[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO48556.1

[Show Plain Result]


## Summary of Sequence Search
    1::371
    1::371       0.0 100%  371 aa  RECF_DESRM RecName: Full=DNA replication and repair protein recF;
    1::340     1e-73  42%  364 aa  RECF_PELTS RecName: Full=DNA replication and repair protein recF;
    1::365     6e-70  41%  375 aa  RECF_BACCZ RecName: Full=DNA replication and repair protein recF;
    1::365     1e-69  41%  375 aa  RECF_BACCR RecName: Full=DNA replication and repair protein recF;
    1::365     1e-69  41%  375 aa  RECF_BACC4 RecName: Full=DNA replication and repair protein recF;
    1::365     1e-69  41%  375 aa  RECF_BACC2 RecName: Full=DNA replication and repair protein recF;
    1::365     2e-69  42%  375 aa  RECF_BACWK RecName: Full=DNA replication and repair protein recF;
    1::365     3e-69  41%  375 aa  RECF_BACHK RecName: Full=DNA replication and repair protein recF;
    1::365     3e-69  41%  375 aa  RECF_BACCQ RecName: Full=DNA replication and repair protein recF;
    1::365     3e-69  41%  375 aa  RECF_BACC7 RecName: Full=DNA replication and repair protein recF;
    1::365     3e-69  41%  375 aa  RECF_BACC3 RecName: Full=DNA replication and repair protein recF;
    1::365     3e-69  41%  375 aa  RECF_BACC1 RecName: Full=DNA replication and repair protein recF;
    1::365     3e-69  41%  375 aa  RECF_BACAH RecName: Full=DNA replication and repair protein recF;
    1::365     4e-69  41%  375 aa  RECF_BACC0 RecName: Full=DNA replication and repair protein recF;
    1::365     4e-69  41%  375 aa  RECF_BACAN RecName: Full=DNA replication and repair protein recF;
    1::365     4e-69  41%  375 aa  RECF_BACAC RecName: Full=DNA replication and repair protein recF;
    1::365     4e-69  41%  375 aa  RECF_BACAA RecName: Full=DNA replication and repair protein recF;
    1::370     9e-69  41%  370 aa  RECF_BACSU RecName: Full=DNA replication and repair protein recF;
    1::356     3e-68  41%  373 aa  RECF_BACCN RecName: Full=DNA replication and repair protein recF;
    1::369     3e-67  39%  374 aa  RECF_GEOSW RecName: Full=DNA replication and repair protein recF;
    1::369     3e-67  39%  370 aa  RECF_BACLD RecName: Full=DNA replication and repair protein recF;
    1::369     9e-67  40%  372 aa  RECF_GEOKA RecName: Full=DNA replication and repair protein recF;
    1::372     2e-66  37%  372 aa  RECF_BACSK RecName: Full=DNA replication and repair protein recF;
    1::370     3e-66  40%  370 aa  RECF_BACA2 RecName: Full=DNA replication and repair protein recF;
    1::374     4e-66  37%  379 aa  RECF_LACS1 RecName: Full=DNA replication and repair protein recF;
    1::373     1e-65  39%  374 aa  RECF_PEDPA RecName: Full=DNA replication and repair protein recF;
    1::368     1e-65  39%  372 aa  RECF_GEOTN RecName: Full=DNA replication and repair protein recF;
    1::357     1e-65  41%  372 aa  RECF_EXISA RecName: Full=DNA replication and repair protein recF;
    1::360     2e-65  40%  369 aa  RECF_OCEIH RecName: Full=DNA replication and repair protein recF;
    1::368     3e-65  38%  370 aa  RECF_STACT RecName: Full=DNA replication and repair protein recF;
    1::368     8e-65  39%  370 aa  RECF_BACP2 RecName: Full=DNA replication and repair protein recF;
    1::369     1e-64  39%  371 aa  RECF_STAS1 RecName: Full=DNA replication and repair protein recF;
    1::369     1e-64  38%  375 aa  RECF_ENTFA RecName: Full=DNA replication and repair protein recF;
    1::341     1e-64  43%  368 aa  RECF_ALKMQ RecName: Full=DNA replication and repair protein recF;
    1::369     2e-64  40%  371 aa  RECF_STAES RecName: Full=DNA replication and repair protein recF;
    1::369     2e-64  40%  371 aa  RECF_STAEQ RecName: Full=DNA replication and repair protein recF;
    1::369     5e-64  40%  371 aa  RECF_STAHJ RecName: Full=DNA replication and repair protein recF;
    1::371     9e-64  39%  375 aa  RECF_HALOH RecName: Full=DNA replication and repair protein recF;
    1::365     1e-63  39%  369 aa  RECF_CLOTH RecName: Full=DNA replication and repair protein recF;
    1::362     4e-63  41%  367 aa  RECF_CLOTE RecName: Full=DNA replication and repair protein recF;
    1::367     1e-62  39%  369 aa  RECF_MACCJ RecName: Full=DNA replication and repair protein recF;
    1::373     2e-62  37%  374 aa  RECF_LACJO RecName: Full=DNA replication and repair protein recF;
    1::373     2e-62  37%  374 aa  RECF_LACGA RecName: Full=DNA replication and repair protein recF;
    1::370     4e-62  38%  373 aa  RECF_OENOB RecName: Full=DNA replication and repair protein recF;
    1::370     1e-61  38%  371 aa  RECF_LACC3 RecName: Full=DNA replication and repair protein recF;
    1::370     2e-61  38%  371 aa  RECF_LACCB RecName: Full=DNA replication and repair protein recF;
    1::373     3e-61  39%  375 aa  RECF_LACSS RecName: Full=DNA replication and repair protein recF;
    1::371     3e-61  39%  384 aa  RECF_EXIS2 RecName: Full=DNA replication and repair protein recF;
    1::369     3e-61  35%  372 aa  RECF_BREBN RecName: Full=DNA replication and repair protein recF;
    1::359     4e-61  39%  360 aa  RECF_DESAP RecName: Full=DNA replication and repair protein recF;
    1::369     5e-61  36%  378 aa  RECF_LEUCK RecName: Full=DNA replication and repair protein recF;
    1::373     7e-61  37%  374 aa  RECF_LEUMM RecName: Full=DNA replication and repair protein recF;
    1::367     9e-61  39%  384 aa  RECF_LACBA RecName: Full=DNA replication and repair protein recF;
    1::368     2e-60  38%  370 aa  RECF_STAAW RecName: Full=DNA replication and repair protein recF;
    1::368     2e-60  38%  370 aa  RECF_STAAU RecName: Full=DNA replication and repair protein recF;
    1::368     2e-60  38%  370 aa  RECF_STAAT RecName: Full=DNA replication and repair protein recF;
    1::368     2e-60  38%  370 aa  RECF_STAAS RecName: Full=DNA replication and repair protein recF;
    1::368     2e-60  38%  370 aa  RECF_STAAR RecName: Full=DNA replication and repair protein recF;
    1::368     2e-60  38%  370 aa  RECF_STAAN RecName: Full=DNA replication and repair protein recF;
    1::368     2e-60  38%  370 aa  RECF_STAAM RecName: Full=DNA replication and repair protein recF;
    1::368     2e-60  38%  370 aa  RECF_STAAE RecName: Full=DNA replication and repair protein recF;
    1::368     2e-60  38%  370 aa  RECF_STAAC RecName: Full=DNA replication and repair protein recF;
    1::368     2e-60  38%  370 aa  RECF_STAA9 RecName: Full=DNA replication and repair protein recF;
    1::368     2e-60  38%  370 aa  RECF_STAA8 RecName: Full=DNA replication and repair protein recF;
    1::368     2e-60  38%  370 aa  RECF_STAA2 RecName: Full=DNA replication and repair protein recF;
    1::368     2e-60  38%  370 aa  RECF_STAA1 RecName: Full=DNA replication and repair protein recF;
    1::372     3e-60  35%  372 aa  RECF_HELMI RecName: Full=DNA replication and repair protein recF;
    1::368     4e-60  38%  370 aa  RECF_STAAB RecName: Full=DNA replication and repair protein recF;
    1::368     4e-60  38%  370 aa  RECF_STAA3 RecName: Full=DNA replication and repair protein recF;
    1::372     8e-60  37%  374 aa  RECF_LACRJ RecName: Full=DNA replication and repair protein recF;
    1::372     8e-60  37%  374 aa  RECF_LACRD RecName: Full=DNA replication and repair protein recF;
    1::372     1e-59  37%  374 aa  RECF_LACPL RecName: Full=DNA replication and repair protein recF;
    1::364     1e-59  38%  365 aa  RECF_ALKOO RecName: Full=DNA replication and repair protein recF;
    1::357     1e-59  40%  370 aa  RECF_LISMO RecName: Full=DNA replication and repair protein recF;
    1::357     1e-59  40%  370 aa  RECF_LISMF RecName: Full=DNA replication and repair protein recF;
    1::357     1e-59  40%  370 aa  RECF_LISMC RecName: Full=DNA replication and repair protein recF;
    1::370     3e-59  36%  371 aa  RECF_BACHD RecName: Full=DNA replication and repair protein recF;
    1::357     7e-59  40%  370 aa  RECF_LISMH RecName: Full=DNA replication and repair protein recF;
    1::367     7e-59  39%  370 aa  RECF_LISIN RecName: Full=DNA replication and repair protein recF;
    1::357     1e-58  40%  370 aa  RECF_LISW6 RecName: Full=DNA replication and repair protein recF;
    1::361     1e-58  40%  361 aa  RECF_CLONN RecName: Full=DNA replication and repair protein recF;
    1::344     2e-58  42%  364 aa  RECF_CLOBM RecName: Full=DNA replication and repair protein recF;
    1::340     3e-58  40%  360 aa  RECF_CLOPH RecName: Full=DNA replication and repair protein recF;
    1::358     6e-58  37%  358 aa  RECF_LACLA RecName: Full=DNA replication and repair protein recF;
    1::368     1e-57  36%  371 aa  RECF_LYSSC RecName: Full=DNA replication and repair protein recF;
    1::372     1e-57  36%  373 aa  RECF_LACF3 RecName: Full=DNA replication and repair protein recF;
    1::359     4e-57  36%  359 aa  RECF_LACLM RecName: Full=DNA replication and repair protein recF;
    1::374     6e-57  34%  375 aa  RECF_LACAC RecName: Full=DNA replication and repair protein recF;
    1::375     1e-56  37%  386 aa  RECF_NATTJ RecName: Full=DNA replication and repair protein recF;
    1::359     1e-56  36%  359 aa  RECF_LACLS RecName: Full=DNA replication and repair protein recF;
    1::341     2e-56  42%  362 aa  RECF_EUBR3 RecName: Full=DNA replication and repair protein recF;
    1::361     2e-56  37%  369 aa  RECF_STREM RecName: Full=DNA replication and repair protein recF;
    1::338     1e-55  39%  361 aa  RECF_STRGC RecName: Full=DNA replication and repair protein recF;
    1::361     1e-55  37%  369 aa  RECF_STRE4 RecName: Full=DNA replication and repair protein recF;
    1::361     2e-55  37%  369 aa  RECF_STRS7 RecName: Full=DNA replication and repair protein recF;
    1::338     3e-55  38%  364 aa  RECF_STRSV RecName: Full=DNA replication and repair protein recF;
    1::340     3e-55  35%  371 aa  RECF_CLOD6 RecName: Full=DNA replication and repair protein recF;
    1::360     4e-55  37%  363 aa  RECF_STRMU RecName: Full=DNA replication and repair protein recF;
    1::338     4e-55  38%  369 aa  RECF_STRA1 RecName: Full=DNA replication and repair protein recF;
    1::363     6e-55  38%  364 aa  RECF_CLOK5 RecName: Full=DNA replication and repair protein recF;
    1::344     1e-54  42%  364 aa  RECF_CLOBK RecName: Full=DNA replication and repair protein recF;
    1::344     1e-54  42%  364 aa  RECF_CLOBJ RecName: Full=DNA replication and repair protein recF;
    1::344     1e-54  41%  364 aa  RECF_CLOB6 RecName: Full=DNA replication and repair protein recF;
    1::344     1e-54  42%  364 aa  RECF_CLOB1 RecName: Full=DNA replication and repair protein recF;
    1::339     2e-54  39%  364 aa  RECF_STRU0 RecName: Full=DNA replication and repair protein recF;
    1::338     3e-54  38%  369 aa  RECF_STRA5 RecName: Full=DNA replication and repair protein recF;
    1::338     3e-54  38%  369 aa  RECF_STRA3 RecName: Full=DNA replication and repair protein recF;
    8::374     6e-54  34%  375 aa  RECF_LACH4 RecName: Full=DNA replication and repair protein recF;
    1::374     6e-54  35%  381 aa  RECF_LACDB RecName: Full=DNA replication and repair protein recF;
    1::344     6e-54  41%  364 aa  RECF_CLOBL RecName: Full=DNA replication and repair protein recF;
    1::325     8e-54  38%  365 aa  RECF_STRZJ RecName: Full=DNA replication and repair protein recF;
    1::325     8e-54  38%  365 aa  RECF_STRPJ RecName: Full=DNA replication and repair protein recF;
    1::325     8e-54  38%  365 aa  RECF_STRP7 RecName: Full=DNA replication and repair protein recF;
    1::325     8e-54  38%  365 aa  RECF_STRP4 RecName: Full=DNA replication and repair protein recF;
    1::374     1e-53  35%  381 aa  RECF_LACDA RecName: Full=DNA replication and repair protein recF;
    4::357     2e-53  36%  370 aa  RECF_MOOTA RecName: Full=DNA replication and repair protein recF;
    1::362     3e-53  36%  363 aa  RECF_CLOAB RecName: Full=DNA replication and repair protein recF;
    1::325     4e-53  38%  365 aa  RECF_STRZT RecName: Full=DNA replication and repair protein recF;
    1::325     4e-53  38%  365 aa  RECF_STRZP RecName: Full=DNA replication and repair protein recF;
    1::325     4e-53  38%  365 aa  RECF_STRR6 RecName: Full=DNA replication and repair protein recF;
    1::325     4e-53  38%  365 aa  RECF_STRPN RecName: Full=DNA replication and repair protein recF;
    1::325     4e-53  38%  365 aa  RECF_STRPI RecName: Full=DNA replication and repair protein recF;
    1::325     4e-53  38%  365 aa  RECF_STRP2 RecName: Full=DNA replication and repair protein recF;
    1::325     9e-53  37%  365 aa  RECF_STRPS RecName: Full=DNA replication and repair protein recF;
    1::350     4e-52  36%  368 aa  RECF_STRPZ RecName: Full=DNA replication and repair protein recF;
    1::350     4e-52  36%  368 aa  RECF_STRP3 RecName: Full=DNA replication and repair protein recF;
    1::350     5e-52  36%  368 aa  RECF_STRPG RecName: Full=DNA replication and repair protein recF;
    1::350     5e-52  36%  368 aa  RECF_STRPD RecName: Full=DNA replication and repair protein recF;
    1::350     5e-52  36%  368 aa  RECF_STRP8 RecName: Full=DNA replication and repair protein recF;
    1::350     5e-52  36%  368 aa  RECF_STRP6 RecName: Full=DNA replication and repair protein recF;
    1::350     6e-52  36%  368 aa  RECF_STRPF RecName: Full=DNA replication and repair protein recF;
    1::350     1e-51  35%  368 aa  RECF_STRP1 RecName: Full=DNA replication and repair protein recF;
    1::350     1e-51  35%  368 aa  RECF_STRPC RecName: Full=DNA replication and repair protein recF;
    1::350     2e-51  35%  368 aa  RECF_STRPM RecName: Full=DNA replication and repair protein recF;
    1::350     2e-51  35%  368 aa  RECF_STRPB RecName: Full=DNA replication and repair protein recF;
    1::342     2e-51  39%  363 aa  RECF_EUBE2 RecName: Full=DNA replication and repair protein recF;
    1::340     2e-51  37%  361 aa  RECF_CLOPS RecName: Full=DNA replication and repair protein recF;
    1::340     2e-51  37%  361 aa  RECF_CLOPE RecName: Full=DNA replication and repair protein recF;
    1::340     2e-51  37%  361 aa  RECF_CLOP1 RecName: Full=DNA replication and repair protein recF;
    1::338     2e-51  37%  366 aa  RECF_STRTD RecName: Full=DNA replication and repair protein recF;
    1::338     2e-51  37%  366 aa  RECF_STRT1 RecName: Full=DNA replication and repair protein recF;
    1::338     5e-51  37%  366 aa  RECF_STRT2 RecName: Full=DNA replication and repair protein recF;
    1::341     1e-49  38%  367 aa  RECF_CLOB8 RecName: Full=DNA replication and repair protein recF;
    1::365     1e-49  36%  365 aa  RECF_DESHY RecName: Full=DNA replication and repair protein recF;
    1::365     1e-49  36%  365 aa  RECF_DESHD RecName: Full=DNA replication and repair protein recF;
    1::343     5e-49  35%  372 aa  RECF_CLOCE RecName: Full=DNA replication and repair protein recF;
    1::325     6e-49  35%  364 aa  RECF_STRSY RecName: Full=DNA replication and repair protein recF;
    1::325     6e-49  35%  364 aa  RECF_STRS2 RecName: Full=DNA replication and repair protein recF;
    1::370     8e-49  36%  374 aa  RECF_ACAM1 RecName: Full=DNA replication and repair protein recF;
    1::389     7e-48  37%  392 aa  RECF_CHLAD RecName: Full=DNA replication and repair protein recF;
    1::339     1e-47  35%  364 aa  RECF_GEOUR RecName: Full=DNA replication and repair protein recF;
    1::379     2e-47  37%  380 aa  RECF_CYAA5 RecName: Full=DNA replication and repair protein recF;
    1::339     2e-46  34%  362 aa  RECF_THEPX RecName: Full=DNA replication and repair protein recF;
    1::339     2e-46  34%  362 aa  RECF_THEP3 RecName: Full=DNA replication and repair protein recF;
    1::341     2e-46  36%  375 aa  RECF_SYMTH RecName: Full=DNA replication and repair protein recF;
    1::391     5e-46  36%  394 aa  RECF_ROSCS RecName: Full=DNA replication and repair protein recF;
    1::317     1e-45  35%  376 aa  RECF_STRGG RecName: Full=DNA replication and repair protein recF;
    1::370     1e-45  37%  374 aa  RECF_NOSP7 RecName: Full=DNA replication and repair protein recF;
    1::370     3e-45  33%  373 aa  RECF_STRAW RecName: Full=DNA replication and repair protein recF;
    1::377     2e-44  36%  380 aa  RECF_CYAP8 RecName: Full=DNA replication and repair protein recF;
    1::370     5e-44  35%  376 aa  RECF_ANASP RecName: Full=DNA replication and repair protein recF;
    1::364     1e-43  36%  390 aa  RECF_TRIEI RecName: Full=DNA replication and repair protein recF;
    1::365     1e-43  37%  392 aa  RECF_CHLSY RecName: Full=DNA replication and repair protein recF;
    1::365     1e-43  37%  392 aa  RECF_CHLAA RecName: Full=DNA replication and repair protein recF;
    1::314     1e-43  34%  373 aa  RECF_STRCO RecName: Full=DNA replication and repair protein recF;
   25::359     4e-43  33%  361 aa  RECF_CLOBB RecName: Full=DNA replication and repair protein recF;
    1::349     7e-43  31%  368 aa  RECF_CHLT3 RecName: Full=DNA replication and repair protein recF;
    1::338     2e-42  33%  359 aa  RECF_PARUW RecName: Full=DNA replication and repair protein recF;
    1::361     3e-42  35%  377 aa  RECF_CYAP4 RecName: Full=DNA replication and repair protein recF;
    1::346     3e-42  34%  363 aa  RECF_CHLPB RecName: Full=DNA replication and repair protein recF;
    1::385     4e-42  32%  398 aa  RECF_RENSM RecName: Full=DNA replication and repair protein recF;
   25::359     4e-42  34%  361 aa  RECF_CLOBA RecName: Full=DNA replication and repair protein recF;
