[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for dred0:ABO51003.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1nxzB.bssp"
#ERROR : Can't open dsspfile "1nxzA.bssp"
#ERROR : Can't open dsspfile "1vhyA.bssp"
#ERROR : Can't open dsspfile "1vhkC.bssp"
#ERROR : Can't open dsspfile "1vhkA.bssp"
#ERROR : Can't open dsspfile "1vhyB.bssp"
#ERROR : Can't open dsspfile "1vhkB.bssp"
#ERROR : Can't open dsspfile "1vhkD.bssp"
#ERROR : Can't open dsspfile "2egvA.bssp"
#ERROR : Can't open dsspfile "2z0yA.bssp"
#ERROR : Can't open dsspfile "1v6zB.bssp"
#ERROR : Can't open dsspfile "1v6zA.bssp"
#ERROR : Can't open dsspfile "1z85B.bssp"
#ERROR : Can't open dsspfile "1z85A.bssp"

## Summary of PDB Search
:247
    5e-29  35%  1nxzB  [b.122.1 - c.116.1] HYPOTHETICAL PROTEIN HI0303
    5e-29  35%  1nxzA  [b.122.1 - c.116.1] HYPOTHETICAL PROTEIN HI0303
    3e-27  35%  1vhyA  [b.122.1 - c.116.1] HYPOTHETICAL PROTEIN HI0303
    2e-24  33%  1vhkC  [b.122.1 - c.116.1] HYPOTHETICAL PROTEIN YQEU
    5e-24  35%  1vhkA  [b.122.1 - c.116.1] HYPOTHETICAL PROTEIN YQEU
    6e-24  34%  1vhyB  [b.122.1 - c.116.1] HYPOTHETICAL PROTEIN HI0303
    5e-21  37%  1vhkB  [b.122.1 - c.116.1] HYPOTHETICAL PROTEIN YQEU
    2e-18  38%  1vhkD  [b.122.1 - c.116.1] HYPOTHETICAL PROTEIN YQEU
    2e-16  26%  2egvA  [x.x.x] UPF0088 PROTEIN AQ_165
    2e-07  26%  2z0yA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN TTHA0657
    2e-07  26%  1v6zB  [b.122.1 - c.116.1] HYPOTHETICAL PROTEIN TTHA0657
    2e-07  26%  1v6zA  [b.122.1 - c.116.1] HYPOTHETICAL PROTEIN TTHA0657
    3e-06  27%  1z85B  [x.x.x] HYPOTHETICAL PROTEIN TM1380
    3e-06  27%  1z85A  [x.x.x] HYPOTHETICAL PROTEIN TM1380
:247

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPRFFVQPEQINSDTAVINGPDVKHISRVLRMETGNNLTLLDGRGNVYLAQILEINKQEVHCRILEQQEA
1nxzB           IPRIYHPISLENQTQCYLSEDAANHVARVLRTE-GEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELA
1nxzA           IPRIYHPISLENQTQCYLSEDAANHVARVLRTE-GEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELA
1vhyA           IPRIYHPISLENQTQCYLSEDAANHVARVLRTE-GEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELA
1vhkC           --RYFIEKQQIEAPTFSITGEEVHHIVNV--RNEGDQIICCSQDGFEAKCELQSVSKDKVSCLVIEWTNE
1vhkA           --RYFIEKQQIEAPTFSITGEEVHHIVNV--RNEGDQIICCSQDGFEAKCELQSVSKDKVSCLVIEWTNE
1vhyB           IPRIYHPISLENQTQCYLSEDAANHVARVLRTE-GEQLELFDGSNHIYPAKII------VKVEILGRELA
1vhkB           -------------------------------------------------------------CLVIEWTNE
1vhkD           ----------------------------------------------------------------------
2egvA           --------EERRGNLLILREGEVKHF-RVRRIEKDEEFGVIH-EGKIYVCKVRREDKREISCEIVEELE-
2z0yA           --------------TGVLPLRETRHLVEVLRARVGDRFTVFDGEREA-LAEVVDLGXXXXXXXXXXXXXX
1v6zB           --------------TGVLPLRETRHLVEVLRARVGDRFTVFDGEREA-LAEVVDLGXXXXXXXXXXXXXX
1v6zA           --------------TGVLPLRETRHLVEVLRARVGDRFTVFDGEREA-LAEVVDLGXXXXXXXXXXXXXX
1z85B           ---------------------------RVVRLKEGDVIEATDGNGFSYTCILKSLXXXXXXXXXXXXXXX
1z85A           ---------------------------RVVRLKEGDVIEATDGNGFSYTCILKSLXXXXXXXXXXXXXXX


