTWSEEIH-------QPILE
3efeD           -------------------------------------TLESKDLLILPGGTTWSEEIH-------QPILE
3efeC           -------------------------------------TLESKDLLILPGGTTWSEEIH-------QPILE
3efeB           -------------------------------------TLESKDLLILPGGTTWSEEIH-------QPILE
3efeA           -------------------------------------TLESKDLLILPGGTTWSEEIH-------QPILE


                         .         .         *         .         .         .         .:140
query           PVIEFARRGGLVLGICNGFQVLTEAGLLPGALHRNKNLSFLCHDTYLRVENDISPFTSLASRGSVIKVPI
3d54D           XXXXXXXXGKLIMGI-NGFQILIEMGLLKGALLQNSSGKFICKWVDLIVENNDTPFTNAFEKGEKIRIPI
1t3tA           HRVRFHRPQTLALGV-NGCQMMSNLRLIPGSFVRNHSDRFEARFSLVEVTQ--SPSLLLQGMGSQMPIAV
2vxoB           PAIFTI--GKPVLGICYGMQMMNK--VFGGTVHKKSDGVF-----NISVDNTCSLFRGLQKEEVVL---L
2vxoA           --------GKPVLGICYGMQMMNK--VFGGTVHKVFNIS---------VDNTCSLFRGLQKEEVVL---L
3efeF           RIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEY------------------------------
3efeD           RIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEY------------------------------
3efeC           RIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEY------------------------------
3efeB           RIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEY------------------------------
3efeA           RIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEY------------------------------


                         +         .         .         .         .         *         .:210
query           AHGEGNYFADSDTVRRLEENNQVVFRYCDYNGEITQGVNPNGSVNNIAGICNEQGNVLGMMPHPERCAEE
3d54D           AHGFGRYVKIDDV--------NVVLRYVK---------DVNGSDERIAGVLNESGNVFGLMPHPERAVEE
1t3tA           SHGEGRVEVRDDALAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTENGRVTIMMPHPER----
2vxoB           THG--------DSVDKVADGFKVVAR----------------SGNIVAGIANESKKLYGAQFHPEVGLTE
2vxoA           THG--------DSVDKVADGFKVVAR----------------SGNIVAGIANESKKLYGAQFHPEVGLTE
3efeF           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
3efeC           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
3efeA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ILGNIDGQLIFKSLLxxxxxxxx
3d54D           LIGGEDGKKVFQSIL--------
1t3tA           -----------------------
2vxoB           -----NGKVILKNFL--------
2vxoA           -----NGKVILKNFL--------
3efeF           -----------------------
3efeD           -----------------------
3efeC           -----------------------
3efeB           -----------------------
3efeA           -----------------------