    1::385     4e-42  32%  401 aa  RECF_ARTS2 RecName: Full=DNA replication and repair protein recF;
    1::381     6e-42  34%  384 aa  RECF_CYAP7 RecName: Full=DNA replication and repair protein recF;
    1::373     1e-41  34%  375 aa  RECF_MICAN RecName: Full=DNA replication and repair protein recF;
    1::370     1e-41  34%  376 aa  RECF_ANAVT RecName: Full=DNA replication and repair protein recF;
    1::403     2e-41  34%  425 aa  RECF_CORJK RecName: Full=DNA replication and repair protein recF;
    1::348     3e-41  32%  371 aa  RECF_ACIC1 RecName: Full=DNA replication and repair protein recF;
    1::359     6e-41  36%  385 aa  RECF_HERA2 RecName: Full=DNA replication and repair protein recF;
    1::339     1e-40  33%  364 aa  RECF_GEOBB RecName: Full=DNA replication and repair protein recF;
    1::364     7e-40  31%  397 aa  RECF_CORDI RecName: Full=DNA replication and repair protein recF;
    1::345     9e-40  33%  375 aa  RECF_GLOVI RecName: Full=DNA replication and repair protein recF;
    1::355     1e-39  31%  389 aa  RECF_MYCGI RecName: Full=DNA replication and repair protein recF;
    1::339     1e-39  32%  364 aa  RECF_GEOSM RecName: Full=DNA replication and repair protein recF;
    1::376     8e-39  32%  377 aa  RECF_THEFY RecName: Full=DNA replication and repair protein recF;
    1::303     8e-39  34%  365 aa  RECF_CHLTR RecName: Full=DNA replication and repair protein recF;
    1::303     8e-39  34%  365 aa  RECF_CHLTB RecName: Full=DNA replication and repair protein recF;
    1::303     8e-39  34%  365 aa  RECF_CHLTA RecName: Full=DNA replication and repair protein recF;
    1::303     8e-39  34%  365 aa  RECF_CHLT2 RecName: Full=DNA replication and repair protein recF;
    1::368     1e-38  31%  394 aa  RECF_CORGL RecName: Full=DNA replication and repair protein recF;
    1::354     3e-38  32%  368 aa  RECF_CHLTE RecName: Full=DNA replication and repair protein recF;
    1::351     5e-38  31%  370 aa  RECF_PROA2 RecName: Full=DNA replication and repair protein recF;
    1::368     5e-38  31%  394 aa  RECF_CORGB RecName: Full=DNA replication and repair protein recF;
    1::393     9e-38  32%  396 aa  RECF_THERP RecName: Full=DNA replication and repair protein recF;
    1::346     9e-38  31%  368 aa  RECF_CHLP8 RecName: Full=DNA replication and repair protein recF;
    1::336     9e-38  32%  365 aa  RECF_CHLMU RecName: Full=DNA replication and repair protein recF;
    1::337     1e-37  32%  367 aa  RECF_CHLFF RecName: Full=DNA replication and repair protein recF;
    1::340     1e-37  30%  365 aa  RECF_SYNWW RecName: Full=DNA replication and repair protein recF;
    1::339     1e-37  30%  364 aa  RECF_GEOSF RecName: Full=DNA replication and repair protein recF;
    1::378     2e-37  32%  384 aa  RECF_SYNY3 RecName: Full=DNA replication and repair protein recF;
    1::361     2e-37  29%  368 aa  RECF_GEOLS RecName: Full=DNA replication and repair protein recF;
    1::370     2e-37  31%  398 aa  RECF_COREF RecName: Full=DNA replication and repair protein recF;
    6::337     2e-37  31%  363 aa  RECF_TROWT RecName: Full=DNA replication and repair protein recF;
    6::337     2e-37  31%  363 aa  RECF_TROW8 RecName: Full=DNA replication and repair protein recF;
    1::346     3e-37  30%  363 aa  RECF_CHLL2 RecName: Full=DNA replication and repair protein recF;
    1::307     4e-37  32%  380 aa  RECF_MYCSS RecName: Full=DNA replication and repair protein recF;
    1::307     4e-37  32%  380 aa  RECF_MYCSK RecName: Full=DNA replication and repair protein recF;
    1::307     4e-37  32%  380 aa  RECF_MYCSJ RecName: Full=DNA replication and repair protein recF;
    1::385     4e-37  30%  399 aa  RECF_ARTAT RecName: Full=DNA replication and repair protein recF;
    1::358     6e-37  32%  392 aa  RECF_CORA7 RecName: Full=DNA replication and repair protein recF;
    1::367     9e-37  32%  379 aa  RECF_THEEB RecName: Full=DNA replication and repair protein recF;
    1::344     1e-36  30%  365 aa  RECF_LEPIC RecName: Full=DNA replication and repair protein recF;
    1::344     2e-36  30%  365 aa  RECF_LEPIN RecName: Full=DNA replication and repair protein recF;
    1::386     2e-36  30%  408 aa  RECF_CLAMS RecName: Full=DNA replication and repair protein recF;
    1::359     3e-36  30%  412 aa  RECF_SALRD RecName: Full=DNA replication and repair protein recF;
    1::360     3e-36  31%  386 aa  RECF_MYCVP RecName: Full=DNA replication and repair protein recF;
    1::360     3e-36  31%  385 aa  RECF_LEIXX RecName: Full=DNA replication and repair protein recF;
    1::347     4e-36  30%  371 aa  RECF_PROVI RecName: Full=DNA replication and repair protein recF;
    1::356     4e-36  32%  359 aa  RECF_FLAJ1 RecName: Full=DNA replication and repair protein recF;
    1::344     6e-36  29%  365 aa  RECF_LEPBL RecName: Full=DNA replication and repair protein recF;
    1::344     6e-36  29%  365 aa  RECF_LEPBJ RecName: Full=DNA replication and repair protein recF;
    1::387     6e-36  29%  402 aa  RECF_ARTCA RecName: Full=DNA replication and repair protein recF;
    1::289     1e-35  34%  387 aa  RECF_SYNE7 RecName: Full=DNA replication and repair protein recF;
    1::347     1e-35  30%  369 aa  RECF_PELLD RecName: Full=DNA replication and repair protein recF;
    1::348     2e-35  33%  359 aa  RECF_FLAPJ RecName: Full=DNA replication and repair protein recF;
    1::289     2e-35  34%  387 aa  RECF_SYNP6 RecName: Full=DNA replication and repair protein recF;
    1::297     3e-35  34%  385 aa  RECF_MYCPA RecName: Full=DNA replication and repair protein recF;
    1::349     4e-35  30%  364 aa  RECF_THETN RecName: Full=DNA replication and repair protein recF;
    1::370     4e-35  32%  380 aa  RECF_SYNJB RecName: Full=DNA replication and repair protein recF;
    1::374     4e-35  31%  391 aa  RECF_KINRD RecName: Full=DNA replication and repair protein recF;
    1::333     5e-35  33%  353 aa  RECF_CARHZ RecName: Full=DNA replication and repair protein recF;
    1::370     7e-35  32%  380 aa  RECF_SYNJA RecName: Full=DNA replication and repair protein recF;
    1::354     9e-35  29%  385 aa  RECF_MYCTU RecName: Full=DNA replication and repair protein recF;
    1::354     9e-35  29%  385 aa  RECF_MYCTA RecName: Full=DNA replication and repair protein recF;
    1::375     1e-34  29%  394 aa  RECF_PROAC RecName: Full=DNA replication and repair protein recF;
    1::337     1e-34  30%  367 aa  RECF_CHLCV RecName: Full=DNA replication and repair protein recF;
    1::334     3e-34  32%  363 aa  RECF_PELCD RecName: Full=DNA replication and repair protein recF;
    1::354     7e-34  29%  385 aa  RECF_MYCBT RecName: Full=DNA replication and repair protein recF;
    1::354     7e-34  29%  385 aa  RECF_MYCBO RecName: Full=DNA replication and repair protein recF;
    1::360     2e-33  30%  384 aa  RECF_MYCSM RecName: Full=DNA replication and repair protein recF;
    1::360     2e-33  30%  384 aa  RECF_MYCS2 RecName: Full=DNA replication and repair protein recF;
    1::314     2e-33  31%  388 aa  RECF_NOCFA RecName: Full=DNA replication and repair protein recF;
    1::339     2e-33  29%  365 aa  RECF_GEOSL RecName: Full=DNA replication and repair protein recF;
    4::346     3e-33  30%  359 aa  RECF_DEIRA RecName: Full=DNA replication and repair protein recF;
    1::297     6e-33  33%  385 aa  RECF_MYCA1 RecName: Full=DNA replication and repair protein recF;
    1::364     6e-33  28%  378 aa  RECF_FRAAA RecName: Full=DNA replication and repair protein recF;
    1::375     8e-33  31%  388 aa  RECF_SYNP2 RecName: Full=DNA replication and repair protein recF;
    2::326     8e-33  35%  349 aa  RECF_ACHLI RecName: Full=DNA replication and repair protein recF;
    4::350     1e-32  29%  363 aa  RECF_DEIDV RecName: Full=DNA replication and repair protein recF;
    2::326     1e-32  35%  349 aa  RECF_ACHLA RecName: Full=DNA replication and repair protein recF;
    1::364     2e-32  28%  377 aa  RECF_SALTO RecName: Full=DNA replication and repair protein recF;
    1::344     3e-32  27%  367 aa  RECF_LEPBP RecName: Full=DNA replication and repair protein recF;
    1::344     3e-32  27%  367 aa  RECF_LEPBA RecName: Full=DNA replication and repair protein recF;
    1::297     5e-32  31%  385 aa  RECF_MYCLE RecName: Full=DNA replication and repair protein recF;
    1::297     5e-32  31%  385 aa  RECF_MYCLB RecName: Full=DNA replication and repair protein recF;
    1::363     5e-32  30%  365 aa  RECF_GEOMG RecName: Full=DNA replication and repair protein recF;
    1::384     5e-32  29%  397 aa  RECF_BEUC1 RecName: Full=DNA replication and repair protein recF;
    1::365     7e-32  29%  404 aa  RECF_CLAM3 RecName: Full=DNA replication and repair protein recF;
    1::364     1e-31  28%  376 aa  RECF_SALAI RecName: Full=DNA replication and repair protein recF;
    1::359     1e-31  29%  367 aa  RECF_CHLAB RecName: Full=DNA replication and repair protein recF;
    4::348     2e-31  29%  358 aa  RECF_DEIGD RecName: Full=DNA replication and repair protein recF;
    1::341     3e-31  27%  360 aa  RECF_SHEB2 RecName: Full=DNA replication and repair protein recF;
    1::325     3e-31  32%  410 aa  RECF_RHOSR RecName: Full=DNA replication and repair protein recF;
    1::341     3e-31  27%  360 aa  RECF_SHEB9 RecName: Full=DNA replication and repair protein recF;
    1::341     3e-31  27%  360 aa  RECF_SHEB5 RecName: Full=DNA replication and repair protein recF;
    1::341     5e-31  27%  360 aa  RECF_SHEB8 RecName: Full=DNA replication and repair protein recF;
    1::362     8e-31  30%  364 aa  RECF_XYLFT RecName: Full=DNA replication and repair protein recF;
    1::362     8e-31  30%  364 aa  RECF_XYLF2 RecName: Full=DNA replication and repair protein recF;
    1::329     8e-31  30%  377 aa  RECF_CYTH3 RecName: Full=DNA replication and repair protein recF;
    1::358     8e-31  29%  412 aa  RECF_BIFLI RecName: Full=DNA replication and repair protein recF;
    1::341     1e-30  26%  360 aa  RECF_SHESW RecName: Full=DNA replication and repair protein recF;
    1::341     2e-30  26%  360 aa  RECF_SHEPC RecName: Full=DNA replication and repair protein recF;
    1::354     2e-30  28%  385 aa  RECF_MYCMM RecName: Full=DNA replication and repair protein recF;
    1::391     3e-30  28%  391 aa  RECF_SACEN RecName: Full=DNA replication and repair protein recF;
    1::325     3e-30  31%  410 aa  RECF_RHOOB RecName: Full=DNA replication and repair protein recF;
    1::300     3e-30  31%  380 aa  RECF_MYXXD RecName: Full=DNA replication and repair protein recF;
   17::292     4e-30  32%  359 aa  RECF_GRAFK RecName: Full=DNA replication and repair protein recF;
    1::359     5e-30  29%  403 aa  RECF_BIFAA RecName: Full=DNA replication and repair protein recF;
    1::341     7e-30  26%  360 aa  RECF_SHESR RecName: Full=DNA replication and repair protein recF;
    1::341     1e-29  26%  360 aa  RECF_SHESA RecName: Full=DNA replication and repair protein recF;
    1::354     1e-29  28%  385 aa  RECF_MYCUA RecName: Full=DNA replication and repair protein recF;
    1::341     1e-29  26%  360 aa  RECF_SHESM RecName: Full=DNA replication and repair protein recF;
    1::354     3e-29  31%  354 aa  RECF_IDILO RecName: Full=DNA replication and repair protein recF;
    1::320     4e-29  29%  409 aa  RECF_RHOE4 RecName: Full=DNA replication and repair protein recF;
    1::357     4e-29  30%  359 aa  RECF_PSYIN RecName: Full=DNA replication and repair protein recF;
    1::362     7e-29  29%  364 aa  RECF_XYLFM RecName: Full=DNA replication and repair protein recF;
    1::340     7e-29  29%  368 aa  RECF_XANAC RecName: Full=DNA replication and repair protein recF;
    1::341     9e-29  26%  360 aa  RECF_SHEON RecName: Full=DNA replication and repair protein recF;
    1::362     2e-28  29%  364 aa  RECF_XYLFA RecName: Full=DNA replication and repair protein recF;
    1::340     4e-28  28%  368 aa  RECF_XANC5 RecName: Full=DNA replication and repair protein recF;
    1::291     4e-28  31%  364 aa  RECF_PSEHT RecName: Full=DNA replication and repair protein recF;
    1::340     5e-28  27%  364 aa  RECF_STRM5 RecName: Full=DNA replication and repair protein recF;
    1::286     5e-28  31%  365 aa  RECF_PARD8 RecName: Full=DNA replication and repair protein recF;
    1::340     6e-28  28%  364 aa  RECF_STRMK RecName: Full=DNA replication and repair protein recF;
    1::319     6e-28  30%  366 aa  RECF_OPITP RecName: Full=DNA replication and repair protein recF;
    2::342     1e-27  30%  363 aa  RECF_NITOC RecName: Full=DNA replication and repair protein recF;
    1::358     2e-27  27%  360 aa  RECF_SHEAM RecName: Full=DNA replication and repair protein recF;
    1::338     3e-27  29%  368 aa  RECF_XANCP RecName: Full=DNA replication and repair protein recF;
    1::338     3e-27  29%  368 aa  RECF_XANC8 RecName: Full=DNA replication and repair protein recF;
    1::341     3e-27  26%  360 aa  RECF_SHEPW RecName: Full=DNA replication and repair protein recF;
    1::357     5e-27  26%  360 aa  RECF_SHEPA RecName: Full=DNA replication and repair protein recF;
    1::288     7e-27  29%  364 aa  RECF_PORGI RecName: Full=DNA replication and repair protein recF;
    1::337     9e-27  28%  368 aa  RECF_XANOR RecName: Full=DNA replication and repair protein recF;
    1::330     9e-27  26%  360 aa  RECF_SHEFN RecName: Full=DNA replication and repair protein recF;
    1::288     9e-27  29%  364 aa  RECF_PORG3 RecName: Full=DNA replication and repair protein recF;
    1::336     1e-26  28%  362 aa  RECF_XANOM RecName: Full=DNA replication and repair protein recF;
    1::341     3e-26  25%  365 aa  RECF_SHEWM RecName: Full=DNA replication and repair protein recF;
    1::330     3e-26  26%  360 aa  RECF_SHESH RecName: Full=DNA replication and repair protein recF;
    1::361     7e-26  25%  362 aa  RECF_PROMI RecName: Full=DNA replication and repair protein recF;
    1::361     7e-26  25%  362 aa  RECF_PROMH RecName: Full=DNA replication and repair protein recF;
    1::306     7e-26  29%  404 aa  RECF_MICLC RecName: Full=DNA replication and repair protein recF;
    1::356     1e-25  26%  357 aa  RECF_SHIFL RecName: Full=DNA replication and repair protein recF;
    1::360     1e-25  23%  361 aa  RECF_ERWT9 RecName: Full=DNA replication and repair protein recF;
    1::356     1e-25  26%  357 aa  RECF_ECOSE RecName: Full=DNA replication and repair protein recF;
    1::355     1e-25  25%  361 aa  RECF_YERPY RecName: Full=DNA replication and repair protein recF;
    1::355     1e-25  25%  361 aa  RECF_YERPS RecName: Full=DNA replication and repair protein recF;
    1::355     1e-25  25%  361 aa  RECF_YERPG RecName: Full=DNA replication and repair protein recF;
    1::355     1e-25  25%  361 aa  RECF_YERPE RecName: Full=DNA replication and repair protein recF;
    1::355     1e-25  24%  361 aa  RECF_YERPB RecName: Full=DNA replication and repair protein recF;
    1::355     1e-25  25%  361 aa  RECF_YERP3 RecName: Full=DNA replication and repair protein recF;
    1::356     1e-25  26%  357 aa  RECF_SHIF8 RecName: Full=DNA replication and repair protein recF;
    1::356     1e-25  26%  357 aa  RECF_ECO7I RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_SHIBS RecName: Full=DNA replication and repair protein recF;
    1::341     2e-25  25%  365 aa  RECF_SHEHH RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ESCF3 RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_SHISS RecName: Full=DNA replication and repair protein recF;
    1::355     2e-25  25%  361 aa  RECF_SERP5 RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECOUT RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECOSM RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECOLU RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECOLI RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECOLC RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECOL6 RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECOK1 RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECOHS RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECODH RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECOBW RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECO8A RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECO81 RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECO5E RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECO57 RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECO55 RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECO45 RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECO27 RecName: Full=DNA replication and repair protein recF;
    1::356     2e-25  26%  357 aa  RECF_ECO24 RecName: Full=DNA replication and repair protein recF;
    1::367     2e-25  29%  370 aa  RECF_BACFN RecName: Full=DNA replication and repair protein recF;
    1::272     3e-25  29%  359 aa  RECF_METCA RecName: Full=DNA replication and repair protein recF;
    1::356     3e-25  26%  357 aa  RECF_ECOL5 RecName: Full=DNA replication and repair protein recF;
    1::367     3e-25  29%  370 aa  RECF_BACFR RecName: Full=DNA replication and repair protein recF;
    1::288     3e-25  25%  366 aa  RECF_AZOPC RecName: Full=DNA replication and repair protein recF;
    1::355     4e-25  25%  361 aa  RECF_YERE8 RecName: Full=DNA replication and repair protein recF;
    4::334     4e-25  28%  367 aa  RECF_SACD2 RecName: Full=DNA replication and repair protein recF;
    1::354     4e-25  29%  369 aa  RECF_BACTN RecName: Full=DNA replication and repair protein recF;
