[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO50894.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bc5A.bssp"
#ERROR : Can't open dsspfile "1af7A.bssp"

## Summary of PDB Search
:256
    6e-32  37%  1bc5A  [a.58.1 - c.66.1] CHEMOTAXIS RECEPTOR METHYLTRANSFERASE
    6e-32  37%  1af7A  [x.x.x] CHEMOTAXIS RECEPTOR METHYLTRANSFERASE CHER
:256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLDYLTINVSE
1bc5A           ---FRRICQLIYQRAGIVLADHKRDMVYNRLVRRLRALGLDDFGRYLSMLEANQNSWQAFINALTTNLTA
1af7A           ---FRRICQLIYQRAGIVLADHKRDMVYNRLVRRLRALGLDDFGRYLSMLEANQNSWQAFINALTTNLTA


                         .         .         *         .         .         .         .:140
query           FFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIANGKRHQIDATDLDNTILQAA
1bc5A           FFREAHHFP-----ILAEHARRRGEYRVWSAAASTGEEPYSIAITLADMAPG-RWKVFASDIDTEVLEKA
1af7A           FFREAHHFP-----ILAEHARRRGEYRVWSAAASTGEEPYSIAITLADMAPG-RWKVFASDIDTEVLEKA


                         +         .         .         .         .         *         .:210
query           ASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVNFKQHNLLADTYPKGYDLIACRNVTIYFTRE
1bc5A           RSGIYRLSELKTLSPQQLQRYFMPHEGLVRVRQELANYVEFSSVNLLEKQYPGPFDAIFCRNVMIYFDKT
1af7A           RSGIYRLSELKTLSPQQLQRYFMPHEGLVRVRQELANYVEFSSVNLLEKQYPGPFDAIFCRNVMIYFDKT


                         .         .         .         +         .         .         .:280
query           AQDKVNARFAQSLNPGGYLFIGGSETIFNxxxxxxxxxxxxxxxxx
1bc5A           TQEDILRRFVPLLKPDGLLFAGHSENFSN-----------------
1af7A           TQEDILRRFVPLLKPDGLLFAGHSENFSN-----------------