[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO50885.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gpmA.bssp"
#ERROR : Can't open dsspfile "1gpmB.bssp"
#ERROR : Can't open dsspfile "2ywbC.bssp"
#ERROR : Can't open dsspfile "2ywbA.bssp"
#ERROR : Can't open dsspfile "2ywcD.bssp"
#ERROR : Can't open dsspfile "2ywbB.bssp"
#ERROR : Can't open dsspfile "2ywbD.bssp"
#ERROR : Can't open dsspfile "2ywcB.bssp"
#ERROR : Can't open dsspfile "2ywcA.bssp"
#ERROR : Can't open dsspfile "2vxoB.bssp"
#ERROR : Can't open dsspfile "2dplA.bssp"
#ERROR : Can't open dsspfile "3a4iA.bssp"
#ERROR : Can't open dsspfile "2z0cA.bssp"
#ERROR : Can't open dsspfile "2dplB.bssp"
#ERROR : Can't open dsspfile "2z0cB.bssp"
#ERROR : Can't open dsspfile "2vxoA.bssp"
#ERROR : Can't open dsspfile "2d7jA.bssp"
#ERROR : Can't open dsspfile "1wl8A.bssp"
#ERROR : Can't open dsspfile "2vpiA.bssp"
#ERROR : Can't open dsspfile "2vpiB.bssp"
#ERROR : Can't open dsspfile "2a9vD.bssp"
#ERROR : Can't open dsspfile "2a9vC.bssp"
#ERROR : Can't open dsspfile "2a9vB.bssp"
#ERROR : Can't open dsspfile "2a9vA.bssp"
#ERROR : Can't open dsspfile "1t36B.bssp"
#ERROR : Can't open dsspfile "1jdbF.bssp"
#ERROR : Can't open dsspfile "1bxrB.bssp"
#ERROR : Can't open dsspfile "1m6vB.bssp"
#ERROR : Can't open dsspfile "1qdlB.bssp"
#ERROR : Can't open dsspfile "1c30B.bssp"
#ERROR : Can't open dsspfile "1cs0B.bssp"
#ERROR : Can't open dsspfile "1a9xB.bssp"
#ERROR : Can't open dsspfile "1i1qB.bssp"

## Summary of PDB Search
:513
    e-147  53%  1gpmA  [c.23.16 - c.26.2 - d.52.2] GMP SYNTHETASE
    e-147  53%  1gpmB  [c.23.16 - c.26.2 - d.52.2] GMP SYNTHETASE
    9e-99  44%  2ywbC  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    3e-98  43%  2ywbA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    1e-97  45%  2ywcD  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    2e-97  43%  2ywbB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    5e-97  43%  2ywbD  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    3e-91  43%  2ywcB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    3e-91  42%  2ywcA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    5e-84  41%  2vxoB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    6e-84  56%  2dplA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    8e-84  56%  3a4iA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    1e-82  56%  2z0cA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    4e-82  56%  2dplB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    5e-80  56%  2z0cB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    1e-76  41%  2vxoA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    4e-37  41%  2d7jA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    7e-37  42%  1wl8A  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    3e-35  42%  2vpiA  [x.x.x] GMP SYNTHASE
    1e-34  42%  2vpiB  [x.x.x] GMP SYNTHASE
    3e-18  27%  2a9vD  [x.x.x] GMP SYNTHASE
    3e-18  27%  2a9vC  [x.x.x] GMP SYNTHASE
    3e-18  27%  2a9vB  [x.x.x] GMP SYNTHASE
    3e-18  27%  2a9vA  [x.x.x] GMP SYNTHASE
    9e-09  31%  1t36B  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE SMALL CHAIN
    9e-09  31%  1jdbF  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE
    9e-09  31%  1bxrB  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE
    1e-08  32%  1m6vB  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHETASE SMALL CHAIN
    3e-08  26%  1qdlB  [c.23.16] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
    1e-07  31%  1c30B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
    2e-06  31%  1cs0B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
    2e-05  30%  1a9xB  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL
    3e-04  27%  1i1qB  [c.23.16] ANTHRANILATE SYNTHASE COMPONENT II
:513

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxELILVLDFGGQYTQLIARRIRDVNVYCEIEPHNVSIDKIKAKNPKGIIFSGGPSSVYGEKAPTV
1gpmA           --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
1gpmB           --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