    1::333     6e-25  25%  363 aa  RECF_PSEA6 RecName: Full=DNA replication and repair protein recF;
    1::290     8e-25  28%  371 aa  RECF_BACV8 RecName: Full=DNA replication and repair protein recF;
    1::356     1e-24  25%  357 aa  RECF_SHIB3 RecName: Full=DNA replication and repair protein recF;
    1::356     1e-24  26%  357 aa  RECF_SHIDS RecName: Full=DNA replication and repair protein recF;
    1::342     1e-24  31%  373 aa  RECF_MARAV RecName: Full=DNA replication and repair protein recF;
    1::356     2e-24  25%  357 aa  RECF_SALTY RecName: Full=DNA replication and repair protein recF;
    1::356     2e-24  25%  357 aa  RECF_SALPK RecName: Full=DNA replication and repair protein recF;
    1::356     2e-24  25%  357 aa  RECF_SALPA RecName: Full=DNA replication and repair protein recF;
    1::356     2e-24  25%  357 aa  RECF_SALNS RecName: Full=DNA replication and repair protein recF;
    1::356     2e-24  25%  357 aa  RECF_SALHS RecName: Full=DNA replication and repair protein recF;
    1::356     2e-24  25%  357 aa  RECF_SALTI RecName: Full=DNA replication and repair protein recF;
    1::356     2e-24  25%  357 aa  RECF_SALSV RecName: Full=DNA replication and repair protein recF;
    1::356     3e-24  25%  357 aa  RECF_SALPC RecName: Full=DNA replication and repair protein recF;
    1::356     3e-24  25%  357 aa  RECF_SALG2 RecName: Full=DNA replication and repair protein recF;
    1::356     3e-24  25%  357 aa  RECF_SALEP RecName: Full=DNA replication and repair protein recF;
    1::356     3e-24  25%  357 aa  RECF_SALDC RecName: Full=DNA replication and repair protein recF;
    1::356     3e-24  25%  357 aa  RECF_SALCH RecName: Full=DNA replication and repair protein recF;
    1::356     3e-24  25%  357 aa  RECF_SALA4 RecName: Full=DNA replication and repair protein recF;
    1::360     3e-24  27%  360 aa  RECF_ACTPJ RecName: Full=DNA replication and repair protein recF;
    1::341     4e-24  24%  360 aa  RECF_SHELP RecName: Full=DNA replication and repair protein recF;
    1::356     4e-24  25%  357 aa  RECF_SALPB RecName: Full=DNA replication and repair protein recF;
    1::360     4e-24  27%  360 aa  RECF_ACTPL RecName: Full=DNA replication and repair protein recF;
    1::360     4e-24  27%  360 aa  RECF_ACTP2 RecName: Full=DNA replication and repair protein recF;
    1::363     5e-24  25%  364 aa  RECF_SODGL RecName: Full=DNA replication and repair protein recF;
    1::287     5e-24  30%  367 aa  RECF_PSEPF RecName: Full=DNA replication and repair protein recF;
    1::356     7e-24  25%  357 aa  RECF_SALAR RecName: Full=DNA replication and repair protein recF;
    1::320     7e-24  26%  358 aa  RECF_PASMU RecName: Full=DNA replication and repair protein recF;
    1::360     7e-24  27%  360 aa  RECF_ACTP7 RecName: Full=DNA replication and repair protein recF;
    1::287     9e-24  31%  367 aa  RECF_PSEE4 RecName: Full=DNA replication and repair protein recF;
    1::356     9e-24  25%  358 aa  RECF_EDWI9 RecName: Full=DNA replication and repair protein recF;
    1::341     1e-23  26%  360 aa  RECF_SHEDO RecName: Full=DNA replication and repair protein recF;
    1::357     1e-23  26%  363 aa  RECF_PHOLL RecName: Full=DNA replication and repair protein recF;
    1::356     1e-23  25%  357 aa  RECF_CITK8 RecName: Full=DNA replication and repair protein recF;
    1::319     2e-23  30%  360 aa  RECF_THISH RecName: Full=DNA replication and repair protein recF;
    1::287     2e-23  30%  367 aa  RECF_PSESM RecName: Full=DNA replication and repair protein recF;
    4::335     3e-23  29%  378 aa  RECF_TERTT RecName: Full=DNA replication and repair protein recF;
    1::363     3e-23  25%  364 aa  RECF_SODGM RecName: Full=DNA replication and repair protein recF;
    1::287     3e-23  29%  368 aa  RECF_MARMS RecName: Full=DNA replication and repair protein recF;
    1::333     3e-23  25%  359 aa  RECF_HAEIN RecName: Full=DNA replication and repair protein recF;
    1::333     3e-23  26%  360 aa  RECF_HAEDU RecName: Full=DNA replication and repair protein recF;
    3::362     3e-23  26%  362 aa  RECF_THICR RecName: Full=DNA replication and repair protein recF;
    1::356     3e-23  26%  357 aa  RECF_ENTS8 RecName: Full=DNA replication and repair protein recF;
    1::344     5e-23  30%  365 aa  RECF_CELJU RecName: Full=DNA replication and repair protein recF;
    1::287     6e-23  30%  367 aa  RECF_PSEU2 RecName: Full=DNA replication and repair protein recF;
    1::287     6e-23  29%  369 aa  RECF_PSEA8 RecName: Full=DNA replication and repair protein recF;
    1::333     6e-23  25%  359 aa  RECF_HAEI8 RecName: Full=DNA replication and repair protein recF;
    1::287     8e-23  29%  367 aa  RECF_PSEF5 RecName: Full=DNA replication and repair protein recF;
    1::331     8e-23  26%  360 aa  RECF_MANSM RecName: Full=DNA replication and repair protein recF;
    1::340     8e-23  26%  375 aa  RECF_HAHCH RecName: Full=DNA replication and repair protein recF;
    1::358     1e-22  26%  359 aa  RECF_VIBVY RecName: Full=DNA replication and repair protein recF;
    1::287     1e-22  30%  367 aa  RECF_PSEPK RecName: Full=DNA replication and repair protein recF;
    1::287     1e-22  32%  367 aa  RECF_PSEPG RecName: Full=DNA replication and repair protein recF;
    1::287     1e-22  30%  367 aa  RECF_PSEP1 RecName: Full=DNA replication and repair protein recF;
    1::360     1e-22  25%  361 aa  RECF_ERWCT RecName: Full=DNA replication and repair protein recF;
    1::362     1e-22  24%  363 aa  RECF_VIBCM RecName: Full=DNA replication and repair protein recF;
    1::362     1e-22  24%  363 aa  RECF_VIBCH RecName: Full=DNA replication and repair protein recF;
    1::362     1e-22  24%  363 aa  RECF_VIBC3 RecName: Full=DNA replication and repair protein recF;
    1::287     1e-22  29%  369 aa  RECF_PSEAE RecName: Full=DNA replication and repair protein recF;
    1::287     1e-22  29%  369 aa  RECF_PSEAB RecName: Full=DNA replication and repair protein recF;
    1::356     1e-22  27%  357 aa  RECF_ENT38 RecName: Full=DNA replication and repair protein recF;
    1::287     2e-22  29%  369 aa  RECF_PSEA7 RecName: Full=DNA replication and repair protein recF;
    1::288     2e-22  27%  377 aa  RECF_COLP3 RecName: Full=DNA replication and repair protein recF;
    1::358     2e-22  26%  359 aa  RECF_VIBVU RecName: Full=DNA replication and repair protein recF;
    1::360     2e-22  25%  361 aa  RECF_PECCP RecName: Full=DNA replication and repair protein recF;
    1::347     2e-22  26%  358 aa  RECF_ACIAD RecName: Full=DNA replication and repair protein recF;
    1::356     3e-22  24%  357 aa  RECF_KLEP7 RecName: Full=DNA replication and repair protein recF;
    1::347     3e-22  28%  360 aa  RECF_ACIBS RecName: Full=DNA replication and repair protein recF;
    1::356     4e-22  24%  357 aa  RECF_KLEP3 RecName: Full=DNA replication and repair protein recF;
    1::356     5e-22  26%  357 aa  RECF_VIBHB RecName: Full=DNA replication and repair protein recF;
    1::284     5e-22  28%  360 aa  RECF_ACIBY RecName: Full=DNA replication and repair protein recF;
    1::284     5e-22  28%  360 aa  RECF_ACIBT RecName: Full=DNA replication and repair protein recF;
    1::284     5e-22  28%  360 aa  RECF_ACIBC RecName: Full=DNA replication and repair protein recF;
    1::284     5e-22  28%  360 aa  RECF_ACIB5 RecName: Full=DNA replication and repair protein recF;
    1::284     5e-22  28%  360 aa  RECF_ACIB3 RecName: Full=DNA replication and repair protein recF;
    1::356     7e-22  26%  359 aa  RECF_VIBPA RecName: Full=DNA replication and repair protein recF;
    1::358     7e-22  24%  359 aa  RECF_VIBFM RecName: Full=DNA replication and repair protein recF;
    1::287     7e-22  30%  367 aa  RECF_PSE14 RecName: Full=DNA replication and repair protein recF;
    1::343     1e-21  28%  365 aa  RECF_SYNPX RecName: Full=DNA replication and repair protein recF;
    1::334     1e-21  25%  358 aa  RECF_ACTSZ RecName: Full=DNA replication and repair protein recF;
    5::281     4e-21  26%  352 aa  RECF_TREPA RecName: Full=DNA replication and repair protein recF;
    1::331     9e-21  27%  349 aa  RECF_FRAP2 RecName: Full=DNA replication and repair protein recF;
    1::358     1e-20  23%  359 aa  RECF_VIBF1 RecName: Full=DNA replication and repair protein recF;
    1::282     1e-20  31%  365 aa  RECF_PSEPU RecName: Full=DNA replication and repair protein recF;
    1::287     2e-20  29%  367 aa  RECF_PSEFS RecName: Full=DNA replication and repair protein recF;
    1::330     2e-20  24%  358 aa  RECF_HAES2 RecName: Full=DNA replication and repair protein recF;
    1::330     2e-20  24%  358 aa  RECF_HAES1 RecName: Full=DNA replication and repair protein recF;
    1::358     2e-20  23%  359 aa  RECF_VIBSL RecName: Full=DNA replication and repair protein recF;
    1::363     2e-20  28%  365 aa  RECF_PROMM RecName: Full=DNA replication and repair protein recF;
    4::334     2e-20  28%  357 aa  RECF_COXBN RecName: Full=DNA replication and repair protein recF;
    1::358     2e-20  23%  359 aa  RECF_ALISL RecName: Full=DNA replication and repair protein recF;
    4::321     3e-20  28%  357 aa  RECF_COXBU RecName: Full=DNA replication and repair protein recF;
    4::321     3e-20  28%  357 aa  RECF_COXBR RecName: Full=DNA replication and repair protein recF;
    4::321     3e-20  28%  357 aa  RECF_COXB2 RecName: Full=DNA replication and repair protein recF;
    4::321     3e-20  27%  357 aa  RECF_COXB1 RecName: Full=DNA replication and repair protein recF;
    1::342     4e-20  24%  361 aa  RECF_HAEPS RecName: Full=DNA replication and repair protein recF;
    1::299     5e-20  26%  372 aa  RECF_ANAD2 RecName: Full=DNA replication and repair protein recF;
    1::340     1e-19  28%  349 aa  RECF_FRATW RecName: Full=DNA replication and repair protein recF;
    1::340     1e-19  28%  349 aa  RECF_FRATT RecName: Full=DNA replication and repair protein recF;
    1::340     1e-19  28%  349 aa  RECF_FRATM RecName: Full=DNA replication and repair protein recF;
    1::340     1e-19  28%  349 aa  RECF_FRAT1 RecName: Full=DNA replication and repair protein recF;
    1::286     1e-19  29%  361 aa  RECF_CHRSD RecName: Full=DNA replication and repair protein recF;
    1::356     1e-19  28%  364 aa  RECF_SYNSC RecName: Full=DNA replication and repair protein recF;
    1::340     1e-19  28%  349 aa  RECF_FRATN RecName: Full=DNA replication and repair protein recF;
    1::340     2e-19  28%  349 aa  RECF_FRATO RecName: Full=DNA replication and repair protein recF;
    1::340     2e-19  28%  349 aa  RECF_FRATH RecName: Full=DNA replication and repair protein recF;
    1::340     2e-19  28%  349 aa  RECF_FRATF RecName: Full=DNA replication and repair protein recF;
    1::287     5e-19  28%  365 aa  RECF_AZOVD RecName: Full=DNA replication and repair protein recF;
    1::287     2e-18  29%  382 aa  RECF_MAGSM RecName: Full=DNA replication and repair protein recF;
    1::287     2e-18  28%  367 aa  RECF_PSEPW RecName: Full=DNA replication and repair protein recF;
    1::287     3e-18  27%  367 aa  RECF_PSEMY RecName: Full=DNA replication and repair protein recF;
    1::287     6e-17  28%  370 aa  RECF_PSEU5 RecName: Full=DNA replication and repair protein recF;
    9::358     1e-15  25%  360 aa  RECF_RICM5 RecName: Full=DNA replication and repair protein recF;
    1::296     2e-15  35%  369 aa  RECF_ANADF RecName: Full=DNA replication and repair protein recF;
    1::299     2e-15  25%  372 aa  RECF_ANADE RecName: Full=DNA replication and repair protein recF;
    9::358     3e-15  24%  360 aa  RECF_RICAE RecName: Full=DNA replication and repair protein recF;
    9::358     5e-15  24%  360 aa  RECF_RICRS RecName: Full=DNA replication and repair protein recF;
    9::358     5e-15  24%  360 aa  RECF_RICRO RecName: Full=DNA replication and repair protein recF;
    9::358     6e-15  24%  360 aa  RECF_RICPU RecName: Full=DNA replication and repair protein recF;
    9::358     1e-14  25%  360 aa  RECF_RICCK RecName: Full=DNA replication and repair protein recF;
    1::319     1e-14  28%  420 aa  RECF_NOCSJ RecName: Full=DNA replication and repair protein recF;
    9::358     2e-14  24%  360 aa  RECF_RICCN RecName: Full=DNA replication and repair protein recF;
    7::338     2e-14  26%  374 aa  RECF_RHILW RecName: Full=DNA replication and repair protein recF;
    7::338     3e-14  27%  374 aa  RECF_AGRVS RecName: Full=DNA replication and repair protein recF;
    9::358     4e-14  23%  360 aa  RECF_RICAH RecName: Full=DNA replication and repair protein recF;
    9::201     1e-13  28%  360 aa  RECF_RICPR RecName: Full=DNA replication and repair protein recF;
    9::350     1e-13  23%  360 aa  RECF_RICBR RecName: Full=DNA replication and repair protein recF;
    9::350     1e-13  23%  360 aa  RECF_RICB8 RecName: Full=DNA replication and repair protein recF;
    7::338     1e-13  26%  375 aa  RECF_AGRRK RecName: Full=DNA replication and repair protein recF;
    9::358     2e-13  23%  364 aa  RECF_RICFE RecName: Full=DNA replication and repair protein recF;
    7::338     2e-13  25%  374 aa  RECF_RHIL3 RecName: Full=DNA replication and repair protein recF;
    7::338     4e-13  25%  374 aa  RECF_RHIE6 RecName: Full=DNA replication and repair protein recF;
    9::358     6e-13  25%  360 aa  RECF_RICTY RecName: Full=DNA replication and repair protein recF;
   16::202     1e-12  27%  384 aa  RECF_BRUSU RecName: Full=DNA replication and repair protein recF;
    7::338     2e-12  25%  374 aa  RECF_RHIEC RecName: Full=DNA replication and repair protein recF;
   16::202     1e-11  27%  384 aa  RECF_BRUME RecName: Full=DNA replication and repair protein recF;
   16::202     1e-11  27%  384 aa  RECF_BRUAB RecName: Full=DNA replication and repair protein recF;
   16::202     1e-11  27%  384 aa  RECF_BRUA2 RecName: Full=DNA replication and repair protein recF;
    8::340     9e-11  27%  376 aa  RECF_AGRT5 RecName: Full=DNA replication and repair protein recF;
    9::338     4e-10  24%  374 aa  RECF_RHIME RecName: Full=DNA replication and repair protein recF;
    1::299     6e-10  34%  372 aa  RECF_ANASK RecName: Full=DNA replication and repair protein recF;
    7::181     8e-09  30%  379 aa  RECF_RHILO RecName: Full=DNA replication and repair protein recF;
    1::320     3e-08  21%  356 aa  RECF_SPHWW RecName: Full=DNA replication and repair protein recF;
    1::73      5e-07  32%  893 aa  RAD50_HALVO RecName: Full=DNA double-strand break repair rad50
   13::237     2e-06  27% 1065 aa  SMC5_SCHPO RecName: Full=Structural maintenance of chromosomes
    1::62      2e-06  35%  852 aa  RAD50_THEMA RecName: Full=Probable DNA double-strand break repair
  126::220     3e-06  28% 1324 aa  SMC4_SCHPO RecName: Full=Structural maintenance of chromosomes
    1::49      3e-06  41%  883 aa  RAD50_HALSA RecName: Full=DNA double-strand break repair rad50
    1::49      4e-06  39% 1070 aa  RAD50_METMA RecName: Full=DNA double-strand break repair rad50
    1::47      5e-06  38%  879 aa  RAD50_PYRHO RecName: Full=DNA double-strand break repair rad50
    3::101     7e-06  27% 1005 aa  RAD50_METJA RecName: Full=DNA double-strand break repair rad50
   26::107     9e-06  32% 1241 aa  SMC4_ARATH RecName: Full=Structural maintenance of chromosomes
    1::50      9e-06  43% 1437 aa  SMC3_DICDI RecName: Full=Structural maintenance of chromosome
    1::49      9e-06  37% 1074 aa  RAD50_METAC RecName: Full=DNA double-strand break repair rad50
    3::101     2e-05  27% 1233 aa  SMC1_SCHPO RecName: Full=Structural maintenance of chromosomes
   41::198     2e-05  29%  364 aa  RECF_AZOVI RecName: Full=DNA replication and repair protein recF;
    4::57      3e-05  37%  886 aa  RAD50_ARCFU RecName: Full=DNA double-strand break repair rad50
   50::145     3e-05  27%  454 aa  YP245_YEAST RecName: Full=Uncharacterized protein YPL245W;
    1::198     3e-05  25%  882 aa  RAD50_PYRFU RecName: Full=DNA double-strand break repair rad50
    4::49      4e-05  42% 1233 aa  SMC1A_RAT RecName: Full=Structural maintenance of chromosomes
    4::49      4e-05  42% 1233 aa  SMC1A_MOUSE RecName: Full=Structural maintenance of chromosomes
    4::49      4e-05  42% 1233 aa  SMC1A_HUMAN RecName: Full=Structural maintenance of chromosomes
    4::49      4e-05  42% 1233 aa  SMC1A_BOVIN RecName: Full=Structural maintenance of chromosomes
    1::57      4e-05  32%  864 aa  RAD50_SULSO RecName: Full=DNA double-strand break repair rad50
    2::53      4e-05  33%  876 aa  RAD50_METKA RecName: Full=DNA double-strand break repair rad50
    2::47      6e-05  44%  829 aa  VF050_IIV3 RecName: Full=Uncharacterized protein 094L;
    4::49      6e-05  42% 1232 aa  SMC1A_XENLA RecName: Full=Structural maintenance of chromosomes
   44::90      7e-05  34% 1092 aa  SMC5_TAKRU RecName: Full=Structural maintenance of chromosomes
    1::49      7e-05  38% 1171 aa  SMC22_ARATH RecName: Full=Structural maintenance of chromosomes
    1::168     1e-04  28% 1205 aa  SMC_MYCTU RecName: Full=Chromosome partition protein smc;
    9::391     1e-04  26%  392 aa  RECF_CAUSK RecName: Full=DNA replication and repair protein recF;
    1::210     1e-04  25%  895 aa  RAD50_THEVO RecName: Full=DNA double-strand break repair rad50
  156::210     2e-04  36% 1418 aa  SMC4_YEAST RecName: Full=Structural maintenance of chromosomes
  158::228     2e-04  28% 1415 aa  SMC4_DICDI RecName: Full=Structural maintenance of chromosomes
    1::47      2e-04  36%  880 aa  RAD50_PYRAB RecName: Full=DNA double-strand break repair rad50