                         .         .         *         .         .         .         .:140
query           TSEPTVKVTLVQGLPKGDKMETIIQKCTELGVSSIIPLAAARSIVKLDAKKAAERVQRWQRVAVEAAKQC
1nxzB           DKESHLKIHLGQVISRGER-EFTIQKSVELGVNVITPLWSERCGVKLDAER-DKKIQQWQKIAIAACEQC
1nxzA           DKESHLKIHLGQVISRGER-EFTIQKSVELGVNVITPLWSERCGVKLDAER-DKKIQQWQKIAIAACEQC
1vhyA           DKESHLKIHLGQVI-----REFTIQKSVELGVNVITPLWSERCGVKLDAER-DKKIQQWQKIAIAACEQC
1vhkC           NRELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVXXXXXXXXXXRERWTKIAKEAAEQS
1vhkA           NRELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVKR---------ERWTKIAKEAAEQS
1vhyB           DKESHLKIHLGQVI---SRREFTIQKSVELGVNVITPLWSERCGVKLDAERD-KKIQQWQKIAIAACEQC
1vhkB           NRELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVR----------ERWTKIAKEAAEQS
1vhkD           --ELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVKR----------ERWTKIAKEAAEQS
2egvA           TKLPPKDITLYQSVTVDLKMDTIVRQATELGVLTFVPIISERSFQKEEA--ILKKTEKWKRIVIEAMKQS
2z0yA           XXXXXXXXXYV-ALLKGDKLAEVVRAATELGATRIQPLVTRHSV----PKEGEGKXXXXXXXXXXXXKQS
1v6zB           XXXXXXXXXYV-ALLKGDKLAEVVRAATELGATRIQPLVTRHSV----PKEGEGKXXXXXXXXXXXXKQS
1v6zA           XXXXXXXXXYV-ALLKGDKLAEVVRAATELGATRIQPLVTRHSV----PKEGEGKXXXXXXXXXXXXKQS
1z85B           XXXXXXXLSVVVPIGRWERTRFLIEKCVELGVDEIFFHKFERSQHEISLDKA-------KIVVREAAKQC
1z85A           XXXXXXXLSVVVPIGRWERTRFLIEKCVELGVDEIFFHKFERSQHEISLDKA-------KIVVREAAKQC


                         +         .         .         .         .         *         .:210
query           RRSGIPEVYMLSSWDEILQQIPPDALVLMPWEGERTKSLREVLQTRPMAPGQVYIFIGPXXXXXXXXXXX
1nxzB           GRNIVPEIRPLKLQDWCAENDGALKLNLHP-------RAHYSIKTLPTIPGGVRLLIGSEGGLSAQEIAQ
1nxzA           GRNIVPEIRPLKLQDWCAENDGALKLNLHP-------RAHYSIKTLPTIPGGVRLLIGSEGGLSAQEIAQ
1vhyA           GRNIVPEIRPLKLQDWCAENDGALKLNLHP-------RAHYSIKTLPTIPGGVRLLIGSEGGLSAQEIAQ
1vhkC           YRNEVPRV-DVHSFQQLLQRQDFDKCVV-----AYESAFSAIVSSLPKGSSLLIVF-GPEGGLTEAEVER
1vhkA           YRNEVPRV-DVHSFQQLLQRQDFDKCVV-----AYESAFSAIVSSLPKGSSLLIVF-GPEGGLTEAEVER
1vhyB           GRNIVPEIRPLKLQDWCAENDGALKLNLHP-------RAHYSIKTLPTIPGGVRLLIGSEGGLSAQEIAQ
1vhkB           YRNEVPRV-DVHSFQQLLQRQDFDKCVV---AYEESSAFSAIVSSLPKGSSLLIVF-GPEGGLTEAEVER
1vhkD           YRNEVPRV-DVHSFQQLLQRQDFDKCVVAYEE----SAFSAIVSSLPKGSSLLIVF-GPEGGLTEAEVER
2egvA           RRPIPMEIKKPVRLSDLIPESEENIILDNFYEGVKPKDVNLEAKT-------YSVVVGPEGGFSKRESQI
2z0yA           GR----XXXXXXXXXXXXKAVPQVAQGLVAHVG-ATARVREVLDEKPLA-----LAVGPEGGFAEEEVAL
1v6zB           GR----XXXXXXXXXXXXKAVPQVAQGLVAHVG-ATARVREVLDEKPLA-----LAVGPEGGFAEEEVAL
1v6zA           GR----XXXXXXXXXXXXKAVPQVAQGLVAHVG-ATARVREVLDEKPLA-----LAVGPEGGFAEEEVAL
1z85B           KRYLFPKVSFL-----------------------------------------------------------
1z85A           KRYLFPKVSFL-----------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXYPVTLGSRILRTETAGPAALTMVLYQFGELG
1nxzB           TEQQGFTEILLGKRVLRTETASLAAISALQICFGDLG
1nxzA           TEQQGFTEILLGKRVLRTETASLAAISALQICFGDLG
1vhyA           TEQQGFTEILLGKRVLRTETASLAAISALQICFGDLG
1vhkC           LTEQDGVTCGLGPRILRTETAPLYALSAISYQ-----
1vhkA           LTEQDGVTCGLGPRILRTETAPLYALSAISYQ-----
1vhyB           TEQQGFTEILLGKRVLRTETASLAAISALQICFGDLG
1vhkB           LTEQDGVTCGLGPRILRTETAPLYALSAISYQ-----
1vhkD           LTEQDGVTCGLGPRILRTETAPLYALSAISYQ-----
2egvA           LREKGFKSVLLEPYTLRTETAVVSIVSILM-------
2z0yA           LEARGFTPVSLGRRILRAET-----------------
1v6zB           LEARGFTPVSLGRRILRAET-----------------
1v6zA           LEARGFTPVSLGRRILRAET-----------------
1z85B           -------------------------------------
1z85A           -------------------------------------