2ywbC           -------MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRP
2ywbA           -------MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRP
2ywcD           --------VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRP
2ywbB           -------MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRP
2ywbD           -------MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRP
2ywcB           --------VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRP
2ywcA           --------VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRP
2vxoB           --------VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWF
2dplA           ----------------------------------------------------------------------
3a4iA           ----------------------------------------------------------------------
2z0cA           ----------------------------------------------------------------------
2dplB           ----------------------------------------------------------------------
2z0cB           ----------------------------------------------------------------------
2vxoA           --------VVILDAG--YGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGP-------APWF
2d7jA           -------MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKV
1wl8A           -------MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKV
2vpiA           --------VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISG---------APWF
2vpiB           --------VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISG----------PWF
2a9vD           --------IYVVDNGGQWTHREWRVLRELGVDTKIVPNXXXXXXXXXXXXXXXXXXAPNIDEELDKLGSV
2a9vC           --------IYVVDNGGQWTHREWRVLRELGVDTKIVPNXXXXXXXXXXXXXXXXXXAPNIDEELDKLGSV
2a9vB           --------IYVVDNGGQWTHREWRVLRELGVDTKIVPNXXXXXXXXXXXXXXXXXXAPNIDEELDKLGSV
2a9vA           --------IYVVDNGGQWTHREWRVLRELGVDTKIVPNXXXXXXXXXXXXXXXXXXAPNIDEELDKLGSV
1t36B           --------VVAYDFGAKRN--ILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGP----GDPAPTA
1jdbF           --------VVAYDFGAKRN--ILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGP----GDPAPTA
1bxrB           --------VVAYDFGAKRN--ILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGP----GDPAPTA
1m6vB           --------VVAYDFGAKRN--ILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGP----GDPAPTA
1qdlB           ------DLTLIIDNYDSFVYNIAQIVGELGSYIVIRNDEISIKGIERIDPDRLIISPGPGTPEKREDIGV
1c30B           --------VVAYDFGAKRN--ILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGP----GDPAPTA
1cs0B           --------VVAYDFGAKRN--ILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGP----GDPAPTA
1a9xB           --------VVAYDFGAKRN--ILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGP----GDPAPTA
1i1qB           --------ILLLDNIDSFTWNLADQLRNVVIYRNHIPAQTLIDRLATMKNPVLMLSPGPG------VPSE


                         .         .         *         .         .         .         .:140
query           DPAVYELDIPVLGICYGMQLMTQQLKGKVVPAEMREYGRTTLRVMQCDNILKNLTADEECWMSHGDRVEE
1gpmA           PQYVFEAGVPVFGVCYGMQTMAMQLGGHVEASNEREFGYAQVEVVNDSALVRGLTADGDVWMSHGDKVTA
1gpmB           PQYVFEAGVPVFGVCYGMQTMAMQLGGHVEASNEREFGYAQVEVVNDSALVRGLTADGDVWMSHGDKVTA
2ywbC           DPRLFSSGLPLLGICYGMQLLAQELGGRVE----RAYGKALLTRHE-GPLFRGLEGEVQVWMSHQDAVTA
2ywbA           DPRLFSSGLPLLGICYGMQLLAQELGGRV---ERAEYGKALLTRHE-GPLFRGLEGEVQVWMSHQDAVTA
2ywcD           DPRLFSSGLPLLGICYG-QLLAQELGGRVERAGRAEYGKALLTRHE-GPLFRGLEGEVQVW-SHQDAVTA
2ywbB           DPRLFSSGLPLLGICYGMQLLAQELGGRVE----RAYGKALLTRHE-GPLFRGLEGEVQVWMSHQDAVTA
2ywbD           DPRLFSSGLPLLGICYGMQLLAQELGGRV-----ERYGKALLTRHE-GPLFRGLEGEVQVWMSHQDAVTA
2ywcB           DPRLFSSGLPLLGICYG-QLLAQELGGRVERAGRAEYGKALLTRHE-GPLFRGLEGEVQVW-SHQDAVTA
2ywcA           DPRLFSSGLPLLGICYG-QLLAQELGGRVERAGRAEYGKALLTRHE-GPLFRGLEGEVQVW-SHQDAVTA
2vxoB           DPAIFTIGKPVLGICYGMQMMNKVFGGTV---HKKSDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDK
2dplA           ----------------------------------------------------------------------
3a4iA           ----------------------------------------------------------------------