   31::77      2e-04  32% 1065 aa  SMC5_XENLA RecName: Full=Structural maintenance of chromosomes
   44::88      4e-04  38% 1093 aa  SMC5_YEAST RecName: Full=Structural maintenance of chromosomes
   53::99      4e-04  34% 1101 aa  SMC5_HUMAN RecName: Full=Structural maintenance of chromosomes
    1::49      4e-04  31%  896 aa  RAD50_THEAC RecName: Full=DNA double-strand break repair rad50
    1::168     5e-04  27% 1203 aa  SMC_MYCLE RecName: Full=Chromosome partition protein smc;
    1::49      5e-04  40% 1170 aa  SMC2_YEAST RecName: Full=Structural maintenance of chromosomes
   15::93      5e-04  27%  786 aa  RAD50_NANEQ RecName: Full=DNA double-strand break repair rad50
  467::583     5e-04  29%  623 aa  DXS_CLONN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::49      6e-04  36% 1175 aa  SMC21_ARATH RecName: Full=Structural maintenance of chromosomes
    1::61      6e-04  30%  879 aa  RAD50_SULTO RecName: Full=DNA double-strand break repair rad50
    1::58      6e-04  33%  993 aa  RAD50_METMP RecName: Full=DNA double-strand break repair rad50
    1::49      8e-04  38% 1215 aa  SUDA_EMENI RecName: Full=Chromosome segregation protein
    1::48      8e-04  43% 1193 aa  SMC3_PLAF7 RecName: Full=Structural maintenance of chromosomes
    1::51      8e-04  39%  978 aa  RAD50_AQUAE RecName: Full=Probable DNA double-strand break repair
    1::371

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRVKKLSLRNFRNYKEAQFIPHPSINIITGPNAQGKTNLLEAIYYSLRGCSFRAEKDRDVTNWESNHTVI
RECF_DESRM      MRVKKLSLRNFRNYKEAQFIPHPSINIITGPNAQGKTNLLEAIYYSLRGCSFRAEKDRDVTNWESNHTVI
RECF_PELTS      MLLRRLEMLNFRNFARQAVEPGLYFNVLSGRNAQGKTNILESIYLACTGRSFRTAREKELIKREKEFSSI
RECF_BACCZ      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQI
RECF_BACCR      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQI
RECF_BACC4      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQI
RECF_BACC2      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEEFGQI
RECF_BACWK      MFITEIQLKNYRNYEHLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDYGNI
RECF_BACHK      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQI
RECF_BACCQ      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQI
RECF_BACC7      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQI
RECF_BACC3      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQI
RECF_BACC1      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQI
RECF_BACAH      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQI
RECF_BACC0      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQI
RECF_BACAN      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQI
RECF_BACAC      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQI
RECF_BACAA      MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQI
RECF_BACSU      MYIQNLELTSYRNYDHAELQFENKVNVIIGENAQGKTNLMEAIYVLSMAKSHRTSNDKELIRWDKDYAKI
RECF_BACCN      MFISEIQLKNYRNYEDLNLSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDYGKI
RECF_GEOSW      MFLTHLSLKNYRNYESETIEFANNVNIILGENAQGKTNMMEAIYVLAMAKSHRTTNDKDLIRWDEDYAKI
RECF_BACLD      MYIQNLTLSSYRNYERLDLQFENKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDKELIRWDEDYAKI
RECF_GEOKA      MFLTNLTLTNYRNYEYETLNFGEGVNVILGENAQGKTNMMEAIYVLAMAKSHRTSNDKDLIRWNEEYAKI
RECF_BACSK      MIIHTLELSSYRNYSKTAVVFGEKINVFVGENAQGKTNLLEAIYVVALAKSHRTQKDKEMIGFEEPFARI
RECF_BACA2      MYIQNLELTSYRNYERAELQFENKVNVIIGENAQGKTNLMEAIYVLSMAKSHRTSNDKELIRWDEDYAKI
RECF_LACS1      MYLEKLELKHFRNYEDVNVAFSPQVNVLIGKNAQGKTNLLESIYVLAMARSHRTSNDREMVTFKKDAALI
RECF_PEDPA      MYLKTLELHNFRNYADLVVEFGSGINVLLGENAQGKTNLLESIYFLALTRSHRTNSDRDLISWKTKAARV
RECF_GEOTN      MFLTNLTLTNYRNYEHETLSFDQGVNIILGENAQGKTNMMEAIYVLAMAKSHRTTNDKDLIRWNEDYAKI
RECF_EXISA      MHLKSIRLQNYRNYETLELDFSEQTNVLIGENAQGKTNLLESIYVLALAKSHRTTQDRELIGWEADAASI
RECF_OCEIH      MHIEKLELTNYRNYDQLEIAFDDQINVIIGENAQGKTNLMEAIYVLSFARSHRTPREKELIQWDKDYAKI
RECF_STACT      MKLNALQLENYRNYEEVVLDCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNAEYAKI
RECF_BACP2      MYIQSLALTSYRNYEHTELQFDNKVNVMIGENAQGKTNLMEAIYVLSMAKSHRTSNDKELIRWDQDYAKI
RECF_STAS1      MKLKTLQLQNYRNYESISLNCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFDSDYAKI
RECF_ENTFA      MRLNELTLQHYRNYETVSLDFPKTLNLFLGENAQGKTNLLESIYVLAMTRSHRTSNEKELIGWEQAAAKI
RECF_ALKMQ      MIIEGLKLINFRNYEQLQLQLHPKLNIFVGENAQGKTNVLEAVYLSAIGKSFRTSKDQEMIFVDKHQAYV
RECF_STAES      MKLNTLQLENYRNYEQVTLDCHPEVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFKSDYAKI
RECF_STAEQ      MKLNTLQLENYRNYEQVTLDCHPEVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFKSDYAKI
RECF_STAHJ      MKLKTLQLENYRNYEEVTLECHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNSEYAKI
RECF_HALOH      MYIDRIYLKDFRNLTENLIKLDNRLNVFVGLNGQGKTNFLEAVYLMGTASSHRTNADRELIRWNQDRAVV
RECF_CLOTH      MYIDRILLKNFRNYKDETIKFSKNLNIIYGQNAQGKTNIIEAVFLCASGRSHRTSKDTELVNIDGTGFSV
RECF_CLOTE      MYVKYLKLINFRNYKELNIELDKNINVFIGNNAQGKTNVLESIYYASIGRSHRTSKDKELIKWQESNSYI
RECF_MACCJ      MKLKTLTLTHYRNYETAELNFSDEVNIFIGINAQGKTNLLEAIYCLAMAKSHRTSNDKELIGWGHEFSHI
RECF_LACJO      MYLANFELKDFRNFEELKINFDPHVNIFIGPNAQGKTNLLEAIYFLALTRSHRTNSDKELIRFGSKFAGL
RECF_LACGA      MYLANFELKDFRNFKELKTDFDPHVNIFIGPNAQGKTNLLEAIYFLALTRSHRTNSDKELIRFGSKFAGL
RECF_OENOB      MFLNSLKLKDFRNYKSLQVDFSNSINVLIGDNAQGKTNLLEAIYILSMARSHRDNNDRDLINWSSDFSDI
RECF_LACC3      MKLDHLVLKNYRNYAAVDTTFSPEINVLIGANAQGKTNLLESIYVLALARSHRTNNDKELIRFGSEFARV
RECF_LACCB      MKLDHLVLKNYRNYAAVDTTFSPEINVLIGANAQGKTNLLESIYVLALARSHRTNNDKELIRFGSEFARV
RECF_LACSS      MYLSELQLNHYRNYESVDVHFSPDTNVLIGENAQGKTNLLEAIYVLALARSHRTNTDRELIQWHEDFAKI
RECF_EXIS2      MRLDSVRLSHYRNYESLELSFSEKTNVLIGENAQGKTNLLEAIYVLALAKSHRTTHDKELIQWDAETARV
RECF_BREBN      MFLKNLSLTNYRNYETMSLSFDGPIQLFIGNNAQGKTNALESIYVLALAKSHRTPRDKELISWDADYATI
RECF_DESAP      MRLTRIKAGNFRNFQHLDVQPAAGLNIVRGRNAQGKTNFIEAVFFALRGHSFRSLRDRELVTWGQESAFV
RECF_LEUCK      MELTSLKLVNYRNYANLELDFSPGVNVFLGENAQGKTNLLESIYVLALARSHRTSSDKDLINWTAKETTI
RECF_LEUMM      MELESLKLDHYRNYSDLTLEFSSGVNVFLGENAQGKTNLLESIYVLALARSHRTSSDKDLVQWQAKEATI
RECF_LACBA      MYLQELQLQQFRNYPTAKLTFGQGINVLLGENAQGKTNLLEAIYVLALTRSHRTANDHDLVNWQAKTAKV
RECF_STAAW      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_STAAU      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_STAAT      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_STAAS      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_STAAR      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_STAAN      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_STAAM      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_STAAE      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_STAAC      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_STAA9      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_STAA8      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_STAA2      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_STAA1      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_HELMI      MQIQAIELAHFRNYRGLQVDFMPGVNIFVGANGQGKTNLLESIALLSGGGSHRDARDAEMVQWQEAYYRI
RECF_STAAB      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_STAA3      MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKI
RECF_LACRJ      MILTELHLHHFRNYQDLTVHFNPGVNVLIGHNAQGKTNMLEAIYVLSLTKSHRTSNDHELINWQEKSALI
RECF_LACRD      MILTELHLHHFRNYQDLTVHFNPGVNVLIGHNAQGKTNMLEAIYVLSLTKSHRTSNDHELINWQEKSALI
RECF_LACPL      MYLENLVLHDFRNYADLTINFSQGVNVLLGENAQGKTNLLEAIYVLALTRSHRTANDKELIRWQTTTATL
RECF_ALKOO      MIVEELKLINYRNYEQMNLKFHPRLNVFIGDNAQGKTNLIESIYLCSAGKSFRTNHDQELINMNKKQAYI
RECF_LISMO      MHLESIVLRNFRNYENLELEFSPSVNVFLGENAQGKTNLLEAVLMLALAKSHRTTNDKDFIMWEKEEAKM
RECF_LISMF      MHLESIVLRNFRNYENLELEFSPSVNVFLGENAQGKTNLLEAVLMLALAKSHRTTNDKDFIMWEKEEAKM
RECF_LISMC      MHLESIVLRNFRNYENLELEFSPSVNVFLGENAQGKTNLLEAVLMLALAKSHRTTNDKDFIMWEKEEAKM
RECF_BACHD      MHIERLTLKQFRNYDELDVSFEPNVNVIIGENAQGKTNVIEAIYFLALAKSHRTARDKELIQWEAPFARI
RECF_LISMH      MHLESIVLRNFRNYENLELEFSPSVNVFLGENAQGKTNLLEAVLMLALAKSHRTTNDKDFIMWEKEEAKM
RECF_LISIN      MHLESIVLRNFRNYENLELEFSPSVNVFLGENAQGKTNLLEAVLMLALAKSHRTTNDKDFIMWEKEEAKM
RECF_LISW6      MHLESIVLRNFRNYENLELEFSPSVNVFLGENAQGKTNLLEAVLMLALAKSHRTTNDKDFIMWEKEEAKM
RECF_CLONN      MYIKNLELINFRNYEILSLKLHSGINVFIGDNAQGKTNILESIYYCSIGKSHRTNKDKELIKWGARDAYI
RECF_CLOBM      MYIKSVHLINFRNYDDMYLELSPNTNIFVGNNAQGKTNILESIYYSSIGKSHRTNKDKDLIKWDKNNTYL
RECF_CLOPH      MIVKSLELSNFRNYENLSLEFSPSTNILYGDNAQGKTNILEAVFLCATTKSHKGSKDREIIKLQSEEAHI
RECF_LACLA      MKLKAIELKNFRNYEELKLDFHPNLNIFLGQNAQGKTNILEAIHFLALTRSHRTSHDKELISWSQQEMKV
RECF_LYSSC      MHIEQIKLTNYRNYDALALNFSPKINVFIGENAQGKTNVMESIYVLAMAKSHRTTNDKELIRWDSDYGKI
RECF_LACF3      MILQELQLSHYRNYEELAVTFAPGINVLIGENAQGKTNLLEAIYLLAFTKSHRTAKDRELIGWHQKLARV
RECF_LACLM      MKLKQIELKNFRNYEDLKLDFHPNLNIFLGQNAQGKTNILEAIHFLALTRSHRTSHDKELIRWSGQEMKV
RECF_LACAC      MYLDHLTVQNFRNLKKLDVDFDPNVNIFIGKNAQGKTNLLEAIYFLALTRSHRTSSDRDLIGFDGEYTNL
RECF_NATTJ      MKLTELCLKNFRNYSNLKLNFKKPIILFFGANAQGKTNLLEAIYYLATGKSHRAQKEKELIRWETSGFYL
RECF_LACLS      MKLKQIELKNFRNYEDLKLDFHPNLNIFLGQNAQGKTNILEAIHFLALTRSHRTSHDKELICWSGQEMKV
RECF_EUBR3      MIIKSIQLSNFRNYEKLDISFDTETNIIYGDNAQGKTNILEAAYLSGTTKSHKGSKDKEMIRFGEDEAHI
RECF_STREM      MWIKELNLTHYRNYQQASAAFSPGLNVFIGDNAQGKTNFLEAIYFLSVTRSHRTKSDKDLIYFDERDCSI
RECF_STRGC      MWLKSLTLKHFRNYQDAEINFHSGLNIFLGQNAQGKTNILESIYFLALTRSHRTRSDKDFIHFQEKDLKV
RECF_STRE4      MWIKELNLTHYRNYQQASAAFSPGLNVFIGDNAQGKTNFLEAIYFLSVTRSHRTKSDKDLIYFDERDCSI
RECF_STRS7      MWIKELNLTHYRNYQQASAAFSPGLNVFIGDNAQGKTNFLEAIYFLSVTRSHRTKSDKDLIYFDERDCSI
RECF_STRSV      MWLQSLKIKHFRNYQEADIDFHPGLNVFLGQNAQGKTNILEAIYFLALTRSHRTRSDKDLIHFTENDLLV
RECF_CLOD6      MKLKSLQLVNFRNYKKLHLEFNGKVNLLVGKNGQGKTNIVESIYMLSFGKSFRTNKDKEMVRFNSENLYI
RECF_STRMU      MWIEKINLKHYRNYTAIESEFSQSLNVFVGQNAQGKTNFLEAIYFLSLTRSHRTRSDKELIQFGQKELNV
RECF_STRA1      MWIKNISLKHYRNYEEAQVDFSPNLNIFIGRNAQGKTNFLEAIYFLALTRSHRTRSDKELVHFKHHDVQI
RECF_CLOK5      MYIKYLKLINFRNYKELDIEFDKNINIFVGDNAQGKTNILESMYYCSIGKSPRTSKDKELINWDNKESYI
RECF_CLOBK      MYIKNVHLINFRNYDDMYLELSPNTNIFVGNNAQGKTNILESIYYSSIGKSHRTNKDKDLIKWDKNNTYL
RECF_CLOBJ      MYIKNVHLINFRNYDDMYLELSPNTNIFVGNNAQGKTNILESIYYSSIGKSHRTNKDKDLIKWDKNNTYL
RECF_CLOB6      MYIKNVHLINFRNYDDMYLELSPNTNIFVGNNAQGKTNILESIYYSSIGKSHRTNKDKDLIKWDKNNTYL
RECF_CLOB1      MYIKNVHLINFRNYDDMYLELSPNTNIFVGNNAQGKTNILESIYYSSIGKSHRTNKDKDLIKWDKNNTYL
RECF_STRU0      MWIKELQLRNFRNYGTVDTEFSPGLNVFIGNNAQGKTNFLEAIYFLALTRSHRTRTDKELIQFSKNNLQL
RECF_STRA5      MWIKNISLKHYRNYEEAQVDFSPNLNIFIGRNAQGKTNFLEAIYFLALTRSHRTRSDKELVHFKHHDVQI
RECF_STRA3      MWIKNISLKHYRNYEEAQVDFSPNLNIFIGRNAQGKTNFLEAIYFLALTRSHRTRSDKELVHFKHHDVQI
RECF_LACH4      -------VQNFRNLKKLDIDFDPNVNIFIGKNAQGKTNLLEAIYFLALTRSHRTNSDKELIGFGGEYTNL
RECF_LACDB      MYLSRFKQSGFRNLAPLNLEFDPHVNVFLGENAQGKTNLLEAIYFLAISRSHRTSNDREMIAFGQDFASL
RECF_CLOBL      MYIKNVHLINFRNYDDMYLELSPNTNIFVGNNAQGKTNILESIYYSSIGKSHRTNKDKDLIKWDKNNTYL
RECF_STRZJ      MWLQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIHFDEEQLHL
RECF_STRPJ      MWLQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIHFDEEQLHL
RECF_STRP7      MWLQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIHFDEEQLHL
RECF_STRP4      MWLQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIHFDEEQLHL
RECF_LACDA      MYLSRFKQSGFRNLAPLNLEFDPHVNVFLGENAQGKTNLLEAIYFLAISRSHRTSNDREMIAFGQDFASL
RECF_MOOTA      LSLQQLQLINFRSYKCLTWDCRPGLNIIFGPNAAGKTNLLEAIGYLALARSFRQQQDQQLLTWGASSFQV
RECF_CLOAB      MYIKNLYLDNFRNYDNIEIDFNKKVNILTGNNAQGKTNILESIFYCSLGKSHRTNKDKELIKWDKDEAFI
RECF_STRZT      MWLQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIHFDEEQLHL
RECF_STRZP      MWLQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIHFDEEQLHL
RECF_STRR6      MWLQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIHFDEEQLHL
RECF_STRPN      MWLQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIHFDEEQLHL
RECF_STRPI      MWLQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIHFDEEQLHL
RECF_STRP2      MWLQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIHFDEEQLHL
RECF_STRPS      MWLQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTQTDKNLIHFDEEQLHL
RECF_STRPZ      MWIKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIHFDHSTVSL
RECF_STRP3      MWIKELELKHYRNYDQLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSQRTRADKELIHFDHSTVSL
RECF_STRPG      MWIKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIHFDHSTVSL
RECF_STRPD      MWIKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIHFDHSTVSL
RECF_STRP8      MWIKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIHFDHSTVSL
RECF_STRP6      MWIKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIHFDHSTVSL
RECF_STRPF      MWIKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIHFDHSTVSL
RECF_STRP1      MWIKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIHFDHSTVSL
RECF_STRPC      MWIKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIHFDHSTVSL
RECF_STRPM      MWIKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIHFDHSTVSL
RECF_STRPB      MWIKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIHFDHSTVSL
RECF_EUBE2      MIVESVELKDFRNYEFLDMNFNEHVNIIYGDNAQGKTNILESIYMCSTSKSHRGSKDREIVRFGEDESHI
RECF_CLOPS      MYIKSLQLINYRNYENLSIKLCPNVNVFIGDNAQGKTNVIEAIYYCGFAKSHRTNRDKELIEWNKDRAFI
RECF_CLOPE      MYIKSLQLINYRNYENLSIKLCPNVNVFIGDNAQGKTNVIEAIYYCGFAKSHRTNRDKELIEWNKDRAFI
RECF_CLOP1      MYIKSLQLINYRNYENLSIKLCPNVNVFIGDNAQGKTNVIEAIYYCGFAKSHRTNRDKELIEWNKDRAFI
RECF_STRTD      MWLEKIDIQHFRNYSEASVSFSPHLNIFLGRNAQGKTNILEAIYFLALTRSHRTHLDKELIQFQQNSLKL
RECF_STRT1      MWLEKIDIQHFRNYSEASVSFSPHLNIFLGRNAQGKTNILEAIYFLALTRSHRTHLDKELIQFQQNSLKL
RECF_STRT2      MWLEKIDIQHFRNYSEASVSFSPHLNIFLGRNAQGKTNILEAIYFLALTRSHRTHLDKELIQFQQNSLKL
RECF_CLOB8      MYVKNINLLNYRNYKKLSVELTENVNVFVGDNAQGKTNILESVYYCAFAKSHRTSKDKELINWENSTAYI
RECF_DESHY      MEIKWLHLKSFRNYQDQEVDFRPGLTILQGENGQGKTNILEGIYYLLTGKSYRVHREQELARWGENEFHL
RECF_DESHD      MEIKWLHLKSFRNYQDQEVDFRPGLTILQGENGQGKTNILEGIYYLLTGKSYRVHREQELARWGENEFHL
RECF_CLOCE      MIVKNLVLENYRNHTNTRILFSDRFNIFYGDNGQGKTNILEAIYLCASGRSHRTSRDSELIKFGCENFSI
RECF_STRSY      MWLERLELQHFRNYNQLDIEFHKGLNVFLGENAQGKTNILESIYVLALTRSHRTRTDKDLLQFQEKELSI
RECF_STRS2      MWLERLELQHFRNYNQLDIEFHKGLNVFLGENAQGKTNILESIYVLALTRSHRTRTDKDLLQFQEKELSI
RECF_ACAM1      MYLQQLHLIQFRNYVAQQVEFSAPKTILVGPNAQGKSNLLEAVELLSTLKSHRVSRDRDLVKDGESLSQV
RECF_CHLAD      MYIHHLALRDFRNYRRQDVALSPTTILLYGPNAAGKTSLLEAIFYLATTRSPRLSSDRDLVRWDAVGEAV
RECF_GEOUR      MKLNKIYLLSFRNLEKIELTPAHRFNIFYGKNAQGKTNLLESIFLLGTMKSFKMAKNSEMVRWGSDQSLI
RECF_CYAA5      MYLKHIHLYGFRNYHEQTLDLQSQKTILLGNNAQGKSNLLEAVELLATLKSHRTNRDRDLIGKKTGQILA
RECF_THEPX      MYVKELFVDNFRNLQKQKIEFCEGINIFYGLNAQGKSNLLESIRLLSMGRSFRGSKTTELIKFGEDYFYV
RECF_THEP3      MYVKELFVDNFRNLQKQKIEFCEGINIFYGLNAQGKSNLLESIRLLSMGRSFRGSKTTELIKFGEDYFYV
RECF_SYMTH      MYLSTLQLGAFRNYDSLTIHFSPGLNVLYGDNAQGKTNLLEAIHFLATGRSHRTSRDPDMVQEGREELLA
RECF_ROSCS      MYVTHLSLRDFRNYERLDLNLEPGVTLLYGPNAAGKTTVLEAIYFLATTRSPRAGADRELVRFEAQGDLL
RECF_STRGG      MHVTHLSLADFRSYARVEVPLDPGVTAFVGPNGQGKTNLVEAVGYLATLGSHRVSSDAPLVRMGAERAVI
RECF_NOSP7      MYLKTLNLRQFRNYQDQKVEFTAAKTILVGNNAQGKSNLLEAVELLATLRSHRMTRDRDLVQEGEAIAQI
RECF_STRAW      MHVTHLSLADFRSYARVEVPLDPGVTAFVGPNGQGKTNLVEAVGYLATLGSHRVSSDAPLVRMGAERAII
RECF_CYAP8      MYLKTLHLSAFRNYREQQIEFDHQKTILLGNNAQGKSNVLEAVELLATLKSHRTNRDRDFILEGETIGQI
RECF_ANASP      MYLKTLHLRHFRNYYDQKVEFTAAKTILVGNNAQGKSNLLEAVELLATLRSHRMARDRDFVQEEEPVAQI
RECF_TRIEI      MYLKHLHLRQFRNYRDQQVKFDGAKTILLGDNAQGKSNLLESVELLSTLKSHRAIRDRDLILDSKQASKI
RECF_CHLSY      MYVHHLFLRDFRNYRRLDLALAPATTLFYGPNAAGKTSLLEAIFYLATTRSPRLSSDRELVRWDAVGEAI
RECF_CHLAA      MYVHHLFLRDFRNYRRLDLALAPATTLFYGPNAAGKTSLLEAIFYLATTRSPRLSSDRELVRWDAVGEAI
RECF_STRCO      MHVTHLSLADFRSYARVEVPLDPGVTAFVGPNGQGKTNLVEAVGYLATLGSHRVSSDAPLVRMGAERAVI
RECF_CLOBB      ------------------------VNVFIGDNAQGKTNVLESIYYCAFAKSHRTSRDKDLINWKENEAYI
RECF_CHLT3      MKLFKLSIHGFRSHQDAVFLPHDGINLIYGKNGTGKTNLLEAIHYTCLTKSFLSTSDSDALHFQAGHFEL
RECF_PARUW      MTLRSLYLQHFRNYEEAYLEFSPQFNLICGPNAKGKTTLLEAIHCLMIGRSFRTSHYPDLIQQQFESFFL
RECF_CYAP4      MYLKSLQLRYFRNYREQVIDFAAPKTILVGQNAQGKSNLLEAVELLSTLRSHRSHRDREVLSGQENGQII
RECF_CHLPB      MRLQEIQLVNFRKHKELVFAPSEAITVVYGPNGSGKTNILEAVHYCTLARGLNRSLDRECLNFDAGYFLL
RECF_RENSM      MYLEQLSLTDFRSYQQADLGLEPGVNVFIGSNGLGKTNLVEALGYLASLSSHRVSQDGPLIRFGAEQALI
RECF_CLOBA      ------------------------VNVFIGDNAQGKTNVLESIYYCAFAKSHRTSRDKDLINWKENEAYI
RECF_ARTS2      MYLEKLSLTDFRSYAQVDLTLEPGVTVLVGYNGIGKTNLMEAIGYLATLSSHRVSSDAPLLRFGTERALI
RECF_CYAP7      MYLKTVQLRSFRNYREQQVNFESQKTIIVGNNAQGKSNLLEAVELLATLKSHRVSRDRDLVLEGATTGQI
RECF_MICAN      MYLEHLHLHSFRNYAEQVLKFESKKTILLGNNAQGKSNLLEAIELLATLKSHRVSKDRDLVLESDSEARI
RECF_ANAVT      MYLKTLHLRHFRNYYDQKVEFTAAKTILVGNNAQGKSNLLEAVELLATLRSHRMARDRDLVQEEEPLAQI
RECF_CORJK      MYVSNLRLSNYRSWEELDLQLSPGITIFSGPNGHGKTNIVEALGYLAHLSSHRVNSDAAVRRGEEIANIS
RECF_ACIC1      MYLSRLELTDFRSYRRAALELDPGVNVFVGSNGQGKTNLVEAVCYLALLRSHRTATDAPLVRQGSERAVL
RECF_HERA2      MYVSRLQLQDFRIYRSLNLALPPGVCLFYGANAAGKTTILEALYYLATTRSLRASVERELIALEAAGDLP
RECF_GEOBB      MKLIKLKLASFRNLQNIELAPGKKFNVFYGNNGQGKTNLLESIYLLATMKSFKQARNAELIAFAGEFALV
RECF_CORDI      MYIRELSLRDFRSWPECTVTLEPGVTLFVGRNGFGKTNIVEAIGYVAHLGSHRVFHDSAVRQGKESARVS
RECF_GLOVI      MFLRSVQLHDFRNYAEADLELTSPKTILVGDNAQGKSNLLEAVQLLATGRSTRALRDRELIARGKEQARV
RECF_MYCGI      MYVRHLALTDFRSWSRVELELSPGRTVFVGPNGFGKTNLVEALWYSATLGSHRVASDAPLIRAGAERAVV
RECF_GEOSM      MKLIKLKLASFRNLQNIELAPGKKFNVFYGNNGQGKTNLLESIYLLATMKSFKQARNAELIAFGGEFALV
RECF_THEFY      MHVSHLQLADYRSYEAAYLELEPGVSTFIGPNGQGKTNLVEAIGYVATHSSHRVAHDAPLXXXXXXXXXX
RECF_CHLTR      MRVLSLFLKDFRNYTDLRLELGPEMNSIFGLNAQGKTNLLEALYILSLGRSFRTSRLTDAIRFGASHFFI
RECF_CHLTB      MRVLSLFLKDFRNYTDLRLELGPEMNSIFGLNAQGKTNLLEALYILSLGRSFRTSRLTDAIRFGASHFFI
RECF_CHLTA      MRVLSLFLKDFRNYTDLRLELGPEMNSIFGLNAQGKTNLLEALYILSLGRSFRTSRLTDAIRFGASHFFI
RECF_CHLT2      MRVLSLFLKDFRNYTDLRLELGPEMNSIFGLNAQGKTNLLEALYILSLGRSFRTSRLTDAIRFGASHFFI
