[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO50917.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1lkvX.bssp"
#ERROR : Can't open dsspfile "1qc7A.bssp"
#ERROR : Can't open dsspfile "1qc7B.bssp"

## Summary of PDB Search
:337
    4e-63  54%  1lkvX  [a.118.14] FLAGELLAR MOTOR SWITCH PROTEIN FLIG
    1e-37  68%  1qc7A  [a.118.14] PROTEIN (FLIG)
    3e-34  72%  1qc7B  [a.118.14] PROTEIN (FLIG)
:337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lkvX           ----------------------------------------------------------------------
1qc7A           ----------------------------------------------------------------------
1qc7B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDPRHILSFIREEHPQTIAFVLSYL
1lkvX           ----------------------------------------------DPVQLVNFLQSEHPQTIAVVLSYL
1qc7A           ----------------------------------------------------------------------
1qc7B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KPDQAAVILAELDSQLQSEVARRVAILDRISPDXXXXXXXXXXXXXXSVAQHEETVVGGVQCLVNILNRV
1lkvX           DPPVAAQILGALPEELQTEVLKRIALLERTSPEVVKEIERNLEKKISGFVSRTFSKVGGIDTAAEIMNNL
1qc7A           ----------------------------------------------------------------------
1qc7B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DRSTEKTIFEDLERADPNLSEEVRRLMFIFEDIVKLHDISIQKVLREVDNKDLALAMKGSNQEVNNRIYK
1lkvX           DRTTEKKIMDKLVQENPELADEIRRRMFVFEDILKLDDRSIQLVLREVDTRDLALALKGASDELKEKIFK
1qc7A           --------------------------MFVFEDILKLDDRSIQLVLREVDTRDLALALKGASDELKEKIFK
1qc7B           --------------------------MFVFEDILKLDDRSIQLVLREVDTRDLALALKGASDELKEKIFK


                         .         *         .         .         .         .         +:350
query           NMSKRASEMLKEEIDYMGPVRLKDVEEAQQRIVNVIRRLEEAGEIVISRGGEDAILV
1lkvX           NMSKRAAALLKDELEYMGPVRLKDVEEAQQKIINIIRRLEEAGEIVIAR--------
1qc7A           NMSKRAAALLKDELEYMGPVRLKDVEEAQQKIINIIRRLEEAGEIVIARGGGEELIM
1qc7B           NMSKRAAALLKDELEYMGPVRLKDVEEAQQKIINIIRRLEEAGEI------------