2z0cA           ----------------------------------------------------------------------
2dplB           ----------------------------------------------------------------------
2z0cB           ----------------------------------------------------------------------
2vxoA           DPAIFTIGKPVLGICYGMQMMNKVFGGTV-------HKVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDK
2d7jA           LEHYDEFNVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVXXXXXXXXXXFKGLPKRLKVWESHMDEVKE
1wl8A           LEHYDEFNVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVEIEIID-EEIFKGLPKRLKVWESHMDEVKE
2vpiA           DPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDK
2vpiB           DPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDK
2a9vD           GKYIDDHNYPILGICVGAQFIALHFGASVVKAKHPEFGKTKVSV-HSENIFGGLPSEITVWENHNDEIIN
2a9vC           GKYIDDHNYPILGICVGAQFIALHFGASVVKAKHPEFGKTKVSV-HSENIFGGLPSEITVWENHNDEIIN
2a9vB           GKYIDDHNYPILGICVGAQFIALHFGASVVKAKHPEFGKTKVSV-HSENIFGGLPSEITVWENHNDEIIN
2a9vA           GKYIDDHNYPILGICVGAQFIALHFGASVVKAKHPEFGKTKVSV-HSENIFGGLPSEITVWENHNDEIIN
1t36B           IQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNH-PVKDVEKNVVMITA-----QNHGFAVDE
1jdbF           IQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNH-PVKDVEKNVVMITA-----QNHGFAVDE
1bxrB           IQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNH-PVKDVEKNVVMITA-----QNHGFAVDE
1m6vB           IQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNH-PVKDVEKNVVMITA-----QNHGFAVDE
1qdlB           SLDVIKYRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNSPLSGIAKEFKATRYHSLVVDE
1c30B           IQKFLETDIPVFGISLGHQLLALASGAKTVKMKFGHHGGNH-PVKDVEKNVVMITA-----QNHGFAVDE
1cs0B           IQKFLETDIPVFGI-LGHQLLALASGAKTVKMKFGHHGGNH-PVKDVEKNVVMITA-----QNHGFAVDE
1a9xB           IQKFLETDIPVFGI-LGHQLLALASGAKTVKMKFGHHGGNH-PVKDVEKNVVMITA-----QNHGFAVDE
1i1qB           AGCMPELKLPIIGICLGHQAIVEAYGGYV---GQILHGKATSIEHDGQAMFAGLANPLPVARYHS---SN


                         +         .         .         .         .         *         .:210
query           VPPGFQVLAQTEKAPVAAMANPEKKLFAVQFHPEVIHTPKGMEVLKSFLFDICGCSGSWSMGSFLDEAVK
1gpmA           IPSDFITVASTESCPFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEALWTPAKIIDDAVA
1gpmB           IPSDFITVASTESCPFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEALWTPAKIIDDAVA
2ywbC           PPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFL-ELAGVKRDWTPEHXXXXXXX
2ywbA           PPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFL-ELAGVKRDWTPEHXXXXXXX
2ywcD           PPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKG-QILENFL-ELAGVKRDWTPEHXXXXXXX
2ywbB           PPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFL-ELAGVKRDWTPEHXXXXXXX
2ywbD           PPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFL-ELAGVKRDWTPEHXXXXXXX
2ywcB           PPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKG-QILENFL-ELAGVKRDWTPEHXXXXXXX
2ywcA           PPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKG-QILENFL-ELAGVKRDWTPEHXXXXXXX
2vxoB           VADGFKVVARSGNI-VAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTVQNRELECIR
2dplA           -------------------------------------------------------------GRFVEEKVR
3a4iA           -------------------------------------------------------------GRFVEEKVR
2z0cA           -------------------------------------------------------------GRFVEEKVR
2dplB           ---------------------------------------------------------------FVEEKVR
2z0cB           -------------------------------------------------------------GRFVEEKVR
2vxoA           VADGFKVVARSGNI-VAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTVQNRELECIR
2d7jA           LPPKFKILARSETCPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRNFA-KLCG----------------
1wl8A           LPPKFKILARSE-TPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRNFA-KLCG----------------
2vpiA           VADGFKVVARSGNI-VAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTV---------
2vpiB           VADGFKVVARSGNI-VAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTV---------