RECF_CORGL      MHIRSLELRDYRSWPELKVDLEPGITVFIGRNGFGKTNIVEAIGYLAHLSSHRVSSDAPLVRAHAENARV
RECF_CHLTE      MRLDSISIANFRNHTLLEFEPGHSITNIYGRNGSGKTSILEAIHYCALTRGFSGNNDREYLKFGEELFTI
RECF_PROA2      MRLDEIKIQNFRKHSELIFSPSEGINLIFGPNGSGKTNILEAIHYCALTKGFNRTTDRQCMNFSAESFLL
RECF_CORGB      MHIRSLELRDYRSWPELKVDLEPGITVFIGRNGFGKTNIVEAIGYLAHLSSHRVSSDAPLVRAHAENARV
RECF_THERP      MLVRSLELEEFRCFRHLHLVPDRGLRLV-GANGSGKTSLIEALYMLATTKSFRASLERHLVHRSSGSELL
RECF_CHLP8      MRLDSISIANFRNHTLLEFEPGHSVTNIYGRNGSGKTSILEAIHYCALTRGFSGNNDREYLKFGEELFTI
RECF_CHLMU      MRVHSLFLKDFRNYSELRLELGPEMNSIFGLNAQGKTNILEALYILSLGRSFRTSRLTEAIRFGSSHFFI
RECF_CHLFF      MNILSLRLKNFRNYKEAKISLSPNMNYIFGENAQGKTNLLEALYVLSLGRSFRTSHLTEAISFGSAYFFL
RECF_SYNWW      MKILKFQIKDFRNLKKIEYQPSPGLNIFYGENAQGKTNILEALYYLATGNSFRSNKEKTLISYESSSLQV
RECF_GEOSF      MKLNKIYLQSFRNLQETMLMPAQHFNIFYGNNGQGKTNLLESIFIMATMKSFKTARSSDLVRWGAISSLL
RECF_SYNY3      MYLKKLYLRAFRNYLEEEVEFSAQKTILVGNNAQGKSNLLEAVELLATLKSHRTSRDQELVLDGAANGQI
RECF_GEOLS      MFLKQVWLEQYRNIQKACIQPARHLTVLYGRNGQGKTNFLESLYLLGNARPFRAAKVPDLISHGSRSXXX
RECF_COREF      MYIRSLELRDFRSWPELKVELKPGITIFIGRNGFGKTNIVEAIGYLAHLSSHRVSTDAPLVRANAGDAAV
RECF_TROWT      --ISHINLRNFRNYEYQSISFTDGLNLIRGDNGQGKTNLAEAIYFLSGFGSHRTYKNQPLIKSGEQKAEI
RECF_TROW8      --ISHINLRNFRNYEYQSISFTDGLNLIRGDNGQGKTNLAEAIYFLSGFGSHRTYKNQPLIKSGEQKAEI
RECF_CHLL2      MKIEQIQLVQFRNHKNLSYGPAEGINLLYGPNGSGKTSVLEGIHYCALTKGFVTAYDSECLAFGESFFLI
RECF_MYCSS      MFVRHLTLTDFRSWARADLELEPGRTVFVGPNGFGKTNLVEALWYSATLGSHRVASDAPLIRVGAPRAVV
RECF_MYCSK      MFVRHLTLTDFRSWARADLELEPGRTVFVGPNGFGKTNLVEALWYSATLGSHRVASDAPLIRVGAPRAVV
RECF_MYCSJ      MFVRHLTLTDFRSWARADLELEPGRTVFVGPNGFGKTNLVEALWYSATLGSHRVASDAPLIRAGAPRAVV
RECF_ARTAT      MYLEHLSLTDFRSYAQVDLKLGPGVTVLVGSNGIGKTNLMEAIGYLATLSSHRVSTDAPLLRFGTERALI
RECF_CORA7      MYIRDLDVRDFRSWPELTLRLKPGITLFVGRNGFGKTNIVEAIGYTAHLSSHRVAHDAPLVNARISATAV
RECF_THEEB      MFLKSLHLRHFRNYSEQSVTFAAPKTILVGDNAQGKSNLLEAVEWLATLQSHRTHRDRDLI--QQGHESA
RECF_LEPIC      MFLKHLTIQNFRNHEELSLDFDSRLIFFVGDNGEGKTNLLEAICILSWLKSFRESEDSNLIRWGSENYFL
RECF_LEPIN      MFLKHLTIQNFRNHEELSLDFDSRLIFFVGDNGEGKTNLLEAICILSWLKSFRESEDSNLIRWGSENYFL
RECF_CLAMS      MIVRHLSLGDFRNYTRADVALLPGATLFVGSNGQGKTNLVEALGFLSTLGSHRVSTDQALVRQGAESAVI
RECF_SALRD      MILHTLRLRSFRAHAESEFDLAPSINLLYGANGAGKTNVLEAVHYLCLTKSFTASRDRYAVRKDAPYFEI
RECF_MYCVP      MYVRHLALTDFRSWARVELELEPGRTVFVGSNGFGKTNLIEALWYSATLGSHRVASDAPLIRAGAERAVV
RECF_LEIXX      MRVTHLSLTDFRNYGTAEVHFEAGANLFVGRNGQGKTNLVESLGYLSALGSHRVSSDQAMIRQGAELAVV
RECF_PROVI      MRLRSIQFENFRNHRSFSFEPEDGINLIYGQNGSGKTSILEGIHYCALTKGFVSAADGECLSFSAGYFLL
RECF_FLAJ1      MHLNKLSLFNYKNFSEAGFDFDIKINCFVGKNGIGKTNVLDAIYHLAYGKSYFNPLAVQNIKHGEEFFVI
RECF_LEPBL      MFLKHLTLQNFRSYEELSLDFNSRLIFFVGDNGEGKTNLLEAICMLSWLKSFRESEDSNLIRWGSENYFL
RECF_LEPBJ      MFLKHLTLQNFRSYEELSLDFNSRLIFFVGDNGEGKTNLLEAICMLSWLKSFRESEDSNLIRWGSENYFL
RECF_ARTCA      MYLEHLSLTDFRSYAQVDLVLSPGVTVLVGYNGIGKTNLMEAIGYLATLSSHRVSSDGPLLRFGTERALV
RECF_SYNE7      MFLHSLHLQHFRNYRDQTVQFQAPKTILLGENAQGKTNLLEAVELFSTLRSHRVSRDRDLVQTGAESALL
RECF_PELLD      MRLKNIQVENFRNHHSLAFQPEEGITVLYGPNGSGKTSVLEAIHYCALTKSLLGAPESECLAFSEEYFII
RECF_FLAPJ      MYLKKISLFNFKNFSDTSFNFEHKINCFVGKNGVGKTNVLDAIYHLSFGKSYFNTLAVQNIKHDEDFFVI
RECF_SYNP6      MFLHSLHLQHFRNYRDQTVQFQAPKTILLGENAQGKTNLLEAVELFSTLRSHRVSRDRDLVQTGAESALL
RECF_MYCPA      MYVRHLGLRDFRSWAHADLELQPGRTVFIGSNGFGKTNLLEALWYSSTLGSHRVGTDAPLIRAGADRAVV
RECF_THETN      MYLKEIFVDNFRNLKKQKLEFCEGVNLIYGLNAQGKSNLLEAIRLLSMGRSFRGSKMSELVKFDEEYFYV
RECF_SYNJB      MYLRSLHLRHFRNYRDQEITFDAPKTILVGENAQGKTNLLEAVXXXXXXXXXXXXXXXXXVYQEERQAQI
RECF_KINRD      MHVAHLSLVDYRSYPTLELDLRPGTTTFVGLNGQGKTNLVEAIGYVATLGSHRVSGDAPLVRQGAERAVV
RECF_CARHZ      MFVDRLQLLNFRNYEELLIDFSPGKILIYGANGQGKTNLIEAIYYLVIGKSFRG-KDNSLIRFGAESFQI
RECF_SYNJA      MYLRFLHLWHFRNYRDQKISFEAPKTILVGENAQGKTNLLEAVELLATLRSRRAGRDRELVQQGAEKARI
RECF_MYCTU      MYVRHLGLRDFRSWACVDLELHPGRTVFVGPNGYGKTNLIEALWYSTTLGSHRVSADLPLIRVGTDRAVI
RECF_MYCTA      MYVRHLGLRDFRSWACVDLELHPGRTVFVGPNGYGKTNLIEALWYSTTLGSHRVSADLPLIRVGTDRAVI
RECF_PROAC      MFVEHLELVDFRSYVRADVPMAAGATTFIGSNGQGKTNLVEAVEYLSTLSSHRVSNDTPLVRLGADQAVV
RECF_CHLCV      MKILSLRLKNFRNYKEAEVSLSPDMNYIFGENAQGKTNLLEALYVLSLGRSFRTTHLTEAIFFGSSHFFL
RECF_PELCD      MILTRIILHNYRNIEAAELCPEENFNLLCGDNAQGKTNTLEAIYLLGHFKSFRRGRNEELIGSADRHTRV
RECF_MYCBT      MYVRHLGLRDFRSWACVDLELHPGRTVFVGPNGYGKTNLIEALWYSTTLGSHRVSADLPLIRVGTDRAVI
RECF_MYCBO      MYVRHLGLRDFRSWACVDLELHPGRTVFVGPNGYGKTNLIEALWYSTTLGSHRVSADLPLIRVGTDRAVI
RECF_MYCSM      MFARHLGLTDFRSWARVDLDLEPGRTVFVGPNGFGKTNLVEALWYSATLGSHRVATDAPLIRAGAERAIV
RECF_MYCS2      MFARHLGLTDFRSWARVDLDLEPGRTVFVGPNGFGKTNLVEALWYSATLGSHRVATDAPLIRAGAERAIV
RECF_NOCFA      MFVRALSLRDFRSWEHVELELSTGRTVFLGANGNGKTNLLEAVGYLATLGSHRVSADAPLIRSGAQRARV
RECF_GEOSL      MHLNAIAISAFRNIDHVEISFDRRFNVLHGANGQGKTSVLEAIYLLGTMKSFRMAKAHDLIAWNAPHSLV
RECF_DEIRA      VRLSALSTLNYRNLAPGTLNFPEGVTGIYGENGAGKTNLLEAAYLALTGQTDAPRIEQLIQAGETE-AYV
RECF_MYCA1      MYVRHLGLRDFRSWAHADLELQPGRTVFIGSNGFGKTNLLEALWYSSTLGSHRVGTDAPLIRAGADRTVV
RECF_FRAAA      MHLTHLSLVDFRSYPSLDLTLGPGVVTLVGRNGQGKTNLIEAIGYVATLASHRVSADAPLVRQGASHAVV
RECF_SYNP2      MYLQTLHLRNFRNYQHQHVDFSAQKTILIGNNAQGKSNLLEAVELLASLKTHRTSRDADLVKQGEATARI
RECF_ACHLI      --ITSIELRNFRNLENYKVLINKPLVIIQGLNGVGKTSILESIYFAATTKSHRSSVEKDMIQYDKPYASV
RECF_DEIDV      VQLESLSTLNYRNLAPCTLSFPAGVTGVFGENGAGKTNLLEAAYLALTGLTDVTRLEQLVQSGEGE-AYV
RECF_ACHLA      --ITSIELRNFRNLENYKVLINRPLVIIQGLNGVGKTSILESIYFAATTKSHRSSVEKDMIQYDKPYASV
RECF_SALTO      MYVRRLELVDFRSYERVGVDLEPGANVLVGPNGVGKTNLIEALGYVATLDSHRVATDAPLVRMGAAAGII
RECF_LEPBP      MFLKKIYIKNFRNHEETQLTFKSRLVFFIGNNGEGKTNLLESISLLSYLKSFRESDQNQLLRWDTSDTFI
RECF_LEPBA      MFLKKIYIKNFRNHEETQLTFKSRLVFFIGNNGEGKTNLLESISLLSYLKSFRESDQNQLLRWDTSDTFI
RECF_MYCLE      MYVRHFGLRDFRSWDHVDLELNPGRTVFFGPNGNGKTNLIEALWYSTTLSSHRVGTDIPLIRAGTIRAIV
RECF_MYCLB      MYVRHFGLRDFRSWDHVDLELNPGRTVFFGPNGNGKTNLIEALWYSTTLSSHRVGTDIPLIRAGTIRAIV
RECF_GEOMG      MFVTKIQISSFRNIAAAEIRFDRRFNVLHGANGQGKTSVLEAIYLLGTMKSFRLAKTPDLVSWNTPHALL
RECF_BEUC1      MYVSDLALTDFRSYADLVIGLEPGITAFVGPNGQGKTNLVEAIGYLGTFSSHRVSGDAALVRWGXXXXXX
RECF_CLAM3      MIVRHLSLGDFRNYTRADVALLPGATLFVGSNGQGKTNLVEALGFLSTLGSHRVSTDQALIRQGAESAVI
RECF_SALAI      MYVRRLELVDFRSYERVGVDLEPGANVLVGHNGVGKTNLIEALGYVATLDSHRVATDAPLVRMGAGAAVI
RECF_CHLAB      MNILSLRLKNFRNYKEAEVSLSPNINYIFGENAQGKTNLIEALYVLSLGRSFRTSHLTEAIFFGSSYFFL
RECF_DEIGD      VQLSSLSTLNYRNLAPGTLHFPAGVTGVFGENGAGKTNLLEAAYLALTGLTDVTRLEQLIQSGE-REAYV
RECF_SHEB2      MSLTRLNIEAFRNIQSAQLIPAPGINLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVINNDDDKLTL
RECF_RHOSR      MFVRALSLRDFRSWDALGLTLRPGCTVFVGPNGHGKTNVLEALGYLSTLSSHRVSSDAPLIRTGTGQAFA
RECF_SHEB9      MSLTRLNIEAFRNIQSAQLIPAPGINLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVINNDDDKLTL
RECF_SHEB5      MSLTRLNIEAFRNIQSAQLIPAPGINLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVINNDDDKLTL
RECF_SHEB8      MSLTRLNIEAFRNIQSAQLIPAPGINLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVINNDDDKLTL
RECF_XYLFT      MHITQLVLRHFRCFDVVDFFPLPGLNFFIGENGSGKTSLLEAVHLMGYGRSFRGRVRDGLIRHGSENLEI
RECF_XYLF2      MHITQLVLRHFRCFDVVDFFPLPGLNFFIGENGSGKTSLLEAVHLMGYGRSFRGRVRDGLIRHGSENLEI
RECF_CYTH3      MYIEKISLLNFKNYPELELSFSAGINLFAGLNGSGKTNLLDSIYCLCLTKSFLSXXXXXXXXXXXXYFSA
RECF_BIFLI      MHISRLALDHYRSWSQVVVDFVPGVNILFGKNGLGKTNLVEAVEVLSTGSSHRTSSTLPLI--ERGQTTA
RECF_SHESW      MSLTRLNIEAFRNIQFAQLIPAPGINVIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVINNDNDKLTL
RECF_SHEPC      MSLTRLNIEAFRNIQFAQLIPAPGINVIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVINNDNDKLTL
RECF_MYCMM      MYVRHLGLRDFRSWAHADLELGPGRTVFVGPNGFGKTNIIEALWYSATLGSHRVGTDAPLIRAGADRAVI
RECF_SACEN      MYVRHLQVTDFRSWPHADLTFEPGPTVLVGSNGQGKTNLVEALGYVATLGSHRVATDAPLVRYGTQRAVV
RECF_RHOOB      MFVRALSLRDFRSWDALGLNLRPGCTVFVGPNGHGKTNVLEALGYLSTLSSHRVSSDAPLIRTGTAQAFA
RECF_MYXXD      MRLLALHVHDFRNLPQVQLTPSAHATIAVGQNGQGKTNLLEALYFLATLKPLRAGRLSELVRWGSQGARV
RECF_GRAFK      ----------------AEFDFDEKINCLVGNNGVGKTNVLDSIYLLSFGKSYFNPITSQNINHDSDFFVV
RECF_BIFAA      MHISRLALDHYRSWDHCVLDFEPGINILQGSNGLGKTNIVEAVEVLXXXXXXXXXXXLPLV--EKGHPSA
RECF_SHESR      MSLIRLNIDSFRNIQLAQLSPSSGINLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVINNEQDKLTL
RECF_SHESA      MSLIRLNIDSFRNIQLAQLSPSSGINLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVINNEQDKLTL
RECF_MYCUA      MYVRHLGLRDFRSWAHADLELGPGRTVFVGPNGFGKTNIIEALWYSATLGSHRVGTDAPLIRAGADRAVI
RECF_SHESM      MSLIRLNIDSFRNIQLAQLSPSSGINLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVINNEQDKLTL
RECF_IDILO      MFIETLNLSHFRNFSEVALSPSPKINIITGDNGSGKTSLLEAIYLLXXXXXXXXXXXXQIKEGNSGFTVF
RECF_RHOE4      MFVRRFSLRDFRSWDSLTLDLTPGTTVFLGSNGHGKTNVLESLGYLSTLSSHRVSTDAPMIRSGSASAFA
RECF_PSYIN      MSLSRLIIHQFRNINSATLDFNPKINVVVGPNGSGKTALLEAIYFLGLGRSFRTHLTSRVVEHESKSFTL
RECF_XYLFM      MHITQLVLRHFRCFDVVDFFPLPGLNFFIGENGSGKTSLLEAVHLMGYGRSFRGRVRDGLIRHGSENLEI
RECF_XANAC      MHVVRLSIHRLRRFQTVELHPSSALNLLTGDNGAGKTSVLEALHLMAYGRSFRGRVRDGLIQQGANDLEV
RECF_SHEON      MSLIRLNIDSFRNIQLAQLSPSEGINLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVINNDQDKLTL
RECF_XYLFA      MHITQLVLRHFRCFDAVDFFPLPGLNFFIGENGSGKTSLLEAVHLMGYGRSFRGRVRDGLIRHGSENLEI
RECF_XANC5      MHVVRLSIHRLRRFHTVELHPSSTLNLLTGDNGAGKTSVLEALHLMAYGRSFRGRVRDGLIQQGANDLEV
RECF_PSEHT      MSLSHLSLKYFRNIEALTLEPVNGVNIIYGENGSGKTSLLEAIYYLSHGKSFRTSKHKSIIAHQQEQFVI
RECF_STRM5      MQIRRLALHQLRRFNAVELSPQPGLNLLTGDNGAGKTSILEALHLMAYGRSFRGRVRDGLVRQEALEIFV
RECF_PARD8      MILKKLSVLNYKNILQSEVIFSPKMNCFFGNNGMGKTNLLDAIHYLSFCKSHVNTPDSQIINSDQDLCVV
RECF_STRMK      MLIRRLALHQLRRFSAVDLSPQPGLNLLTGDNGAGKTSVLEALHLMAYGRSFRGRVRDGLVRQGQEALEI
RECF_OPITP      MRLRHLTLRHFRNVGFAALAFSGRQQFLVGLNGQGKTNLLEAAGFLTALRSFRTTDNKLLIQHGQHTGAI
RECF_NITOC      MHITHLDIRNFRNLKHIELHPSKGVNILSGANSSGKTSFLEAIYLLGLGRSFRTVQSAIQAGMESLRVVA
RECF_SHEAM      MSLSRLSIDAFRNIDSAQLAPGAGLNLIYGHNGSGKTSILEAIYFLGMGRSFRSHLSQRVIQNDADCLTL
RECF_XANCP      MHVARLSIHRLRRFEAVEFHPASTLNLLTGDNGAGKTSVLEALHVMAYGRSFRGRVRDGLIRQGGQDLEI
RECF_XANC8      MHVARLSIHRLRRFEAVEFHPASTLNLLTGDNGAGKTSVLEALHVMAYGRSFRGRVRDGLIRQGGQDLEI
RECF_SHEPW      MSLNRLHIEAFRNITSAQLQPGDGLNVIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVINNDADALTL
RECF_SHEPA      MSLSRLHIESFRNISSAQLQPGDGLNLIYGHNGSGKTSILEAIYFLGMGRSFRSHLSQRVIKNDDDALTL
RECF_PORGI      MIIEELHIVNFKSIAAADCRFSPKVNCLVGNNGMGKTNLLDALHFSFCRSHLSVPDNMVVRHGEEMALLQ
RECF_XANOR      MHVMRLSIHRLRRFQTVELHPASALNLLTGDNGAGKTSVLEALHLMAYGRSFRGRVRDGLIQQGANDLEV
RECF_SHEFN      MSLSRINIGSFRNITSASLQPCDGLNLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVINNDDDKLTL
RECF_PORG3      MIIEELHIVNFKSIAAADCRFSPKVNCLVGNNGMGKTNLLDALHFSFCRSHLSVPDNMVVRHGEEMALLQ
RECF_XANOM      MHVMRLSIHRLRRFQTVELHPASALNLLTGDNGAGKTSVLEALHLMAYGRSFRGRVRDGLIQQGANDLEV
RECF_SHEWM      MSLTRLHIETFRNISSAQLHPSDGLNLIYGQNGSGKTSVLEAIYFLGMGRSFRSHLSQRVIQHQDDKLTL
RECF_SHESH      MSLTRLHIETFRNITSAQLLPGEGINLIYGHNGSGKTSILEAIYFLGMGRSFRSHLSQRVIQHSDDKLTL
RECF_PROMI      MILSRLLIRHFRNIEQADLPLADGFNFLVGPNGSGKTSILEAIYTLGHGRAFRSAQANRVIQHDENAFIL
RECF_PROMH      MILSRLLIRHFRNIEQADLPLADGFNFLVGPNGSGKTSILEAIYTLGHGRAFRSAQANRVIQHDENAFIL
RECF_MICLC      MYLSHLTVADFRSYRWADLELTPGSTVLLGANGVGKTNLVEAIGYLGAQQSHRVSSDAQLVRFGRDRARI
RECF_SHIFL      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ERWT9      MALTRLLIKDFRNIENADLALAPGFNFLVGPNGSGKTSVLEAIYTLGHGRAFRSLQAGRVIRHDQDAFVL
RECF_ECOSE      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_YERPY      MALTRLLIKDFRNIESADLALAAGFNFLVGPNGSGKTSVLEAVYTLGHGRAFRSLQAGRVIRHECAEFVL
RECF_YERPS      MALTRLLIKDFRNIESADLALAAGFNFLVGPNGSGKTSVLEAVYTLGHGRAFRSLQAGRVIRHECAEFVL
RECF_YERPG      MALTRLLIKDFRNIESADLALAAGFNFLVGPNGSGKTSVLEAVYTLGHGRAFRSLQAGRVIRHECAEFVL
RECF_YERPE      MALTRLLIKDFRNIESADLALAAGFNFLVGPNGSGKTSVLEAVYTLGHGRAFRSLQAGRVIRHECAEFVL
RECF_YERPB      MALTRLLIKDFRNIESADLALAAGFNFLVGPNGSGKTSVLEAVYTLGHGRAFRSLQAGRVIRHECAEFVL
RECF_YERP3      MALTRLLIKDFRNIESADLALAAGFNFLVGPNGSGKTSVLEAVYTLGHGRAFRSLQAGRVIRHECAEFVL
RECF_SHIF8      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGCVIRHEQEAFVL
RECF_ECO7I      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_SHIBS      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_SHEHH      MSLTRLHIETFRNISLAQLDPGDGLNLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVIQHNDDKLTL
RECF_ESCF3      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFIL
RECF_SHISS      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_SERP5      MALTRLLIKDFRNIEAADLALAPGFNFLVGANGSGKTSVLEAVYTLGHGRAFRSLQAGRVIRHDQPEFIL
RECF_ECOUT      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECOSM      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECOLU      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECOLI      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECOLC      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECOL6      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECOK1      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECOHS      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECODH      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECOBW      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECO8A      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECO81      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECO5E      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECO57      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECO55      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECO45      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECO27      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_ECO24      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_BACFN      MILKRISILNYKNLEQVELNFSAKLNCFFGQNGMGKTNLLDAVYFLSFCKSAGNPIDSQNIRHEQDFFVI
RECF_METCA      MALLKLDIADVRNIESASLSPGEGLNLLFGANGSGKTSLLEAIYLLSRGKSFRSPQSGRIIRFDRPCLTV
RECF_ECOL5      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_BACFR      MILKRISILNYKNLEQVELNFSAKLNCFFGQNGMGKTNLLDAVYFLSFCKSAGNPIDSQNIRHEQDFFVI
RECF_AZOPC      MIIEIVTILNFKNIEEGSLSFSPKINYLLGDNGMGKTNLLDALYYLAFTKNHTNLTDSQLINYNKDFAVL
RECF_YERE8      MALTRLLIKDFRNIESADLALASGFNFLVGPNGSGKTSVLEAIYTLGHGRAFRSLQAGRVIRHECAEFVL
RECF_SACD2      --LSNLKVQQFRNLGLVDITPSPTLNLVYGENGSGKTSLLEAISVLAHCRSFRTHKYRRLIQDXXXXXXX
RECF_BACTN      MILKRISILNYKNLEQVEIGFSAKLNCFFGQNGMGKTNLLDAVYFLSFCKSSGNPIDSQNIRHEQDFFVI
RECF_PSEA6      MKLDSVQIRNLRNLQHVTFKPSHGVNFILGINGSGKSSILEAIHYLGFGRSFRTSKHKNVIQNEQESFTV
RECF_BACV8      MILKRISILNYKNLEQAELEFSPKMNCFIGQNGMGKTNLLDAVYYLSFCKSATNPIDSQNIRHEGEFFVI
RECF_SHIB3      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_SHIDS      MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSMLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_MARAV      MALVKLQTQHFRNLLSAPVEFSPSFNLLYGANGSGKTSVLEAIGYLGLGRSFRVSRHQAVVHGQSKLTVI
RECF_SALTY      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_SALPK      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_SALPA      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_SALNS      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_SALHS      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_SALTI      MSLSRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_SALSV      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_SALPC      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_SALG2      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_SALEP      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_SALDC      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_SALCH      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_SALA4      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_ACTPJ      MPLSRLIINNFRNLQSLDLELSPNFNFIVGHNGSGKTSLLEAIFYLGHGRSFKSHISNRIIHYQAEDFVL
RECF_SHELP      MSLSRLHIDSFRNIASAQLQLGDGLNLIYGQNGSGKTSILEAIFFLGMGRSFRSHLSQRVIQNDQDKLTL
RECF_SALPB      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQPGRVIRHEQEAFVL
RECF_ACTPL      MPLSRLIINNFRNLQSLDLELSPNFNFIVGHNGSGKTSLLEAIFYLGHGRSFKSHISNRIIHYQAEDFVL
RECF_ACTP2      MPLSRLIINNFRNLQSLDLELSPNFNFIVGHNGSGKTSLLEAIFYLGHGRSFKSHISNRIIHYQAEDFVL
RECF_SODGL      MALSRLMIRDFRNISVADLSLAADFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQSGRVIRHEQPEFVL
RECF_PSEPF      MSLSRVSVTAVRNLHPVTFSPSPRINILYGANGSGKTSVLEAIHLLGLARSFRSTRLLPVIQYEQLACTV
RECF_SALAR      MSLSRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_PASMU      MAISRLLIENFRNLTAVDLEFDHGFNFLVGNNGSGKTSLLEAIFYLGHGRSFKSAVSNRIISYEQPHFIL
RECF_ACTP7      MPLSRLIINNFRNLQSLDLELSPNFNFIVGHNGSGKTSLLEAIFYLGHGRSFKSHISNRIIHYQAEDFVL
RECF_PSEE4      MSLRRLSVTAVRNLHPVTLSPSPRINILYGANGSGKTSVLEAVHLLGLARSFRSTRLNPVIQYEQQTCTV
RECF_EDWI9      MALTRLVIRDFRNIEEADLALAPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQAGRVIRHDCSAFVL
RECF_SHEDO      MSLQRISIESFRNIAAANLLPSEGLNLIYGHNGSGKTSVLEAIYFLGMGRSFRSHLSQRVIRHDEDKLTL
RECF_PHOLL      MTLTRLLIRDFRNIAAADLPLATGFNFLVGSNGSGKTSVLEAIYTLGHGRSFRSIQAGRVILHGCDHGRL
RECF_CITK8      MSLTRLLIRDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQESFVL
RECF_THISH      MILNRLEVRGLRILRHVRMDPVSGLNLVHGVNGAGKTSLLEAIHLLSTGHSFRTRQLSPLLAPDCD--AV
RECF_PSESM      MSLSRVSVTGVRNLHPVTLSPSPRINILYGANGSGKTSVLEAIHLLGIARSFRSSRLLPVIQYEQPSCTV
RECF_TERTT      --LRRLDISEFRNLRSATLQPGEGINLISGENGSGKTSILESISVLAHGRSFRTHKFRRINNDEKSFTLF
RECF_SODGM      MALSRLMIRDFRNISVADLSLAADFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQSGRVIRHEQPEFVL
RECF_MARMS      MPLVRLDISHVRNLSSVRFEPSPQVNVIVGKNGSGKTSVLEAIHLLSFGRSFRSHKHKTYIQHENDACIV
RECF_HAEIN      MAISRLLVEKFRNLTAVDLDFDPCFNFLIGNNGSGKTSLLEAIFYLGHGRSFKSAVTNRIISYDEPHFTL
RECF_HAEDU      MPLSRLLINNFRNLQAIDLELSPDFNFIVGHNGSGKTSLLEAIFYLGHGRSFKSHISNRIIHHHAENFVL
RECF_THICR      -KILQFQLQHFRNIEQASLTFGEGLNLIVGDNAAGKTALIEAIWTLASGRSFRTAKPHQLIQQNQSELVL
RECF_ENTS8      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQDAFIL
RECF_CELJU      MSLARLRVHHLRNLESVDIEPSSRVNLIYGLNGSGKTSLLEAINVLALGRSFRSHKHKPLISHQQLAFTI
RECF_PSEU2      MSLSRVSVTGVRNLHPVTLSPSPRINILYGANGSGKTSVLEAIHLLGIARSFRSSRLLPVIQYEQPSCTV
RECF_PSEA8      MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHLLGLARSFRSARLQPVIQYEEAACTV
RECF_HAEI8      MAISRLLVEKFRNLTAVDLDFDPCFNFLIGNNGSGKTSLLEAIFYLGHGRSFKSAVTNRIISYDEPHFTL
RECF_PSEF5      MSLSRVSVTAVRNLHPVTFSPSPRINLLYGANGSGKTSVLEAIHLLGLARSFRSARLLPVIQYEQLACTV
RECF_MANSM      MAIARLIVENFRNISAVDLEFDHGFNFLVGNNGSGKTSLLEALFYLGHGRSFKSSVTTRVIRYDQPHFTL
RECF_HAHCH      MGLSRIAFTNLRNISSLKLDTSARLLLFHGNNGSGKSSLLEGVYLLGRGASFRTELDYAVSHLSDEMVCF
RECF_VIBVY      MPLSRLIIQQFRNIKACDIALSPGFNFLIGPNGSGKTSVLEAIYLLGHGRSFKSALTGRVIQNECDQLFV
RECF_PSEPK      MSLRRIMVTAVRNLHPVTLLPSPRINILYGANGSGKTSVLEAVHLLGLARSFRSTRLNPVIQYEQAACTV
RECF_PSEPG      MSLRRIMVTAVRNLHPVTLLPSPRINILYGANGSGKTSVLEAVHLLGLARSFRSSRLNPVIQYEQPACTV
RECF_PSEP1      MSLRRIMVTAVRNLHPVTLLPSPRINILYGSNGSGKTSVLEAVHLLGLARSFRSTRLNPVIQYEQAACTV
RECF_ERWCT      MALTRLLIKDFRNIEAADLALVPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSIQAGRVIRHDQPEFVL
RECF_VIBCM      MPLSRLMIQQFRNIKACDIRLSAGFNFLIGPNGSGKTSVLEAIYLLGHGRSFKSSLTGRIIQNECSELFV
RECF_VIBCH      MPLSRLMIQQFRNIKACDIRLSAGFNFLIGPNGSGKTSVLEAIYLLGHGRSFKSSLTGRIIQNECSELFV
RECF_VIBC3      MPLSRLMIQQFRNIKACDIRLSAGFNFLIGPNGSGKTSVLEAIYLLGHGRSFKSSLTGRIIQNECSELFV
RECF_PSEAE      MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHLLGLARSFRSARLQPVIQYEEAACTV
RECF_PSEAB      MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHLLGLARSFRSARLQPVIQYEEAACTV
RECF_ENT38      MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQVGRVIRHEQESFIL
RECF_PSEA7      MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHLLGLARSFRSARLQPVIQYEEAACTV
RECF_COLP3      MSVARLTTYNFRNLSSVAIDLHPKLNFFIGNNGSGKSSLLEALFFLGHGKSFRTSKVEHLACYETDNFVV
RECF_VIBVU      MPLSRLIIQQFRNIKACDIALSPGFNFLIGPNGSGKTSVLEAIYLLGHGRSFKSALTGRVIQNECDQLFV
RECF_PECCP      MALTRLLIKDFRNIEAADLALVPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSIQAGRVIRHDQPEFVL
RECF_ACIAD      MQITRLNIERVRNLKAVALSGLQPFNIFYGANGSGKTSILEAVHLLATGRSFRTHMPKHYIQQNAQDAII
RECF_KLEP7      MSLTRLLIKDFRNIESADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQDAFVL
RECF_ACIBS      MHLTRLNIERVRNLKTVALHGLQPFNVFYGANGSGKTSILEAIHLLATGRSFRTHIPKNYIQYEADDAIV
RECF_KLEP3      MSLTRLLIKDFRNIESADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVL
RECF_VIBHB      MPLSRLIIQQFRNIKACDIDLSAGFNFLIGPNGSGKTSVLEAIYLLGHGRSFKSSLTGRVIQNECDELFV
RECF_ACIBY      MHLTRLNIERVRNLKTVALHGLQPFNVFYGANGSGKTSILEAIHLLATGRSFRTHIPKNYIQYEADDAIV
RECF_ACIBT      MHLTRLNIERVRNLKTVALHGLQPFNVFYGANGSGKTSILEAIHLLATGRSFRTHIPKNYIQYEADDAIV
RECF_ACIBC      MHLTRLNIERVRNLKTVALHGLQPFNVFYGANGSGKTSILEAIHLLATGRSFRTHIPKNYIQYEADDAIV
RECF_ACIB5      MHLTRLNIERVRNLKTVALHGLQPFNVFYGANGSGKTSILEAIHLLATGRSFRTHIPKNYIQYEADDAIV
RECF_ACIB3      MHLTRLNIERVRNLKTVALHGLQPFNVFYGANGSGKTSILEAIHLLATGRSFRTHIPKNYIQYEADDAIV
RECF_VIBPA      MPLSRLIIQQFRNIKACDIQLSAGFNFLIGPNGSGKTSVLEAIYLLGHGRSFKSSLTGRVIQNECDELFV
RECF_VIBFM      MPLSRLIINDFRNITTCDIQLSPGFNFVIGPNGSGKTSVLEAIYLLGHGRSFKSSLTGRIIRNDCDELFI
RECF_PSE14      MSLSRVSVTGVRNLHPVTLSPSPRINILYGANGSGKTSVLEAIHLLGIARSFRSSRLLPVIQYVQPSCTV
RECF_SYNPX      -------MQGFRNHRKLSLLTQPRLLVI-GPNGIGKSNLLEAVELSLR--SHRCSQDRDLIQWEAPRALL
RECF_ACTSZ      MAISRLIIENFRNLAAVDLEFDHGFNFLVGNNGSGKTSLLESIFYLGHGRSFKSSVSTRIITYDKPYFTL
RECF_TREPA      ---------NFRNLAHHTIISSPEVFFV-GNNGQGKTNILEVLYLAAYGNSFRTRTESELYATHARSNEY
RECF_FRAP2      MYIANLRLQNFRNIPIKSFDFKNSINFIVGKNGSGKTSILESIYFLSHSRSFRSSQLNRIINHDSDEFIV
RECF_VIBF1      MPLSRLIINDFRNITTCDIQLSSGFNFVIGPNGSGKTSVLEAIYLLGHGRSFKSSLTGRIIRNDCDELFI
RECF_PSEPU      MSLRRIMVTAVRNLHPVTLLPSPRINILYGANGSGKTSVLEAVHLLGLARSFRSTRLNPVIQYEQAACTV
RECF_PSEFS      MSLSRVSVTAVRNLHPVTFSPSPRINILHGANGSGKTSVLEAIHLLGLARSFRSARLLPVIQYEQLACTV
RECF_HAES2      MAISRLIINHFRNLTAIDLEFERXXXXXXXXXXSGKTSLLEAIFYLGHGRSFKSAVANRIISYQQPHFIL
RECF_HAES1      MAISRLIINHFRNLTAIDLEFERXXXXXXXXXXSGKTSLLEAIFYLGHGRSFKSAVANRIISYQQPHFIL
RECF_VIBSL      MPLSRLIVKQFRNIEACDIQPSSGFNFLIGANGSGKTSVLEAVYLLGHGRSFKSSLSGRIIQNECSELFV
RECF_PROMM      -------MQGYRNYSRLQLELTENRLLVIGPNGIGKSNLLEAIELSLR--SHRASSDQDLIHWEEQRALL
RECF_COXBN      --IGSLKVNQFRNLADVDITPHSXXXXXXXXXXAGKTSILESIYYLSVGRSFRTHLPQRLIQDNTDRFLI
RECF_ALISL      MPLSRLIINDFRNIETCDIQLSTGFNFVIGPNGSGKTSVLEAIYLLGHGRSFKSSLTGRIIRNSCDELFI
RECF_COXBU      --IGSLKVNQFRNLADVDITPHSXXXXXXXXXXAGKTSILESIYYLSVGRSFRTHLPQRLIQDNTDRFLI
RECF_COXBR      --IGSLKVNQFRNLADVDITPHSXXXXXXXXXXAGKTSILESIYYLSVGRSFRTHLPQRLIQDNTDRFLI
RECF_COXB2      --IGSLKVNQFRNLADVDITPHSXXXXXXXXXXAGKTSILESIYYLSVGRSFRTHLPQRLIQDNTDRFLI
RECF_COXB1      --IGSLKVNQFRNLADVDITPHSXXXXXXXXXXAGKTSILESIYYLSVGRSFRTHLPQRLIQDNTDRFLI
RECF_HAEPS      MSLSRLIINNFRNLTAVDLELNHGFNFFIGANGSGKTSLLEAIFYLGHGKSFKSHISNRIIKYNQEEFTL
RECF_ANAD2      MKLLSLHVQDFRNLAAVELAPSPRATVLLGENGQGKTNLLEAIYFLTTLKPLRAVRLAELVRFGAEQGAV
RECF_FRATW      MYISNLRLQNFRNIPAKSFDFKNSINFIVGKNGSGKTSILESIYFLSHSRSFRSSQLNRIINHNADEFII
RECF_FRATT      MYISNLRLQNFRNIPAKSFDFKNSINFIVGKNGSGKTSILESIYFLSHSRSFRSSQLNRIINHNADEFII
RECF_FRATM      MYISNLRLQNFRNIHAKSFDFKNSINFIVGKNGSGKTSILESIYFLSHSRSFRSSQLNRIINHNADEFII
RECF_FRAT1      MYISNLRLQNFRNIPAKSFDFKNSINFIVGKNGSGKTSILESIYFLSHSRSFRSSQLNRIINHNADEFII
RECF_CHRSD      MPLERLNFLGLRNLAALDMRPGPGINLITGANGSGKTSLLEGMHVLGMARSFRTQKLKHAIAHDADAVTL
RECF_SYNSC      -------MQGFRNHTVLQLLTQPRLLVI-GPNGIGKSNLLEAVELSLR--SHRCSNDRDLIQWDTPQALI
RECF_FRATN      MYISNLRLQNFRNIPAKSFDFKNSINFIVGKNGSGKTSILESIYFLSHSRSFRSSQLNRIINHNADEFII
RECF_FRATO      MYISNLRLQNFRNIPAKSFDFKNSINFIVGKNGSGKTSILESIYFLSHSRSFRSSQLNRIINHNADEFII
RECF_FRATH      MYISNLRLQNFRNIPAKSFDFKNSINFIVGKNGSGKTSILESIYFLSHSRSFRSSQLNRIINHNADEFII
RECF_FRATF      MYISNLRLQNFRNIPAKSFDFKNSINFIVGKNGSGKTSILESIYFLSHSRSFRSSQLNRIINHNADEFII
RECF_AZOVD      MSLGRVTVTAVRNLHPVTLNPSPRINILYGPNGSGKTSLLEAIHLLGLARSFRSQRLSPVIQHEQPACTV
RECF_MAGSM      MQLDRLTLRDFRNITEAELRFGPGLNLITGPNGHGKSNLLEAIGLLATGRSFRRAPAAALRRYGQPWFHL
RECF_PSEPW      MSLRRIMVTAVRNLHPVTLSPSPRINILYGANGSGKTSVLEAVHLLGLARSFRSTRLNPVIQYEQAACTV
RECF_PSEMY      MSLSRIMVTAVRNLHPVTLSPSPRINILHGANGSGKTSVLEAIHLLGLARSFRSTRLQPVIHYEQPACTV
RECF_PSEU5      MSLSRLSVTGVRNLHPVTLSPSPRINILFGDNGSGKTSLLEAIHLLGLARSFRSIRLNPVITYEQPACTV
RECF_RICM5      -----LSLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLADICKTSEDHCLV
RECF_ANADF      MKLLSLAVQDFRNLAQVELLPSPRATVLLGENGQGKTNLLEAIYFLTTLKPLRTARLAELVRHGAQTGLV
RECF_ANADE      MKLLSLHVQDFRNLAAVELAPSPRATVLLGENGQGKTNLLEAIYFLTTLKPLRAVRLAELXXXXXXXXXX
RECF_RICAE      -----LSLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLANVCKTSEDHCLV
RECF_RICRS      -----LSLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLANVCKTSEDHCLV
RECF_RICRO      -----LSLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLANVCKTSEDHCLV
RECF_RICPU      -----LSLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLANVCKTSEDHCLV
RECF_RICCK      -----LILENYRNFKNLELKIDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLADICKTSEDHCSI
RECF_NOCSJ      MYVAHLSLHDFRSYATAEVELSPGVTAFIGRNGQGKTNLVEAIDYLSRLSSHRVASDAPLXXXXXXXXXX
RECF_RICCN      -----LNLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLANVCKTSEDHCLV
RECF_RHILW      --LSRLKLTDFRNYAAAALDLDGRHAVLTGDNGAGKTNLMEAVSLLSPGRGLRRAAYGDITRVGSIFAAL
RECF_AGRVS      --INRLQLTDFRNYGSASLRLDGRHVVLTGNNGSGKTNLMEAVSFLSPGRGLRRAVLSDVXXXXXXXXXX
RECF_RICAH      -----LSLANYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLDDICKASEDYCIV
RECF_RICPR      -----LTLENYRNFKNLELKTDNTPIILTGENGSGKTNILEAISLFYPGRGLRSSKLTDICKTSEDYCKV
RECF_RICBR      -----LIVENYRNFKNLELKTDNIPITIIGENGSGKTNILEAISLFYPGRGLRSARLADICRESEDHCSV
RECF_RICB8      -----LIVENYRNFKNLELKTDNIPITIIGENGSGKTNILEAISLFYPGRGLRSARLADICRESEDHCSV
RECF_AGRRK      --ISRLKLTDFRNYAAAALTLDERHVVLTGDNGAGKTNLMEAVSLLSPGRGLXXXXXXXXXXXXXNGFSI
RECF_RICFE      -----LTLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLADICKASEDQCLV
RECF_RHIL3      --LSRLKLTDFRNYXXXXXXXDGRHAVLTGDNGAGKTNLMEAVSLLSPGRGLRRAAYGDITRVGSIFAAL
RECF_RHIE6      --LSRLKLTDFRNYAAVSLALDGRHAVLTGNNGAGKTNLMEAVSLLSPGRGLRRAAYGDITRVGSIFAAL
RECF_RICTY      -----LNLENYRNFKNLELKIDNIPIILTGENGSGKTNILEAISLFYPGRGLRSSKLTDICKTSEDYCRV
RECF_BRUSU      --IRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAYDDVARANAEHAAL
RECF_RHIEC      --LSRLKLTDFRNYAAASLSLDGRHAVLTGDNGAGKTNLMEAVSLLSPGRGLRRAAYGDITRVGSIFAAL
RECF_BRUME      --IRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAYDDVARANAEHAAL
RECF_BRUAB      --IRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAYDDVARANAEHAAL
RECF_BRUA2      --IRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAYDDVARANAEHAAL
RECF_AGRT5      --LSRLKLTDFRNYAAAALVLDERHVVLTGDNGSGKTNLLEAVSFLSPGRGLRRAVLSDVTGAEATGFSI
RECF_RHIME      ----RLKLSDFRNYATLALDLDQRHVVLTGENGAGKTNLMEGVSFLSPGRGLRRAAYADVADGFSVFAAV
RECF_ANASK      MKLLSLHVQDFRNLAAVALAPSPRATVLLGENGQGKTNLLEAIYFLTTLKPLRAVRLAELVRFGADQGAV
RECF_RHILO      --ISKLTLTNFRNYAALAIDLAPGAVVFSGDNGAGKTNLLEAISLLTPGRGLRRAPYADVAREGGDHARL
RECF_SPHWW      MTVARLMLTDFRSYASATIAAGPGFVVLTGENGAGKTNILEAVXXXXXXXXXXXXXXXXXXXXXXXXXXX
RAD50_HALVO     MRFTRIAIRNFKPYEDAELDLRDGVTVIHGVNGSGKSSLLEACFFALYGSKALAGTLEDVVTTGADDAEI
SMC5_SCHPO      --IVRIKLVNFVTYDYCELFPGPYLNLIIGPNGTGKSTIVSAICIGLPKLLGRAKEAREFIKYGKNTATI
RAD50_THEMA     MRPERLTVRNFLGLKNVDIEFQSGITVVEGPNGAGKSSLFEAISFALFGNGIRYPNSYDYVN--------
SMC4_SCHPO      --VYELRLTNFKSYAGTQIVGHPSFSSIVGPNGSGKSNVIDALVFGFRASKLRQSKASALIHKSATHPSL
RAD50_HALSA     MRFTRLSLSNFKCYADAAVSLDPGVTVIHGLNGSGKSSLLDACFFALYG---------------------
RAD50_METMA     MKLKNLYIENIRSYKKLDFTFEDGVTVISGVNGSGKSSLLEACFMGLFG---------------------
RAD50_PYRHO     MKIERVIVQNFRSHKNSEIEFKPGINLIIGQNGAGKSSLLDAILVGL-----------------------
RAD50_METJA     MILKEIRMNNFKSHVNSRIKFEKGIVAIIGENGSGKSSIFEAVFFALFGAGSNFNYDTIITKGKSVYVEL
SMC4_ARATH      --IKELVMRNFKSYAGEQRVGHKSFSAVVGPNGSGKSNVIDAMVFGKRAKQMRLNKVSELIHNSTNHQ--
SMC3_DICDI      MFIKFIFIKGFRSYKDQGFTSHPGFNVVTGRNGAGKSNLFAAIRFLL-----------------------
RAD50_METAC     MKLKNLYIENIRSYRKLDFTFEDGVTVISGVNGSGKSSLLEACFMGLFG---------------------
SMC1_SCHPO      -RLLRLEVENFKSYRGHQIIPFEDFTSIIGPNGAGKSNLMDAISFVLKSSHLRSTNVKELIYLQRDNTDF
RECF_AZOVI      ---------------------------ISGPNGSGK----RPAYWRRSTCSFRSQRLSPVIQHEQPACTV
RAD50_ARCFU     --LKELQIKNFRSHSDSKIEFDTGINLIAGRNGAGKSSILEAIFYGLKPATLR-----------------
YP245_YEAST     -RVLSFMRSNLSQYKSDW--KHPAMFVIQGDAGTGKSVILNSLFNEIQKLSQFSPSSEDILHGTHNYLVV
RAD50_PYRFU     MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAIYWPLRIKDIKKDEEKDGTKYRITRRFL
SMC1A_RAT       --LKLIEIENFKSYKGRQIIPFQRFTAIIGPNGSGKSNLMDAISFVL-----------------------
SMC1A_MOUSE     --LKLIEIENFKSYKGRQIIPFQRFTAIIGPNGSGKSNLMDAISFVL-----------------------
SMC1A_HUMAN     --LKLIEIENFKSYKGRQIIPFQRFTAIIGPNGSGKSNLMDAISFVL-----------------------
SMC1A_BOVIN     --LKLIEIENFKSYKGRQIIPFQRFTAIIGPNGSGKSNLMDAISFVL-----------------------
RAD50_SULSO     MRIDKITLTNFLSHEHSEIQFMGEINVIVGQNGAGKSSIIDGIVFSLFRTHSRGNND-------------
RAD50_METKA     --IERVKIENLRSHSSTEIEFREGINVLVGPNGAGKTTVLEAITLALFPRTFRS----------------
VF050_IIV3      ----KLTLKNFKCYTSATFFALDSTTLITGPSGQGKSTILLAVQFALFG---------------------
SMC1A_XENLA     --LKLIEIENFKSYKGRQIIPFHRFTAIIGPNGSGKSNLMDAISFVL-----------------------
SMC5_TAKRU      --ILRITMRNFLTYDYTEVYPGPNLNMIVGANGTGKSSIVCAICLGLAG---------------------
SMC22_ARATH     MHIKEICLEGFKSYATRTVVPDPHFNAITGLNGSGKSNILDSICFVL-----------------------
SMC_MYCTU       MYLKSLTLKGFKSFAAPTTLREPGITAVVGPNGSGKSNVVDALAWTLRGGKMRAEVTVSIDNSDNALPIE
RECF_CAUSK      -----LTLTDFRSYERATLRPDGASVYLFGANGAGKTNLLEAISLGLRGSSLAAETEAPQTDFGQDEPVL
RAD50_THEVO     MIIERIRLRNFLSHSDSDIYFDTGINMIIGQNGAGKSSIVDAIRFALFS-DKRTRRTEDMIKKGERYMEV
SMC4_YEAST      --INELVLENFKSYAGKQVVGHTSFSAVVGPNGSGKSNVIDSMLFVF---GFRANKMR------------
SMC4_DICDI      LMITKMVMENFKSYAGAQEVGHKCFSSVVGPNGSGKSNVIDAMVFGYRAKQIRLNKISELIHNSENH---
RAD50_PYRAB     MKIEEVKVYNFRSHEETVVRFRKGINLIIGQNGSGKSSLLDAILVGL-----------------------
SMC5_XENLA      --IVRIKMENFLTYDQCEVFPGPYLNMIVGANGTGKSSIVCAICLGLAG---------------------
SMC5_YEAST      ----KIRLQDFVTYTLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAG---------------------
SMC5_HUMAN      --IVRISMENFLTYDICEVSPGPHLNMIVGANGTGKSSIVCAICLGLAG---------------------
RAD50_THEAC     MIIDRIRLINFLSHEDSEIFFDTGVNIIVGHNGAGKSSIIDAIRFALFG---------------------
SMC_MYCLE       MYLKSLTLKGFKSFASPTTLREPGITAVVGPNGSGKSNVVDALAWTLRGSKMRAEVTLIIDNSDNVLPIE
SMC2_YEAST      MKVEELIIDGFKSYATRTVITDPQFNAITGLNGSGKSNILDAICFVL-----------------------
RAD50_NANEQ     -------------HSKREFDFEKGINLILGPNGSGKTTLVESIFLALFGGDFARVIDYFKKGEKTMAITL
DXS_CLONN       -----------------------------------------AIRYPRGGDSIEAKTDYIVGKWEVLKTEG
SMC21_ARATH     MHIKEICLEGFKSYATRTVVSDPHFNAITGLNGSGKSNILDSICFVL-----------------------
RAD50_SULTO     MIIRRIDIENFLSHDRSLIEFKGTVNVIIGHNGAGKSSIIDAISFSLFRKSLRAKKQEDL----------
RAD50_METMP     MIIKNIKMENFRSHRNTSINFSKGITSIIGQNGSGKSSIFQAMNFALRGNNFRIE---------------
SUDA_EMENI      MYVKQIIIQGFKSYKDQTVIESPKHNVIVGRNGSGKSNFFAAIRFVL-----------------------
SMC3_PLAF7      MYIKQIRLKGFRTYKNETTIDFTGINCIVGFNGSGKSNILLAIEFIL-----------------------
RAD50_AQUAE     MRPLKLEVKGFTVYKKPQVIDFTPLKVIQGKTGAGKTSIIDAITYALYG---------------------


                         .         .         *         .         .         .         .:140
query           NTEVNLSSRLIKLQWKIQEGSKKLSLNGVERPRSELDLFGVVLFCPEDLSLIKGSPQERRHFLDYEVGTL
RECF_DESRM      NTEVNLSSRLIKLQWKIQEGSKKLSLNGVERPRSELDLFGVVLFCPEDLSLIKGSPQERRHFLDYEVGTL
RECF_PELTS      RCLFETRGREVEVKVTLVPGRKRIEVNGVLKSGHPFGWPGVVLFTPDDLVMIKGSPAERRRFLDYDLGPF
RECF_BACCZ      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACCR      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACC4      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACC2      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACWK      KGRLQRRNSSISLELNISKKGKKAKLNQLEQQKLSIGEMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACHK      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACCQ      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACC7      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACC3      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACC1      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACAH      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACC0      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACAN      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACAC      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACAA      KGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_BACSU      EGRVMKQNGAIPMQLVISKKGKKGKVNHIEQQKLSVGALNTIMFAPEDLNLVKGSPQVRRRFLDMEIGQV
RECF_BACCN      KGRLQKRNSSVSLELNISKKGKKAKLNELEQQKLSIGEMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQI
RECF_GEOSW      EGKAMKKNGALSLELIISKKGKKAKCNHIEQQRLSVGHLNIVMFAPEDLNLVKGSPQVRRRFVDMEIGQV
RECF_BACLD      EGRVIKKNGSVPIQLVISKKGKKGKVNHIEQQKLSVGAVNTIMFAPEDLNLVKGSPQVRRRFLDMEIGQV
RECF_GEOKA      EGRAEKRSGSLTLELLISKKGKKARCNHIEQQRLSVGHLNVVMFAPEDLNLVKGSPQVRRRFVDMEIGQV
RECF_BACSK      HAKAEKRTGEVELDIILSAKGKKGKINGLEQRRLSVGTLNVVMFAPEDLDLVKGSPQVRRRFIDMELGQI
RECF_BACA2      EGRVMKRNGDIPMQLVISKKGKKGKVNHIEQQKLSVGALNTIMFAPEDLNLVKGSPQVRRRFLDMEIGQV
RECF_LACS1      RGEVHQRLGNTKLELLISRKGKKAKVNHLEKARLSIGQLNVILFAPEDLALVKGAPSVRRRFIDMEFGQI
RECF_PEDPA      SGSVQKEHTVTPLEINLSSKGKNAKVNHLEQSRLSVGQLNVILFAPEDLSIVKGSPAVRRKFIDMEFGQM
RECF_GEOTN      EGRAEKRSGSLALELTISKKGKKARCNHIEQQRLSVGHLNVVMFAPEDLNLVKGSPQVRRRFIDMEIGQV
RECF_EXISA      EGRIHKRTGESVQSLSFSPKGKKAKLNHLEQRRLSVGAFNVVLFAPEDLAIVKGSPQGRRRFLDMEIGQV
RECF_OCEIH      EGRITKRNQSIPLQISITSKGKKAKVNHLEQHRLS-DYIGVVMFAPEDLTIVKGAPQIRRRFMDMELGQI
RECF_STACT      EGELSYRHGKMPLTMFITKKGKKVKVNHLEQHRQYVGHLNVVLFAPEDLNIVKGSPQVRRRFIDMELGQI
RECF_BACP2      EGRVIKKNGPLPMQLVISKKGKKGKVNHIEQQKLSVGALNTIMFAPEDLSLVKGSPQIRRRFLDMEIGQV
RECF_STAS1      EGDLSYRYGEMPLTMYITKKGKQVKINHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_ENTFA      SGVVEKKTGTVPLEILISNKGRKTKVNHIEQKRAYIGQLNVILFAPEDLSLVKGSPQVRRKFIDMELGQV
RECF_ALKMQ      QVKVKVYENNIELRLNVDK-KKNIKVNQVPXXXXXXXXXXIVLFSPEDLKIIKEGPGERRKFIDGEISQI
RECF_STAES      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAEQ      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAHJ      EGVLNYRHGTMPLTMFITKKGKQVKVNHLEQSRQYVGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_HALOH      QLYLVKRDEKLKISLEINKKVKKLEINDVERVSELLGNLNVVLFSPEDLKLVKEGPHFRRKFLDTELSQV
RECF_CLOTH      LLDLESSEGRKKIEIDYECGKKKVKIN--EIPLKKINLMGAVIFSPEDILIIKEGPSERRRFIDITLCQL
RECF_CLOTE      KIYVAKEDKTIEIR-VLKEGKKAINVNSININKLS-ELFGVVIFSPEDLSIVKESPSFRRKFLDIELSKL
RECF_MACCJ      EGMLSYKHGTMPLSLSISKKGKKAKVNYLEQKREYIGHMNVVLFAPEDLNLVKGSPQIRRRFIDMEIGQI
RECF_LACJO      QGKVHKSQLEVELKLRLTPNGKKAWVNRLEQKKAYVGQMNAILFSPEDLALVKGAPSIRRRFMDLEFGQI
RECF_LACGA      QGRVHKSQLQVELKLRLTANGKKAWVNRLEQKKAYVGQMNAILFSPEDLALVKGAPSVRRRFMDLEFGQI
RECF_OENOB      TGEVQSKMGKFPLEVRITRTGKKVFVNHLTENRLS-DYIGTVLFAPEDLDLVKGSPGVRRKFIDSEFGQM
RECF_LACC3      SGQVSRQSGSHQLELIISHQGKRARIDRIEQPKLSLGHFNVILFAPEDLAIVKGSPAGRRRFIDMEFGQM
RECF_LACCB      SGQVSRQSGSHQLELIISHQGKRARIDRIEQPKLSLGHFNVILFAPEDLAIVKGSPAGRRRFIDMEFGQM
RECF_LACSS      TGLVQRSAGKTPLELVLSQKGKKAKVNHLEQAKLSIGQLNVVLFAPEDLNIVKGSPAVRRHFIDMEFGQM
RECF_EXIS2      EGRIHKRRGSHSQEIAISSRGKKAKLNHLEQRRLSVGALNIVLFAPEDLHIVKGSPQIRRRFLDMEIGQV
RECF_BREBN      RSDVLRRYGSVRLELQLTTKGKRAKINGMEQQKAYVGALNVVMFAPEDLSIVKGAPAQRRRFIDMEIGQV
RECF_DESAP      EAELEGKDGRTRVRAELNPAGKKIVWAGEPVGKAELAVLGTVLFTPDDLSLIKGGPRERRRFLDLELGIF
RECF_LEUCK      SGRIKKNISETPLSLHFSSKGKKARVNHLEQSKLSVGQLNVILFAPEDLELVKGAPSVRRRFIDMEFGQM
RECF_LEUMM      SGRVKRSISETPLSLHFSNKGKKARVNHLEQSKLSIGQLNVILFAPEDLELVKGAPSVRRRFIDMEFGQM
RECF_LACBA      SGRVVKAAGAVPLELTFSRQGKRARVNHLEQARLSVGQLNVILFAPEDLAIVKGAPTVRRRFMDMEFGQM