2a9vD           LPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFI---------------------
2a9vC           LPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFI---------------------
2a9vB           LPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFI---------------------
2a9vA           LPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFI---------------------
1t36B           LPANLRVTHKSFDGTLQGIHRTDKPAFSFQGHPEASPGP-------------------------------
1jdbF           LPANLRVTHKSFDGTLQGIHRTDKPAFSFQGHPEASPGP-------------------------------
1bxrB           LPANLRVTHKSFDGTLQGIHRTDKPAFSFQGHPEASPGP-------------------------------
1m6vB           LPANLRVTHKSFDGTLQGIHRTDKPAFSFQGHPE------------------------------------
1qdlB           VHRPLIVDASAEDNEIMAIHHEEYPIYGVQFHPESVGTSLGYKILYNFL---------------------
1c30B           LPANLRVTHKSFDGTLQGIHRTDKPAFSFQGHPEASPGP-------------------------------
1cs0B           LPANLRVTHKSFDGTLQGIHRTDKPAFSFQGHPEASPGP-------------------------------
1a9xB           LPANLRVTHKSFDGTLQGIHRTDKPAFSFQGNPEASPGP-------------------------------
1i1qB           VPAGLTINAHF-NGMVMAVRHDADRVCGFQFHPESILTTQGARLLEQTL---------------------


                         .         .         .         +         .         .         .:280
query           EVKQRVGNRQVLCALSGGVDSSVAAVLVHRAVGDNLTCVFVDHGLLRKNEAEQVVKTFRDQFNIKLVHVD
1gpmA           RIREQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLRLNEAEQVLDMFGDHFGLNIVHVP
1gpmB           RIREQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLRLNEAEQVLDMFGDHFGLNIVHVP
2ywbC           XXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLA-VFVDHXXXXXXXXXXXXXXXXXX-GVNLLVVD
2ywbA           XXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHL-AVFVDH-XXXXXXXXXXXXXXXXXXGVNLLVVD
2ywcD           XXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLA-VFVDHXXXXXXXXXXXXXXXXXX-GVNLLVVD
2ywbB           XXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHL-AVFVDH-XXXXXXXXXXXXXXXXXXGVNLLVVD
2ywbD           XXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHL-AVFVDH-XXXXXXXXXXXXXXXXXXGVNLLVVD
2ywcB           XXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLA-VFVDHXXXXXXXXXXXXXXXXXX-GVNLLVVD
2ywcA           XXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLA-VFVDHXXXXXXXXXXXXXXXXXX-GVNLLVVD
2vxoB           EIKERVGTSKVLVLLSGGVDSTVCTALLNRALNEQVIAVHIDNGFMRKRESQSVEEALK-KLGIQVKVIN
2dplA           EIRETVGDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFRDEFGMNLHYVD
3a4iA           EIRETVGDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFRDEFGMNLHYVD
2z0cA           EIRETVGDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFRDEFGMNLHYVD
2dplB           EIRETVGDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFRDEFGMNLHYVD
2z0cB           EIRETVGDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFRDEFGMNLHYVD
2vxoA           EIKERVGTSKVLVLLSGGVDSTVCTALLNRALNEQVIAVHIDNGFMRKRESQSVEEALK-KLGIQVKVIN
2d7jA           ----------------------------------------------------------------------
1wl8A           ----------------------------------------------------------------------
2vpiA           ----------------------------------------------------------------------
2vpiB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
1t36B           ----------------------------------------------------------------------
1jdbF           ----------------------------------------------------------------------
1bxrB           ----------------------------------------------------------------------
1m6vB           ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1cs0B           ----------------------------------------------------------------------
1a9xB           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ASERFLGKLQGVTDPEQKRKIIGTEFIRVFEEEARKLGEIDFLVQGTLYPDVVESGTATAEVIKSHHNVG
1gpmA           AEDRFLSALAGENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAA-------------
1gpmB           AEDRFLSALAGENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIE----------------
2ywbC           AKERFLKALKGVEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESAXXXXXXXXXXXX--
2ywbA           AKERFLKALKGVEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDV----------------IX
2ywcD           AKERFLKALKGVEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVI-----------------
2ywbB           AKERFLKALKGVEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVI-----------------
2ywbD           AKERFLKALKGVEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVI-----------------
2ywcB           AKERFLKALKGVEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVI-----------------
2ywcA           AKERFLKALKGVEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVI---------------XX
2vxoB           AAHSFYNTLNMTTSPEEKRKIIGDTFVKIANEEMNLKPEEVFLAQGTLRPDLIESASGKAELIKTHHNDT
2dplA           AQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIG-AEYLIQGTIAP--------------------
3a4iA           AQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIG-AEYLIQGTIAPNL------------------
2z0cA           AQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIG-AEYLIQGTI----------------------
2dplB           AQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIG-AEYLIQGTI----------------------
2z0cB           AQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIG-AEYLIQGTI----------------------
2vxoA           AAHSFYNTLNMTTSPEEKRKIIGDTFVKIANEEMNLKPEEVFLAQGTLRPDLIESASGKAELIKTHHNDT
2d7jA           ----------------------------------------------------------------------
1wl8A           ----------------------------------------------------------------------
2vpiA           ----------------------------------------------------------------------
2vpiB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
1t36B           ----------------------------------------------------------------------
1jdbF           ----------------------------------------------------------------------
1bxrB           ----------------------------------------------------------------------
1m6vB           ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1cs0B           ----------------------------------------------------------------------
1a9xB           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GLPEDMKFDLVEPLRWLFKDEVRRLGEELGMPEEIVWRQPFPGPGLAVRILGEITKPKLAILREADFVVT
1gpmA           ------KMGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIFI
1gpmB           -----MKMGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIFI
2ywbC           ------------------KDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFT
2ywbA           XXXXXXXXXXXXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFT
2ywcD           -------FELLEPFRLLFKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFT
2ywbB           ------XXXXXXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFT
2ywbD           -----XXXXXXXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFT
2ywcB           ------XXXXXXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFT
2ywcA           XXXXXXXXXXXXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFT
2vxoB           ELIRKLREEVIEPLKDFHKDEVRILGRELGLPEELVSRHPFPGPGLAIRVIASVKKPHTLLQRVKACTTE
2dplA           -----LNLKLIEPLRDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVE
3a4iA           --------KLIEPLRDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVE
2z0cA           ------ALKLIEPLRDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVE
2dplB           -------LKLIEPLRDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVE
2z0cB           -------LKLIEPLRDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVE
2vxoA           ELIRKLREEVIEPLKDFHKDEVRILGRELGLPEELVSRHPFPGPGLAIRVIASVKKPHTLLQRVKACTTE
2d7jA           ----------------------------------------------------------------------
1wl8A           ----------------------------------------------------------------------
2vpiA           ----------------------------------------------------------------------
2vpiB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
1t36B           ----------------------------------------------------------------------
1jdbF           ----------------------------------------------------------------------