RECF_STAAW      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAAU      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAAT      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAAS      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAAR      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAAN      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAAM      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAAE      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAAC      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAA9      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAA8      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAA2      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAA1      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_HELMI      KAMGTADGQPVVIELAFGGERRKLAKVNNRRLRRIADLMNTVVFSPEDLSLVKGSPAQRRRYLDRELSQA
RECF_STAAB      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_STAA3      EGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQI
RECF_LACRJ      SGTVEKSIGKIPLELQFSSKGKKAKVNHLEQARLSVGQLNAILFAPEDLSLVKGSPALRRHFMDREFSQM
RECF_LACRD      SGTVEKSIGKIPLELQFSSKGKKAKVNHLEQARLSVGQLNAILFAPEDLSLVKGSPALRRHFMDREFSQM
RECF_LACPL      QGRLHKSTGAVPLELELGRRGKRAKVNHLEQAKLSVGNLNVIVFAPEDLSIVKGAPAVRRRFMDMEFGQM
RECF_ALKOO      HXXXXXXHSDVHIEVRLNSERKKLKVNQIPLVKMGLGNLNVVLFSPEDLKLVKEGPSERRRFMDREISQI
RECF_LISMO      EGRIAKHGQSVPLELAITQKGKRAKVNHLEQKKLSVGNLNVVIFAPEDLSLVKGAPGIRRRFLNMEIGQM
RECF_LISMF      EGRIAKHGQSVPLELAITQKGKRAKVNHLEQKKLSVGNLNVVIFAPEDLSLVKGAPGIRRRFLNMEIGQM
RECF_LISMC      EGRIAKHGQSVPLELAITQKGKRAKVNHLEQKKLSVGNLNVVIFAPEDLSLVKGAPGIRRRFLNMEIGQM
RECF_BACHD      EGAFQKQNGPLSXXXXXXXXXXXXXXXXXEQRRLSIGAVNVVMFGPEDLNLVKGSPQIRRRFLDMELGQM
RECF_LISMH      EGRIAKHGQSVPLELAITQKGKRAKVNHLEQKKLSVGNLNVVIFAPEDLSLVKGAPGIRRRFLNMEIGQM
RECF_LISIN      EGRVVKRGQTVPLELAITQKGKRAKVNHLEQKKLSVGNLNVVIFAPEDLSLVKGAPGVRRRFLNMEIGQM
RECF_LISW6      EGRVVKRGQTVPLELAITQKGKRAKVNHLEQKKLSVGNLNVVIFAPEDLSLVKGAPGIRRRFLNMEIGQM
RECF_CLONN      SVYISKERLDKKIDIKIKEGKKGVRVNSIKKTISDLGVFNVVMFSPEDLKIVKESPSYRRKFLDIELSKL
RECF_CLOBM      RTYVSRERLDKTIDINIKNGKKAITVNKIKKKISELGNLNVVMFSPEDLRIIKDSPGNRRKFLDIELCKI
RECF_CLOPH      RMRINRDDVDHRLDMHLKKNKPKVAIDGIPIKRSS-ELFGVVFFSPEDLSIIKNGPSERRRFIDMELCQL
RECF_LACLA      SGVVEKAHATVPLEVQLSPKGRIAKANHLKENRLA-DYIGILMFAPENLELVKGSPATRRKFMDIELGQI
RECF_LYSSC      EGAVQKRHGILPIELXXXXXXXXXXXNHIEQSRLSIGQMNVVMFAPEDLNVVKGSPQIRRRFIDMEIGQI
RECF_LACF3      SGVVERASGRLPLEVQISTSGKRVKVNHLFQKRTYVGNLNVVLFAPEDLALVKGAPVNRRQFMDMEFGQM
RECF_LACLM      SGLVEKAHATVPLEVQLSSKGRIAKANHLKENRLA-DYIGILMFAPENLELVKGSPATRRRFMDIELGQI
RECF_LACAC      AGHVQKSQVTLNLRVLITKKGKKVWINRIEQAKLSVGQLNAILFSPEDLELIKGAPSLRRRFMDQEFGQI
RECF_NATTJ      KGELEKEQAQYTLEQXXXXXXXXXXXXSQTNTRNFLKTMNVVIFSPEDLMLVKGTPDNRRRFIDQEITQV
RECF_LACLS      SGLVEKAHATVPLEVQLSSKGRIAKANHLKENRLA-DYIGILMFAPENLELVKGSPATRRRFMDIELGQI
RECF_EUBR3      RTIVEKNDKEYRIDMHLRKGAKGVAINKMPIKKAS-ELFGIVFFSPEDLNIIKNGPAERRRFIDLELCQL
RECF_STREM      SGTLERLSGRVQLEILLSDKGRITKINTLKQAKLS-DYIGVVLFAPEDLQLVKGSPSLRRKFMDIDLGQI
RECF_STRGC      SGILEKKTGTIPLDIELTAKGRITKINHLKQNRDYIGAMNVVLFAPEDLQLIKGSPSLRRKFIDIELGQI
RECF_STRE4      SGTLERLSGRVQLEILLSDKGRITKINTLKQAKLS-DYIGVVLFAPEDLQLVKGSPNLRRKFMDIDLGQI
RECF_STRS7      SGTLERLSGRVQLEILLSDKGRITKINTLKQAKLS-DYIGVVLFAPEDLQLVKGSPSLRRKFMDIDLGQI
RECF_STRSV      SGILEKKTGKVPLDINLTPKGRITKVNHLKQSKDYIGTMNVVLFAPEDIQLIKGSPSLRRKFIDIELGQI
RECF_CLOD6      GGSFSKYNKYSLIELIIGKDKKGIRINKVQKIQELLGNLNVVIFSPEDLRLVKEGPKERRAFIDKEISQI
RECF_STRMU      SGLLNRVNGKIPLEINLSNKGRTTKINYLKQPKDYIGTMTVVLFAPEDLQLIKGSPSLRRKFIDIDLGQI
RECF_STRA1      TGEVIRKSGHLSLDIQLSEKGRITKVNHLKQAKDYIGAMTVVLFAPEDLQLVKGAPSLRRKFLDIDIGQI
RECF_CLOK5      KVHXXXXXXXXXXXXXXXXXXXXXXXXNVSKLSELMGVLNVVMFSPEDLKIIKESPVYRRKFLDIELCKF
RECF_CLOBK      RTYVSRERLDKTIDINIKNGKKAITVNKIKKKISELGNLNVVMFSPEDLRIIKDSPGNRRKFLDIELCKI
RECF_CLOBJ      RTYVSRERLDKTIDINIKNGKKAITVNKIKKKISELGNLNVVMFSPEDLRIIKDSPGNRRKFLDIELCKI
RECF_CLOB6      RTYVSRERLDKTIDINIKNGKKAITVNKIKKKISELGNLNVVMFSPEDLRIIKDSPGNRRKFLDIELCKI
RECF_CLOB1      RTYVSRERLDKTIDINIKNGKKAITVNKIKKKISELGNLNVVMFSPEDLRIIKDSPGNRRKFLDIELCKI
RECF_STRU0      IGKLNRISGALSLELQLSDKGRITKINALKQARLS-DYIGVVLFAPEDLQLIKGAPSLRRKFIDIDLGQI
RECF_STRA5      TGEVIRKSGHLNLDIQLSEKGRITKVNHLKQAKDYIGAMTVVLFAPEDLQLVKGAPSLRRKFLDIDIGQI
RECF_STRA3      TGEVIRKSGHLNLDIQLSEKGRITKVNHLKQAKDYIGAMTVVLFAPEDLQLVKGAPSLRRKFLDIDIGQI
RECF_LACH4      LGHVRKSQVDLTLRVLITQKGKKVWINRVEQAKLSVGQLNAILFSPEDLELIKSAPALRRRFMDQEFGQI
RECF_LACDB      AGRVHKRQLDLDLRIVISKKGKSAWVNRVEQARLSVGHLNAILFSPEDMELVKGAPSLRRRFMDLEFGQI
RECF_CLOBL      RTYVSRERLDKTIDINIKNGKKAITVNKIKKKISELGNLNVVMFSPEDLRIIKDYPGNRRKFLDIELCKI
RECF_STRZJ      SGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARDYVGHMNVVLFAPEDLQLIKGAPSIRRKFIDMELGQI
RECF_STRPJ      SGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARDYVGHMNVVLFAPEDLQLIKGAPSIRRKFIDMELGQI
RECF_STRP7      SGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARDYVGHMNVVLFAPEDLQLIKGAPSIRRKFIDMELGQI
RECF_STRP4      SGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARDYVGHMNVVLFAPEDLQLIKGAPSIRRKFIDMELGQI
RECF_LACDA      AGRVHKRQLDLDLRIVISKKGKSAWVNRVEQARLSVGHLNAILFSPEDMELVKGAPSLRRRFMDLEFGQI
RECF_MOOTA      RGLCHSNGEKIELVINYQQHNKRLTINGNRNRLIELGIFPVIYFGPDDLHLLKGGPAYRRHFLDREISMG
RECF_CLOAB      RLNLSLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGIFNVVMFSPEDLKIVKESPGHRRKFLDMEISKL
RECF_STRZT      SGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARDYVGHMNVVLFAPEDLQLIKGAPSIRRKFIDMELGQI
RECF_STRZP      SGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARDYVGHMNVVLFAPEDLQLIKGAPSIRRKFIDMELGQI
RECF_STRR6      SGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARDYVGHMNVVLFAPEDLQLIKGAPSIRRKFIDMELGQI
RECF_STRPN      SGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARDYVGHMNVVLFAPEDLQLIKGAPSIRRKFIDMELGQI
RECF_STRPI      SGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARDYVGHMNVVLFAPEDLQLIKGAPSIRRKFIDMELGQI
RECF_STRP2      SGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARDYVGHMNVVLFAPEDLQLIKGAPSIRRKFIDMELGQI
RECF_STRPS      SGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARDYVGHMNVVLFAPEDLQLIKGAPSIRRKFIDMELGQI
RECF_STRPZ      TGKIQRISGTVDLEINLSDKGRVTKINALKQAKLS-DYIGVVLFAPEDLQLVKGAPSLRRKFIDIDLGQI
RECF_STRP3      TGKIQRISGTVDLEINLSDKGRVTKINALKQAKLS-DYIGVVLFAPEDLQLVKGAPSLRRKFIDIDLGQI
RECF_STRPG      TGKIQRISGTVDLEINLSDKGRVTKINALKQAKLS-DYIGVVLFAPEDLQLVKGAPSLRRKFIDIDLGQI
RECF_STRPD      TGKIQRISGTVDLEINLSDKGRVTKINALKQAKLS-DYIGVVLFAPEDLQLVKGAPSLRRKFIDIDLGQI
RECF_STRP8      TGKIQRISGTVDLEINLSDKGRVTKINALKQAKLS-DYIGVVLFAPEDLQLVKGAPSLRRKFIDIDLGQI
RECF_STRP6      TGKIQRISGTVDLEINLSDKGRVTKINALKQAKLS-DYIGVVLFAPEDLQLVKGAPSLRRKFIDIDLGQI
RECF_STRPF      TGKIQRISGTVDLEINLSDKGRVTKINALKQAKLS-DYIGVVLFAPEDLQLVKGAPSLRRKFIDIDLGQI
RECF_STRP1      TGKIQRISGTVDLEINLSDKGRVTKINALKQAKLS-DYIGVVLFAPEDLQLVKGAPSLRRKFIDIDLGQI
RECF_STRPC      TGKIQRISGTVDLEINLSDKGRVTKINALKQAKLS-DYIGVVLFAPEDLQLVKGAPSLRRKFIDIDLGQI
RECF_STRPM      TGKIQRISGTVDLEINLSDKGRVTKINALKQAKLS-DYIGVVLFAPEDLQLVKGAPSLRRKFIDIDLGQI
RECF_STRPB      TGKIQRISGTVDLEINLSDKGRVTKINALKQAKLS-DYIGVVLFAPEDLQLVKGAPSLRRKFIDIDLGQI
RECF_EUBE2      KLNVLKHGMKYRIDMHLKKNKTKIAVNGIPIKKA-VELFGIVFFSPEDLNIIKNGPSERRRFMDMELSQL
RECF_CLOPS      RLDVHKDDKIIDVNILKDGXXXXXXXXXXXXXXGELGTFNVVMFSPEDLKIVKESPGIRRRFIDMELSQL
RECF_CLOPE      RLDVHKDDKIIDVNILKDGXXXXXXXXXXXXXXGELGTFNVVMFSPEDLKIVKESPGIRRRFIDMELSQL
RECF_CLOP1      RLDVHKDDKIIDVNILKDGXXXXXXXXXXXXXXGELGTFNVVMFSPEDLKIVKESPGIRRRFIDMELSQL
RECF_STRTD      NGIVHRHSGNLPLEINLSNKGRVTKVNYLKQAKLS-DYIGVVLFAPEDLQLVKGSPSLRRKFIDIDLGQI
RECF_STRT1      NGIVHRHSGNLPLEINLSNKGRVTKVNYLKQAKLS-DYIGVVLFAPEDLQLVKGSPSLRRKFIDIDLGQI
RECF_STRT2      NGIVHRHSGNLPLEINLSNKGRVTKVNYLKQAKLS-DYIGVVLFAPEDLQLVKGSPSLRRKFIDIDLGQI
RECF_CLOB8      SLLIGKNRLDKKIDINILRDGXXXXXXXXXXXXXXGELFGVVMFSPEDLKVIKEAPSLRRRLLDMELSQV
RECF_DESHY      YGDFIVQRRKLRLESHYQDKRKIIKINQIPRKLSEVGTINVVFFSPDDLVMVKGGPAERRRFLDLHIAQH
RECF_DESHD      YGDFIVQRRKLRLESHYQDKRKIIKINQIPRKLSEVGTINVVFFSPDDLVMVKGGPAERRRFLDLHIAQH
RECF_CLOCE      AVHVSKTGGLDKIEISYYENQKKIKINDIKKIGALMGNLYAVLFSPEDLFIVKQGPTERRRFVDITLSQI
RECF_STRSY      SGLLHRTSGKVPLDIHLTDKGRVTKVNHLKQAKNYIGHMNVVLFAPEDLQLIKGAPALRRKFIDVELGQI
RECF_STRS2      SGLLHRTSGKVPLDIHLTDKGRVTKVNHLKQAKNYIGHMNVVLFAPEDLQLIKGAPALRRKFIDVELGQI
RECF_ACAM1      TATLQRESGPLDLSLTLRNGRRTVSVNS-ETIRRQLDFLGIVQFSSLDMDLVRGGPGERRNWLDAVLVQL
RECF_CHLAD      ERRIGPVRLEILVQRRLDDGGQPL--NGAQRPARAIDLIGVVLFTPTDVMLVDGPPAERRRYLDITLSQL
RECF_GEOUR      KGWVERDGVTREIALFIDKQGKKIKLDRKSVTKVD-EFFGVVVFTPEEINMVRGVPDLRRKYLDRAVFSS
RECF_CYAA5      MVERTYGESELGITFR-SPGRRSLMLNH-ENLRRHLDFLGAVEFSCLDLDLVRGSPETRRSWLDTLLIQL
RECF_THEPX      KAIICQENNDKKIEFGYXXXXXXXXXXXXXXXXSTSELLGTVIFSPEDLNIIKEGPSHRRKYLDSCISVV
RECF_THEP3      KAIICQENNDKKIEFGYXXXXXXXXXXXXXXXXSTSELLGTVIFSPEDLNIIKEGPSHRRKYLDSCISVV
RECF_SYMTH      RAAVVRRTGTIELELRCGQTRKQLKINGIERKIARLGSLAVVLFSPDDLQLLKGPPSGRRRFLDLELSQI
RECF_ROSCS      VCDVVRADGYVRLEVVVQRRAEEESAIGARKAVRALDLVGVVLFTPADIALVTGAPAERRRYLDVTLSQI
RECF_STRGG      RAAVTQGERSQLIELELNPGRARINRSSQVRPRDVLGIVRTVLFAPEDLALVKGDPGERRRFLDELITAR
RECF_NOSP7      NATLERQTGVSDLTLTLRNGRRSVALNG-ESIRRQMDFLGVVQFSSLDLDLVRGGPEGRRNWLDTLLIQL
RECF_STRAW      RAQVRQDERRQLVELELNPGKARINRSSQVRPRDVLGIVRTVLFAPEDLALIKGDPGERRRFLDELITAR
RECF_CYAP8      TAKIERNYGTSDLAITLRSGRRTLTLNH-EHLRRHLEFLGAVQFSSLDLDLVRGSPDARRNWLDTLLVQL
RECF_ANASP      NATLERDTGVSDLSLILRNGRRTVALNG-EPLRRQMDFLGVVQFSSLDLELVRGSPEVRRNWLDTLLIQL
RECF_TRIEI      QASLERQLGNIDLALTLRQGKRTVAVNGISRHLDFLSILNVVHFSSLDLDLVRGGPEVRRYWLDRLLVQL
RECF_CHLSY      AADVERRIGPVRLEVLVQRRADDQPLNGAQRPARAIDLIGVVLFTPTDLTLVDGPPAERRRYLDITLSQL
RECF_CHLAA      AADVERRIGPVRLEVLVQRRADDQPLNGAQRPARAIDLIGVVLFTPTDLTLVDGPPAERRRYLDITLSQL
RECF_STRCO      RAQVRQGERQQLIELELNPGRARVNRSSQVKPRDVLGIVRTVLFAPEDLALVKGDPGERRRFLDELITAR
RECF_CLOBB      SLLVXXXXXXXXXXXXXXXXXXKVNSIKINKIGELFGTFNVVMFSPEDLKIIKESPGIRRKFLDMELCQI
RECF_CHLT3      EAVLQSDSEKVRVYYSPAEGKHVINKTPLESFSKIVGEFPCVALSPYDIALTQGSPQERRRFLDASISQT
RECF_PARUW      EAQFYKHGIEQTLKFGFHTTDRKIIYNSLATLSNLLGLIPGVIITPDDVQLVKGSPQLRRQFLDIQIAQV
RECF_CYAP4      AT-IERDSGPLDLTLNLRSNGRRTLMVNSEPVRRHLDFLGAVEFSSLDLDLVRGTPAERRNWLDNVLIQL
RECF_CHLPB      QGTF-ADDRGIELSVKVKNVEKKIFINSDELKKYS-QLIGCVTFSPMELSLVNGSPQERRRFMDNALSQT
RECF_RENSM      RGNLVRGTQRLGLEVEIXXXXXXXXXXXXXXXXXXXEILGLVLFAPEDLSLVKGDPGNRRRFLDDLLQSL
RECF_CLOBA      SLLVXXXXXXXXXXXXXXXXXXKVNSIKINKIGELFGTFNVVMFSPEDLKIIKESPGIRRKFLDMELCQI
RECF_ARTS2      RAKLVRGGQSTVLELEIN-GSRRINRSNPVRARDILGICQTVLFAPEDLALVKGDPSNRRRFLDELLVSL
RECF_CYAP7      LATLERAYGLAELGLILRVSGRRTVILNQEPLRRQLDFLGVVQFSSLDLDLVRGSPESRRSWIDTLLVQL
RECF_MICAN      FARVNRLYGASELSLILRSSGRRTVIRDRQPLRRHLDFLGVVQFSSLDLDLVRGGPEARRDWLDTLLIQL
RECF_ANAVT      NATLERDTGVSDLSLILRNGRRTVALNG-ESLRRQMDFLGVVQFSSLDLELVRGSPEVRRNWLDTLLIQL
RECF_CORJK      ATAVNNGRELTAHLAIRARGSNRAHINRAAM-NSQRDLLGVVLFSPEDLALIRGEPEQRRHFLDAIMVAR
RECF_ACIC1      HGEVLTSGRRIDLDVEIVPGANRLRVNGTRRARDLVGILRVVIFAPEDLALVKGDPAARRDYLDDVLVEL
RECF_HERA2      QPEAEMQTIEIVLQRKFGADSKTIRINKIAR--RALDLIGVVMFAPQDLELVTGAPAERRRYLDVTLSQI
RECF_GEOBB      KGTVERDQVRREIAVLIEKQGKKAKVDAKLMTRLD-DFFGVVLFTPEEISMVRGGPDLRRRYLDRAVFTC
RECF_CORDI      VTAVNHGRELTAHLLIKAKGANQAQINRLKSPRELLGVVKTVLFSPEDLSLVRGDPAERRRYLDHVIATR
RECF_GLOVI      AATVERLGDTVELEMILRAXXXXXXXXXXXXXXXXXEALGYVSFSSLDLDLVRGAPETRRDWLDGILLQL
RECF_MYCGI      STIIVNEGRELAVDLDITSGKARLNRSPVRSAREILGVLRAVLFAPEDLALVRGDPGDRRRYLDELATTR
RECF_GEOSM      KGTVERDQVRREIAVLIEKQGKKAKVDAKLMTRLD-DFFGVVLFTPEEISMVRGGPDLRRRYLDRAVFTC
RECF_THEFY      XXXXXXHGQTALIELEINPGRARLNRSPNTRMRDVLGILHTVLFAPEDLALVKGDPGERRRFLDELLTAR
RECF_CHLTR      EAVFSHKEVFHTLSIQVDKKGKKILFDGAPITKSELGLFPVILFSIKDIAIIEGSPSERRRFLDLLLAQA
RECF_CHLTB      EAVFSHKEVFHTLSIQVDKKGKKILFDGAPITKSELGLFPVILFSIKDIAIIEGSPSERRRFLDLLLAQA
RECF_CHLTA      EAVFSHKEVFHTLSIQVDKKGKKILFDGAPITKSELGLFPVILFSIKDIAIIEGSPSERRRFLDLLLAQA
RECF_CHLT2      EAVFSHKEVFHTLSIQVDKKGKKILFDGAPITKSELGLFPVILFSIKDIAIIEGSPSERRRFLDLLLAQA
RECF_CORGL      SAVAVNQGRELAAHLLIKHAANQASLNRVRTPRELLGVVKTVLFAPEDLALVKGEPAERRRYLDDIIATR
RECF_CHLTE      RSSFT-SGQGIATKVSITKREKRILVNEQELQTSHIGTIPCVTFTPREMVIINGAPAERRRFIDTAICQY
RECF_PROA2      KS---LFTSDTGCQYRVHNGGKSISLNNLEKFSALIGLIPCILFSPAEITIVHGSPQERRRFLDNALCQI
RECF_CORGB      SAVAVNQGRELAAHLLIKHAANQASLNRVRTPRELLGVVKTVLFAPEDLALVKGEPAERRRYLDDIIATR
RECF_THERP      FTETERSTLEIVLMVDPASGTVRKLYRRDGRSLRAVEFVGVVLFSPEDLELVTGSPQQRRRYLDTILSTI
RECF_CHLP8      RSSFT-SGQGIATKVSVAKREKRILVNEQELQTSHIGTIPCVTFTPREMVIINGAPAERRRFIDTAICQY
RECF_CHLMU      EAVFSQNQVFHTLSIQVDKRGKKILFDGITKLSALVGLFPVILFSVKDTTIIEGSPAERRRFLDLLLAQA
RECF_CHLFF      EMTCEKDGFSHKLSIYVDKHGKKIDQSPIKTLSQLIGMVPIVLFSSKDRLLISGSPSDRRLFLNLLLSQC
RECF_SYNWW      QARYNHQERIIDSSITYGLDGKVFRINKKRASYNHTDRLRIILFSPDDLYLVKGAPYKRRFFLDFLLGQI
RECF_GEOSF      KGWVERDGVTREIAVFLDNQGKKIRVDQKAVTRID-DFFGVVVFTPEEVNMVKGLPELRRKYLDRAVFSS
RECF_SYNY3      KALLERQYSVAELEIDLRRSGRRNLRINQNQCRRQLDFLGAVEFSCLDLDLVRGAPDCRRQWLDTLLTQL
RECF_GEOLS      XXXXXXXXXESTIVLHVENSTRRVTIDDKAVHRAA-DLHGVVVFSPDDTAMVKLGPETRRRYLDRSLYAS
RECF_COREF      NQGRELAAHLLIKPHAANQG--QINRTRVKSPRELLGVIKTVLFAPEDLALVRGEPAERRRYLDDIIATR
RECF_TROWT      SAKIQSKYGTRNVYIGISCNSNNLKVDGKSKLRDLVSVFSCVIFSPEDIDLVKGDPGHRRKYLDDIICRA
RECF_TROW8      SAKIQSKYGTRNVYIGISCNSNNLKVDGKSKLRDLVSVFSCVIFSPEDIDLVKGDPGHRRKYLDDIICRA
RECF_CHLL2      NGRF-ISDALKEDGVKVRDNGKKLTVNGQDLTSFSQHIGSIITFSPAEMSVINGSPVERRRFLDNAICQA
RECF_MYCSS      STIVVNEGRELAVDLEITTGKARLNRSPVRSPREVLGVLRAVLFAPEDLALVRGDPGERRRYLDELATTR
RECF_MYCSK      STIVVNEGRELAVDLEITTGKARLNRSPVRSPREVLGVLRAVLFAPEDLALVRGDPGERRRYLDELATTR
RECF_MYCSJ      STIVVNEGRELAVDLEITTGKARLNRSPVRSPREVLGVLRAVLFAPEDLALVRGDPGERRRYLDELATTR
RECF_ARTAT      RAKLVRGEQSTVIELEXXXXXXXXXXXXXXXPVRARDILGIVLFAPEDLALVKGDPSNRRRFLDELLVSL
RECF_CORA7      NQGRELTAHLLIKPHAANQA--QINRTRLKSPRELLGVVKTVLFSPEDLSLVRGEPAARRQYLDDIIASR
RECF_THEEB      QIEATLERQGVPLDLAVSSSGRVLRVNGVKRTADFLGQLNAVEFSCLDLELVRGTPAIRRNWLDRIXXXX
RECF_LEPIC      RGKINLKESVLEIGFTSKPSVKRKLKFNQEEIKKRTDLIGTVLLTPMDLKIIEGGPAERRKFIDAFISSF
RECF_LEPIN      RGKINLKESVLEIGFTSKPSVKRKLKFNQEEIKKRTDLIGTVLLTPMDLKIIEGGPAERRKFIDAFISSF
RECF_CLAMS      RALLQHAGRELRVEVQIRSAANRAQVNGTATKTRELPYFSSVLFAPEDLALVRGDPSGXXXXXXXXXXXX
RECF_SALRD      EGQVREEPMTVRLAYVPGEG-KSIFVNGAELDRLA-DIVGVVVFSPEDYDLTAGGPSERRRFVNNILSQA
RECF_MYCVP      STIVVNDGRELAVDLDITSGKARLNRSPVRSAREILGVLRAVLFAPEDLALVRGDPGERRRYLDELATTR
RECF_LEIXX      RARIQHEARELLVEVQLNRGANRAQVNRAAKPRELPRYFSSVLFAPEDLALVRGEPGVRRRFLDQLLIQR
RECF_PROVI      TALFESSSGIVRLSYT-KESGKKLQIDGNELKPFSLHIGSIISFSPPEIVIVSGPPGERRRFLDNAVCQS
RECF_FLAJ1      DAELEKNDRTEQIVCSLKKGQKKLKRNGYDKFSDHIGFIPLVIISPADRDLIVEGSETRRKFMDSVISQL
RECF_LEPBL      RGKIKGDQKVLEVGFTAKPTVKRKLKFNQEEVKKRTDLIGTVLLTPMDLKIIEGGPAERRKFIDAFISSF
RECF_LEPBJ      RGKIKGDQKVLEVGFTAKPTVKRKLKFNQEEVKKRTDLIGTVLLTPMDLKIIEGGPAERRKFIDAFISSF
RECF_ARTCA      RARLVRNGQTTVLELEXXXXXXXXXXXXXXXPVRARDLLGIVLFAPEDLALVKGDPSNRRRFLDELLASL
RECF_SYNE7      TAVVERDSGEXXXXXXXXXXXXXXXXXDGEVLRRQLDLLGSVQFSSLDLDLVRGGPQQRRDWLDRLLIQL
RECF_PELLD      SGEF-VSTRGTSLSVKVSYGKKLVQLNQSEKPFSQVGTIPCITFSPSEIAIVNGSPGERRRFLDNALSSX
RECF_FLAPJ      DGEFDKQERSENILCSLKKGQKKLKRNGYEKFSDHLGFIPLVIISPTDADLIREGSETRRKFIDSVISQL
RECF_SYNP6      TAVVERDSGEXXXXXXXXXXXXXXXXXDGEVLRRQLDLLGSVQFSSLDLDLVRGGPQQRRVWLDRLLIQL
RECF_MYCPA      STIVVNDGRECAVDLEIAAGKARLNRSPVRSTREVLGVLRAVLFAPEDLALVRGDPSERRRYLDDLATLR
RECF_THETN      RGLVRSADFYEKIEFXXXXXXXXXXXXXXXXLKSTGEILGTVIFSPEDIEIIKEGPSRRRKYLDACISVI
RECF_SYNJB      AATVERLGVAHELVMELRSGRRSLKVDGLRRQADFLGQVNAVVFSSLDLELVRGGPEARRNWLDGVLLQL
RECF_KINRD      RAQLERGGRRALVELEITPGKARLNGNPVRRTRDVLGVLRTVLFAPEDLALVKGDPGERRRYLDELLVTR
RECF_CARHZ      GAKISKNGQKTTLGVEYSVKGKFFLKNG-QKQKSFSSILGNVLFTPDEPVIFFGFPANRRKALDLFLAQT
RECF_SYNJA      AATVERLGVAHELAMELRQGGRSLRVNGLRRQSDFLGQVSAVVFSSLDLELVRGAPEARRTWLDGVLLQL
RECF_MYCTU      STIVVNDGRECAVDLEIATGKARLNRSSVRSTRDVVGVLRAVLFAPEDLGLVRGDPADRRRYLDDLXXXX
RECF_MYCTA      STIVVNDGRECAVDLEIATGKARLNRSSVRSTRDVVGVLRAVLFAPEDLGLVRGDPADRRRYLDDLXXXX
RECF_PROAC      RGRVRAGSLLLEVEXXXXXXXXXXXXXXLTRPRDILGVLRTVVFSPNDLAVVRGDPSDRRAFLDGLVVTR
RECF_CHLCV      EMTFEKDGFCHTLSTYVDKQGKKIDHSPIKTLSQLIGMVPIVLFSSKDRSLISGAPADRRLFLNLLLSQC
RECF_PELCD      QGEFLRDGLRETVSITITGDKKNIEING-KRPRQSNEMFGSVLFAPEEVSLPKGFPAGRRALLDRALCQT
RECF_MYCBT      STIVVNDGRECAVDLEIATGKARLNRSSVRSTRDVVGVLRAVLFAPEDLGLVRGDPADRRRYLDDLXXXX
RECF_MYCBO      STIVVNDGRECAVDLEIATGKARLNRSSVRSTRDVVGVLRAVLFAPEDLGLVRGDPADRRRYLDDLXXXX
RECF_MYCSM      STIVVNEGRELAVDLEITSGKARLNRSPVRSAREILGVLRAVLFSPEDLSLVRGDPGDRRRYLDELATTR
RECF_MYCS2      STIVVNEGRELAVDLEITSGKARLNRSPVRSAREILGVLRAVLFSPEDLSLVRGDPGDRRRYLDELATTR
RECF_NOCFA      GANVVNAGRELRIDVELNQGSAQINRSPVRRTREILGILQTVLFAPEDLALVRGDPGERRRFLDELCTAR
RECF_GEOSL      RGDIDKAGVRREIALYLGREGRKARID--RKPVTKLDFFGAVVFSPEEIGMARGGPELRRRYLDRAIFNG
RECF_DEIRA      RADLQQGGSLSIQEVGLGRGRRQLKVDGVRARTGDLPRGGAVWIRPEDSELVFGPPSGRRAYLDSLLSRL
RECF_MYCA1      STIVVNDGRECAVDLEIAAGKARLNRSPVRSTREVLGVLRAVLFAPEDLALVRGDPSERRRYLDDLATLR
RECF_FRAAA      RARIVRGDRAALVELEIVPGRARLNRAPVPRPRDVLGLLCTVLFAPEDLALVKGDPAGRRQFLDELLVAR
RECF_SYNP2      QAQIQRGYGTVDFDLLLRQGGRTLKLNG-EILRRQLDGLGTVEFSCLDLDLVRGGPDCRRQWIDNLLIQL
RECF_ACHLI      --KLIEDSKLHEIV--LTPNGKRTTINKSE-VRKISDYIGVVMFAPEDLMLIKGSPSERRYFLDMELMQV
RECF_DEIDV      RADLESGGSLSIQEVGLGRGRRQLKVDGVRVRAGDLPRGSAVWIRPEDSELVFGSPSGRRNFLDALLSRL
RECF_ACHLA      --KLIEDSKLHEIV--LTPNGKRTTINKSE-VRKISDYIGVVMFAPEDLMLIKGSPSERRYFLDMELMQV
RECF_SALTO      RCAVVHEGRELLVELEIVPGRARLGRSPARRARDVLGALRLVLFAPEDLELVRGDPAQXXXXXXXXXXXX
RECF_LEPBP      RAEFESEGNEYLFEYGIEHSQKKLKVNGEEFKKISVGYFRSIVMSPPDILIIEDGNVERRRFLDAFISST
RECF_LEPBA      RAEFESEGNEYLFEYGIEHSQKKLKVNGEEFKKISVGYFRSIVMSPPDILIIEDGNVERRRFLDAFISST
RECF_MYCLE      STIVVNEGRECAIDLEIXXXXXXXXXXXXSLVRGMREVVGVVLFAPEDLALVCGDPANRRRYLDDLATVR
RECF_MYCLB      STIVVNEGRECAIDLEIXXXXXXXXXXXXSLVRGMREVVGVVLFAPEDLALVCGDPANRRRYLDDLATVR
RECF_GEOMG      RGWAERDGVGREIALYLGKEGRKARVD--QKPVTRLDFFGAVVFSPEEIAMARSGPDLRRRYLDRAIFSG
RECF_BEUC1      XXXXXXXXXPTLVELEIVAGRARVDRSPVSRVREAAGIARSVIFAPEDLALVKGDPDGRRRFLDDLLVQL