1bxrB           ----------------------------------------------------------------------
1m6vB           ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1cs0B           ----------------------------------------------------------------------
1a9xB           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DEIKNAGLNREIWQYFAVLPDMRSVGVMGDGRTYAYAIVVRAVYSHDGMTADWAKIPHDVLGNISTRLVN
1gpmA           EELRKADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIIN
1gpmB           EELRKADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIIN
2ywbC           SLLREWGLYEKVAQALAVLTPV------------GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR
2ywbA           SLLREWGLYEKVAQALAVLTPV------------GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR
2ywcD           SLLREWGLYEKVAQALAVLTPVR-----------GYVLALRAVTTED-FTADWARLPLEFLDEAARRITR
2ywbB           SLLREWGLYEKVAQALAVLTPV------------GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR
2ywbD           SLLREWGLYEKVAQALAVLTPV------------GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR
2ywcB           SLLREWGLYEKVAQALAVLTPV------------GYVLALRAVTTED-FTADWARLPLEFLDEAARRITR
2ywcA           SLLREWGLYEKVAQALAVLTPV------------GYVLALRAVTTED-FTADWARLPLEFLDEAARRITR
2vxoB           EDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSY---VCGISSKD--EPDWESL--IFLARLIPRMCH
2dplA           EEVERAGLRP--WQAFAVLLGVKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITS
3a4iA           EEVERAGLRP--WQAFAVLLGVKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITS
2z0cA           EEVERAGLRP--WQAFAVLLGVKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITS
2dplB           EEVERAGLRP--WQAFAVLLGVKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITS
2z0cB           EEVERAGLRP--WQAFAVLLGVKTVGVQGDIRAYKETIAVRIV---ESMTANAMNVPWEVLQRIAFRITS
2vxoA           EDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSY---VCGISSKD--EPDWESL--IFLARLIPRMCH
2d7jA           ----------------------------------------------------------------------
1wl8A           ----------------------------------------------------------------------
2vpiA           ----------------------------------------------------------------------
2vpiB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
1t36B           ----------------------------------------------------------------------
1jdbF           ----------------------------------------------------------------------
1bxrB           ----------------------------------------------------------------------
1m6vB           ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1cs0B           ----------------------------------------------------------------------
1a9xB           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EVAEINRVVYDITSKPPGTIEWE
1gpmA           EVNGISRVVYDISGKPPATIEWE
1gpmB           EVNGISRVVYDISGKPPATIEWE
2ywbC           RVPEIGRVVYDLTSKPPATIEWE
2ywbA           RVPEIGRVVYDLTSKPPATIEWE
2ywcD           RVPEIGRVVYDLTSKPPATIEWE
2ywbB           RVPEIGRVVYDLTSKPPATIEWE
2ywbD           RVPEIGRVVYDLTSKPPATIEWE
2ywcB           RVPEIGRVVYDLTSKPPATIEWE
2ywcA           RVPEIGRVVYDLTSKPPATIEWE
2vxoB           NV---NRVVY-------------
2dplA           EIPEVGRVLYDITNKPPATIEFE
3a4iA           EIPEVGRVLYDITNKPPATIEFE
2z0cA           EIPEVGRVLYDITNKPPATIEFE
2dplB           EIPEVGRVLYDITNKPPATIEFE
2z0cB           EIPEVGRVLYDITNKPPATIEFE
2vxoA           NV---NRVVY-------------
2d7jA           -----------------------
1wl8A           -----------------------
2vpiA           -----------------------
2vpiB           -----------------------
2a9vD           -----------------------
2a9vC           -----------------------
2a9vB           -----------------------
2a9vA           -----------------------
1t36B           -----------------------
1jdbF           -----------------------
1bxrB           -----------------------
1m6vB           -----------------------
1qdlB           -----------------------
1c30B           -----------------------
1cs0B           -----------------------
1a9xB           -----------------------
1i1qB           -----------------------