RECF_CLAM3      RALLQHAGRELRVEVQIRSAANRAQVNSTTKPRELPRYFSSVLFAPEDLALVRGDPSGXXXXXXXXXXXX
RECF_SALAI      RCAVVHEGRELLIELEIVPGRARLGRSPARRARDVLGALRLVLFAPEDLELVRGDPAEXXXXXXXXXXXX
RECF_CHLAB      EMTFEKDGVPHTLSTYVDKHGKKIDQSPIKTLSQLIGMIPIVLFSAKDRCLIAGAPSDRRLFLNLLLSQC
RECF_DEIGD      RADVQQGGSLSIQEVGLGRGRRHLKVDGVRAKTGDLPRGSAVWIRPEDSELVFGPPAGRRAYLDALLSRL
RECF_SHEB2      FATLNLARGDSKIGLRFRSGETEVRIDGVKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHA
RECF_RHOSR      GATVVNAGRELTVDLELNEGKSRINQSPTRRPREILGILQTVLFAPEDLSLVRGDPGDRRRYLDELLTSR
RECF_SHEB9      FATLNLARGDSKIGLRFRSGETEVRIDGVKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHA
RECF_SHEB5      FATLNLARGDSKIGLRFRSGETEVRIDGVKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHA
RECF_SHEB8      FATLNLARGDSKIGLRFRSGETEVRIDGVKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHA
RECF_XYLFT      FVDINARRRRAGLSHYGQEWIGRLDGQKIMHLASLCAALAVITFESSSYQLINSNAELRRRFLDWGLFHV
RECF_XYLF2      FVDINARRRRAGLSHYGQEWIGRLDGQKIMHLASLCAALAVITFESSSYQLINSNAELRRRFLDWGLFHV
RECF_CYTH3      LGWFQENAKEFKIQYDFD--GKKKSFTVDKKPYAKISRFPAIVLTPHDTDLIRNSSEDRRRFFDTLFSQA
RECF_BIFLI      TIRANVADDAG--QTTTYEAS--IHARGANRARSSLDIIGKVSFTPEDQRLVSGDPGARRTMMNQAAALL
RECF_SHESW      FATLNLASKIGLRRFRSGETEVKIDGEKVKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHA
RECF_SHEPC      FATLNLASKIGLRRFRSGETEVKIDGEKVKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHA
RECF_MYCMM      STIVVNDGRECAVDLEIAAGKARLNRSPVRSTREVIGVLRAVLFAPEDLALVRGDPADRRRYLDDLATLR
RECF_SACEN      RAAVVNHGRELLVELEITPXXXXXXXXXXXXPRDVLGILRTVLFAPEDMAMVRGDPGERRRFLDDLLVAR
RECF_RHOOB      GATVVNTGRELTVDLELNEGKSRINQSPTRRPREILGILQTVLFAPEDLSLVRGDPGDRRRYLDELLTSR
RECF_MYXXD      TGRFLLKGAEREIAVEVGGGTRQAFVDG-KKASSLEDYFGVVAFTPDDLEVVKGGPDSRRGFLDRAVFNR
RECF_GRAFK      EGEFKKNDKAEKILASAKKGQKKINNKAYEKVSDHIGFIPTVIISPADRDLIIEGSETRRKFMDGVISQS
RECF_BIFAA      TVRANVEDAGEQRTYEITIAARGANRARVDGGKSQYDIVGSVSFTPEDQRLVSGDPATRRNFLNQAASLL
RECF_SHESR      FATLNLDSKIGLRRFRSGETEVKIDGEKVKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHS
RECF_SHESA      FATLNLDSKIGLRRFRSGETEVKIDGEKVKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHS
RECF_MYCUA      STIVVNDGRECAVDLEIAAGKARLNRSPVRSTREVIGVLRAVLFAPEDLALVRGDPADRRRYLDDLATLR
RECF_SHESM      FATLNLDSKIGLRRFRSGETEVKIDGEKVKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHS
RECF_IDILO      CRSQDYAIGVRRST----DGEQSLRLNGVQRMSDVARLVPVQLLTPESVDILLEGPGQRRQFIDWGVFHV
RECF_RHOE4      GATVVNNGRELTIDVELIEGKSRINQSPTRRPREVLGILQSVMFAPEDLSLVRGDPGDRRRYLDELLTSR
RECF_PSYIN      FSEINNGSIPIGLQ-KSKSGETLLKINGCKKLANLTQYLPLQLITPEGYTLLSGSPKNRRAFLDWGVFYH
RECF_XYLFM      FVDINARRHRAGLSHYGQEWIGRLDGQKIIHLASLCAALAVITFESSSYQLINSNAELRRRFLDWGLFHV
RECF_XANAC      FVEWKEGTRRAGLRHSGQEWTGRLDGEDVAQLGSLCAALAVVTFEPGSHVLISGGGEPRRRFLDWGLFHV
RECF_SHEON      FATLNLDSKIGLRRFRSGETEVKIDGEKVKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHT
RECF_XYLFA      FVDINARRRRAGLSHYGQEWIGRLDGQKIMHLATLCAALAVITFESSSYQLINSNAELRRRFLDWGLFHV
RECF_XANC5      NGAAGERTRRAGLRHRGQEWTGRLDGEDVAQLGALCAALAVVTFEPGSHVLISGGGEPRRRFLDWGLFHV
RECF_PSEHT      HGRKAIHDLSIPIGSKTQAGETNLKIQGASRKISELQLMPVQIITPESYSLFFGGPKERRKFLDLGLFHV
RECF_STRM5      EWDEQRASRKAGLRHSGQDWKGRLDGEDVAQLGNLCAALAVVTFEPGSHALVSGGGEPRRRFLDWGLFHV
RECF_PARD8      QGNYDYEGRIFCAMXXXXXXXXXXXXXEYDKLSEHIGLLPLVMVSPADADLIRGGSDERRRFLDLIISQQ
RECF_STRMK      FVEWDEQRRKAGLRHSGQDWKGRLDGEDVAQLGNLCAALAVVTFEPGSHALVSGGGEPRRRFLDWGLFHV
RECF_OPITP      SSELTHEQLGTKLTIKLRRDGKELDATRVTRLADHLGRFPTVVFSSQDLHLVRGAPALRRRWLDLTLASM
RECF_NITOC      KVKQVGGSHTAGVEFGPAGFRARINKDTVKKRSQLATQLPLLYMSSYSHVVLDGGPRYRRQWLDWSLFHL
RECF_SHEAM      VAEGQAGDSRIGLR-RHRSGDTEVKIDGVKRLSQLAEALPIQVITPESFSLLFEGPSARRQFIDWGAFHA
RECF_XANCP      FVESTERTRRAGLRHSGQEWTGRLDGEDVAQLGSLCAALAVVTFEPGSHVLISGGGEPRRRFLDWGLFHV
RECF_XANC8      FVESTERTRRAGLRHSGQEWTGRLDGEDVAQLGSLCAALAVVTFEPGSHVLISGGGEPRRRFLDWGLFHV
RECF_SHEPW      FANMQSAEDESKIGLRFRSGEIEVKINGVKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHS
RECF_SHEPA      NMESGDEQSKIGLR-RFRSGDIEVKINGVKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHS
RECF_PORGI      GLYRDESGDGIELLLSIRPGKHKVNKKEYERLSDHIGRFPLVIVSPQDYQLILGGSDERRRFMDQQLCQQ
RECF_XANOR      FVEAGERTRRAGLRHSGQEWTGRLDGEDVAQLGSLCAALAVVTFEPGSHVLISGGGEPRRRFLDWGLFHV
RECF_SHEFN      FAHLIDADRDCKIGLRHRSGEIEVKIDGVKRLSTLAETLPIQVITPESFSLLFEGPKARRQFIDWGAFHS
RECF_PORG3      GLYRDESGDGIELLLSIRPGKHKVNKKEYERLSDHIGHFPLVIVSPQDYQLILGGSDERRRFMDQQLCQQ
RECF_XANOM      FVEAGERTRRAGLRHSGQEWTGRLDGEDVAQLGSLCAALAVVTFEPGSHVLISGGGEPRRRFLDWGLFHV
RECF_SHEWM      FANLSLGEQESKIGLRFRSGETEVKINGIKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHS
RECF_SHESH      FANLNVLDKESKIGLRFRSGETEVKIDGVKRLSTLAESLPIQVITPESFALLFEGPKSRRQFIDWGAFHC
RECF_PROMI      HSGLDEESRGYSIGLKDREGNSTVRIDGSDGHKAELKLLPMQLITPEGFTLLNGGPKYRRAFIDWGCFHN
RECF_PROMH      HSGLDEESRGYSIGLKDREGNSTVRIDGSDGHKAELKLLPMQLITPEGFTLLNGGPKYRRAFIDWGCFHN
RECF_MICLC      AGRVHRGSRTVALKVEILPGSNRVAINASVRAKEGLGILRTVVFAPEDLSLVTGEPGGRRRLLDQLMVQL
RECF_SHIFL      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ERWT9      HGRIATAEREISVLTKNRAGDSKVRIDGSDGHKAELQMLPMQLITPEGFTLLNGGPKYRRAYIDWGCFHN
RECF_ECOSE      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_YERPY      HGRVDANEREASVGLKSRQGDTKVRIDGTDGHKAELQMLPMQLITPEGFTLLNGGPKFRRAFLDWGCFHN
RECF_YERPS      HGRVDANEREASVGLKSRQGDTKVRIDGTDGHKAELQMLPMQLITPEGFTLLNGGPKFRRAFLDWGCFHN
RECF_YERPG      HGRVDANEREASVGLKSRQGDTKVRIDGTDGHKAELQMLPMQLITPEGFTLLNGGPKFRRAFLDWGCFHN
RECF_YERPE      HGRVDANEREASVGLKSRQGDTKVRIDGTDGHKAELQMLPMQLITPEGFTLLNGGPKFRRAFLDWGCFHN
RECF_YERPB      HGRVDANEREASVGLKSRQGDTKVRIDGTDGHKAELQMLPMQLITPEGFTLLNGGPKFRRAFLDWGCFHN
RECF_YERP3      HGRVDANEREASVGLKSRQGDTKVRIDGTDGHKAELQMLPMQLITPEGFTLLNGGPKFRRAFLDWGCFHN
RECF_SHIF8      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECO7I      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SHIBS      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWACFHN
RECF_SHEHH      FANLSVCEQESKIGLRFRNGETEVKINGIKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHS
RECF_ESCF3      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SHISS      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SERP5      HGRIDGAEREISVGLKSRQGDSKVRIDGSDGHKAELQLLPMQLITPEGFTLLNGGPKFRRAFLDWGCFHN
RECF_ECOUT      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECOSM      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECOLU      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECOLI      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECOLC      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECOL6      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECOK1      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECOHS      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECODH      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECOBW      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECO8A      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECO81      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECO5E      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECO57      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECO55      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECO45      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECO27      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ECO24      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_BACFN      Q---GFYEAMDGTPEEIYCGMKRRSKKQFKRNKKEIGFIPLVMVSPADSELIAGGSDERRRFMDVVISQY
RECF_METCA      SGSIGRPGAGIAVGVRLGRSEKEVRVGGCDSSAQLIRLFPAVLIHPASVALLEGPPRWRRQMLDWGVFHV
RECF_ECOL5      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_BACFR      Q---GFYEAMDGTPEEIYCGMKRRSKKQFKRNKKEIGFIPLVMVSPADSELIAGGSDERRRFMDVVISQY
RECF_AZOPC      HAFYKDKDNIEEIYCGIKLKQRKINKKEYKKLSEHIGLIPTVMVSPNDTNMIQFGSNERRKFADMLISQY
RECF_YERE8      HGRVDANERESSVGLKSRQGDTKVRIDGTDGHKAELQLLPMQLITPEGFTLLNGGPKFRRAFLDWGCFHN
RECF_SACD2      XXXXEGSDAFVQREWSGKSTAKLDGLSAKSSAQLATNL-PVQIIDAHTFALLEGGSKARRKFFDWLVFHV
RECF_BACTN      QGFYEAEDGTPE---EIYCGMKRRSKKQFKRNKKEYSRFSLVMVSPADSELIAGGSDERRRFMDVVISQY
RECF_PSEA6      FCECDSTTQRLGLSRSIND-TVSVSINGIKKVSDLVSLLPVQIFTPQSSDILLGAPKLRRKYIDWCLFHV
RECF_BACV8      QTDQGEPEEVYCGLXXXXXXXXXXXXXEYNRLSDHIGFIPLVMVSPADAELIAGGSDGRRRFMDVVISQY
RECF_SHIB3      HGRLQGEERETAIGLKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWACFHN
RECF_SHIDS      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_MARAV      SRDVSLKETQLRVDG---EAVRSLSFLAMHLPVSVID--------PGVFDIVAGGPGKRRQFLDWLVFHV
RECF_SALTY      HGRLQSEERETSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SALPK      HGRLQGEEREMSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SALPA      HGRLQGEEREMSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SALNS      HGRLQSEERETSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SALHS      HGRLQSEERETSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SALTI      HGRLQGEERETSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SALSV      HGRLQGEERETSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SALPC      HGRLQGEERETSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SALG2      HGRLQGEERETSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SALEP      HGRLQGEERETSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SALDC      HGRLQGEERETSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SALCH      HGRLQGEERETSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_SALA4      HGRLQGEERETSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ACTPJ      HARIDEGQH----QWSVRSGDTLLKINGEDGNKSDLHLLPMQVITPEGLTLLNGGPTFRRAFLDWGLFHQ
RECF_SHELP      FAQLEQGEQETKIGLRYRSGETEVKMNGVKRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHT
RECF_SALPB      HGRLQGEERETSILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ACTPL      HARIDEGQH----QWSVRSGDTLLKINGEDGNKSDLHLLPMQVITPEGLTLLNGGPTFRRAFLDWGLFHQ
RECF_ACTP2      HARIDEGQH----QWSVRSGDTLLKINGEDGNKSDLHLLPMQVITPEGLTLLNGGPTFRRAFLDWGLFHQ
RECF_SODGL      HGRINVDARATSVGLSRNRGDSTVRIDGSDGHKAELQLLPMQLITPEGFTLLNGGPKYRRAFMDWGCFHN
RECF_PSEPF      FGQVELAESALGIS-RDRQGEFQIRIDG-QNARSAAQLAEILLINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_SALAR      HGRLQGEERETSIGLKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_PASMU      HAKIQEQAH----QWKLRQGNSVVKINGEDKIADLAHLLPMQLITPEGLTLLNGGPVYRRAFLDWGLFHH
RECF_ACTP7      HARIDEGQH----QWSVRSGDTLLKINGEDGNKSDLHLLPMQVITPEGLTLLNGGPTFRRAFLDWGLFHQ
RECF_PSEE4      FGQVELTSNLGVSRERQGEFTIRIDGQNARSAAQLAEMLPLQLINPDSFRLLEGAPKVRRQFLDWGVFHV
RECF_EDWI9      HGRIDDGERAVGLS-KDRQGDSKVRIDGSDGHKAELQMLPMQLITPEGFTLLNGGPKYRRAFLDWGCFHG
RECF_SHEDO      FAQLNGESKVGLRRHRNGEIEVKIDGDRVKRLSTLAETLPIQVITPESFSLLFEGPKARRQFVDWGAFHS
RECF_PHOLL      GQQENERERSIGLS-KNRNGDSKVRIDGSDGGKAELKMLPMQLITPEGFTLLNGGPKYRRAFIDWGCFHN
RECF_CITK8      HGRLQGEERETAILTKDKLGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_THISH      EVVARIQSTGGGEPWPV--GIRKTRDSTTARIRGEARLLPLQVMHPESHLLVSGGPGYRRAFLDWGCFHT
RECF_PSESM      FGQVDLASNLGVS--RDRQGEFQIRIDG-QNARSAAQLAEILLINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_TERTT      GQIFEGTTRNIGLS-RASNGDIQIRIDSAAHTATELECLPLLVMNSASFQLLEGSGQVRRKFFDWLVFHV
RECF_SODGM      HGRINVDARATSVGLRNRLGDSTVRIDGSDGHKAELQLLPMQLITPEGFTLLNGGPKYRRAFMDWGCFHN
RECF_MARMS      FAQLHQSPIRVGLQ-RHRDGQIDVRIQG-QRAQSVIELLPVQLINPDAFRLLEGSPSIRRQFIDWGAFHF
RECF_HAEIN      FGQIQESQH----QWKLRQGNTLVKINGEDGNKSDLHLLPMQLITPEGLTLLNGGPSYRRAFLDWGLFHH
RECF_HAEDU      HSKIDETQH----QWSVRAGDTLLKINGEDGKKIAAHLLPMQVITPEGLTLLNGGPSYRRAFLDWGLFHQ
RECF_THICR      FGTLTEADRIHKIGLARTSDKVTLKIDG-ELAKTQADMSAVQLLTPESHRLLEEGPKARRQFMDWGCFHH
RECF_ENTS8      HGRLQGDEREVSVGLKDRNGDSTVRIDGSDGHKAELQLMPMQLITPEGFTLLGGGPKYRRAFLDWGCFHN
RECF_CELJU      FGRVDAAEIPIGIQ-RNQQGEVMLKANGANGSIADLAIFPVQVINSDTFLLLEGSPKVRRQFMDWLVFHV
RECF_PSEU2      FGQVDLASNLGVS--RDRQGEFQIRIDG-QNARSAAQLAEILLINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_PSEA8      FGQVMLANGIASNLGRERQGEFTIRIDG-QNARSAAQLAETLLINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_HAEI8      FGQIQESQH----QWKLRQGNTLVKINGEDGNKSDLHLLPMQLITPEGLTLLNGGPSYRRAFLDWGLFHH
RECF_PSEF5      FGQVELSSLGIS---RDRQGEFQIRIDG-QNARSAAQLAEILLINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_MANSM      HGRI----RELQHEWSVKDGNTIVKINGEDGNKSDLHLLPMQIITPEGLTLLNGGPSYRRAFLDWGLFHH
RECF_HAHCH      GEAVNEDAKSFRIGVSRQKTGKRVRINGESRTLSELAALPILIVTPDTFGFINGGPGERRRFVDWGVFHV
RECF_VIBVY      HGRF-LNSDQFELPIKQRDGTTEVKIGGQSXXXXXXXXXXXXXIHPEGFDLLTDGPKHRRAFIDWGVFHT
RECF_PSEPK      FGEVQLTSNLGVSRERQGEFTIRIDGQNARSXXXXXXXXXXXXINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_PSEPG      FGEVELTGGTCKLVSRERQGEFTIRIDG-QNARSXXXXXXXXXXXPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_PSEP1      FGEVQLTSNLGVSRERQGEFTIRIDGQNARSXXXXXXXXXXXXINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_ERWCT      HGRIDETERAVGLS-KNRQGDSKVRIDGSDGHKAELQLLPIQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_VIBCM      HGRISLSSDQFELPVGIRDGSTEVKIGGQTGXXXXXXXXXXXXXXPEGFELLTDGPKQRRAFIDWGVFHT
RECF_VIBCH      HGRISLSSDQFELPVGIRDGSTEVKIGGQTGXXXXXXXXXXXXXXPEGFELLTDGPKQRRAFIDWGVFHT
RECF_VIBC3      HGRISLSSDQFELPVGIRDGSTEVKIGGQTGXXXXXXXXXXXXXXPEGFELLTDGPKQRRAFIDWGVFHT
RECF_PSEAE      FGQVMLANGIASNLGRERQGEFTIRIDG-QNARSAAQLAETLLINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_PSEAB      FGQVMLANGIASNLGRERQGEFTIRIDG-QNARSAAQLAETLLINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_ENT38      HGRLQGSERETSILTKDKQGDSKVRIDGTDGHKAELALMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_PSEA7      FGQVMLANGIASNLGRERQGEFTIRIDG-QNARSAAQLAETLLINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_COLP3      SIK-DVNDLQLGLSKNLQTGVTLIKINGERHARSELKNIAVQIVTPESFKLFFGGPKERRRFIELGMFHV
RECF_VIBVU      YGRF-LNSDQFELPIKQRDGTTEVKIGGQSXXXXXXXXXXXXXIHPEGFDLLTDGPKHRRAFIDWGVFHT
RECF_PECCP      HGRIDETERSVGLS-KNRQGDSKVRIDGSDGHKAELQLLPIQLITPEGFTLLNGGPKFRRAFLDWGCFHN
RECF_ACIAD      FAQ-SLSEK-IGMQ-KLLSGEQLIKVNGVATQGQLAKLLPLQHLDPQSTDIIDHGAKPRRQLLDWLMFHV
RECF_KLEP7      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_ACIBS      FAQ--SATEKIGMQ-KLASGEQLMKVNGVATQGQLAKLLPLQHIDPQSTEIIDHGAKPRRQLLDWLMFHV
RECF_KLEP3      HGRLQGEERETAILTKDKQGDSKVRIDGTDGHKAELHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHN
RECF_VIBHB      HGRF-LNSDQFELPIGIRDGSTEVKIGGQSGXXXXXXXXXXXXXXPEGFDLLTDGPKHRRAFIDWGVFHT
RECF_ACIBY      FAQ--SATEKIGMQ-KLASGEQLMKVNGVATQGQLAKLLPLQHIDPQSTDIIDHGAKPRRQLLDWLMFHV
RECF_ACIBT      FAQ--SATEKIGMQ-KLASGEQLMKVNGVATQGQLAKLLPLQHIDPQSTDIIDHGAKPRRQLLDWLMFHV
RECF_ACIBC      FAQ--SATEKIGMQ-KLASGEQLMKVNGVATQGQLAKLLPLQHIDPQSTDIIDHGAKPRRQLLDWLMFHV
RECF_ACIB5      FAQ--SATEKIGMQ-KLASGEQLMKVNGVATQGQLAKLLPLQHIDPQSTDIIDHGAKPRRQLLDWLMFHV
RECF_ACIB3      FAQ--SATEKIGMQ-KLASGEQLMKVNGVATQGQLAKLLPLQHIDPQSTDIIDHGAKPRRQLLDWLMFHV
RECF_VIBPA      HGRF-LNSDQFELPIKQRDGSTEVKIGGQSXXXXXXXXXXXXXIHPEGFDLLTDGPKHRRAFIDWGVFHT
RECF_VIBFM      HTTPELFELPIGIN-KQRDGTTEVKIGGEQKLAQLAKVLPLQLIHPEGFELVTDGPKFRRAFIDWGVFHV
RECF_PSE14      FGQVDLASNLGVS--RDRQGEFQIRIDG-QNARSAAQLAEILLINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_SYNPX      RAXXXXXXXXXXXXXXXXXXXXXXNGKTLDR---QLDLIGCIGFSALDLELVRGEPALRRQWLDRVVLQL
RECF_ACTSZ      HGRIQQHEWSVGLQKQRKEGLTLVKINGEDGNKSDLHLLPMQMITPEGLTLLNGGPSYRRAFLDWGLFHH
RECF_TREPA      RVKVMYRGEYTHTVQIFSKNGKKRIEKNLKKIRTKKELISCILFFHNDLDFVVGTPERRRFFLDQSLSMC
RECF_FRAP2      YTKANPDEVVXXXXXXXXXXXXXXXXXEIQKNHTEITVLPIQLMNPESFNIINSGAQQRCKVLDWGAFYL
RECF_VIBF1      HGRFTTPEQFIGIN-KQRDGTTEVKIGGEQKLAQLAKVLPLQLIHPEGFELVTDGPKFRRAFIDWGVFHV
RECF_PSEPU      FGEVQLT----------EGGTSNLGVSRERQGEFTIRIDGXXXINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_PSEFS      FGQVELSSLGIS---RDRGGEFQIRIDG-QNARSAAQLAEILLINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_HAES2      HGKIQEQQH----QWSVRQGNTLMKINGEDAKKSDLHLLPMQLITPEGLTLLNGGPSYRRAYLDWGLFHH
RECF_HAES1      HGKIQEQQH----QWSVRQGNTLMKINGEDAKKSDLHLLPMQLITPEGLTLLNGGPSYRRAYLDWGLFHH
RECF_VIBSL      HGRFMTSDQFIGIN-KQRDGTTEVKISGQXXXXXXXXXXXXXXIHPEGFDLLTDGPKHRRAFIDWGVFHS
RECF_PROMM      RA---IADDTEKLELELXXXXXXXXXXNGKTLTRQLDLIGCVGFSALDLNLVRGEPALRRQWLDRVVQQL
RECF_COXBN      FITLYNGTQFIPLGVERDHGDRCLRINGETASSWSLAAKRLPLCSLSAMSFLLDGPRVRRQFLDWLMFHV
RECF_ALISL      HGRFTTPEQFIGIN-KQRDGTTEVKIGGEQKLAQLAKVLPLQLIHPEGFELVTDGPKFRRAFIDWGVFHV
RECF_COXBU      FITLYNGTQFIPLGVERDHGDRCLRINGETASSWSLAAKRLPLCSLSAMSFLLDGPRVRRQFLDWLMFHV
RECF_COXBR      FITLYNGTQFIPLGVERDHGDRCLRINGETASSWSLAAKRLPLCSLSAMSFLLDGPRVRRQFLDWLMFHV
RECF_COXB2      FITLYNGTQFIPLGVERDHGDRCLRINGETASSWSLAAKRLPLCSLSAMSFLLDGPRVRRQFLDWLMFHV
RECF_COXB1      FITLYNGTQFIPLGVERDQGDRCLRINGETASSWSLAAKRLPLCSLSAMSFLLDGPRVRRQFLDWLMFHV
RECF_HAEPS      FGKIQEEKHSVGLQ-KNRQGETILRINGESNKKADLALLPMQVITPEGLTLLNGGPIYRRAFLDWGLFHQ
RECF_ANAD2      AGDFEGPXXXXXXXXXXXXXXXXXXLDGKARLDDYFEGLASVCFSPDDLLLVKAGPDGRRRFLDRAAFNR
RECF_FRATW      YTEITXXXXXXXXXXXXXXXXXXXQKNHTEITRN----LPIQLINPESFNIINSGAQQRCKVLDWGAFYL
RECF_FRATT      YTEITXXXXXXXXXXXXXXXXXXXQKNHTEITRN----LPIQLINPESFNIINSGAQQRCKVLDWGAFYL
RECF_FRATM      YTEITXXXXXXXXXXXXXXXXXXXQKNHTEITRN----LPIQLINPESFNIINSGAQQRCKVLDWGAFYL
RECF_FRAT1      YTEITXXXXXXXXXXXXXXXXXXXQKNHTEITRN----LPIQLINPESFNIINSGAQQRCKVLDWGAFYL
RECF_CHRSD      HGRVAGDPPVALGVRRARDASEEIRLDGERRVARLAEALPLQLINPDAFRLLEGSPAARREFLDWGVFHV
RECF_SYNSC      RADVXXXXXXXXXXXXXXXXXXXXNGKLLDR---QLDLIGCIGFSALDLDLVRGEPALRRQWLDRVVLQL
RECF_FRATN      YTEITXXXXXXXXXXXXXXXXXXXQKNHTEITRN----LPIQLINPESFNIINSGAQQRCKVLDWGAFYL
RECF_FRATO      YTEITXXXXXXXXXXXXXXXXXXXQKNHTEITRN----LPIQLINPESFNIINSGAQQRCKVIDWGAFYL
RECF_FRATH      YTEITXXXXXXXXXXXXXXXXXXXQKNHTEITRN----LPIQLINPESFNIINSGAQQRCKVIDWGAFYL
RECF_FRATF      YTEITXXXXXXXXXXXXXXXXXXXQKNHTEITRN----LPIQLINPESFNIINSGAQQRCKVIDWGAFYL
RECF_AZOVD      FGQVLWNDGRVRARNRLGELQIRIDGQNVRSAAQLAESLPLQLINPDSFRLLEGAPKVRRQFLDWGVFHV
RECF_MAGSM      RGETTARDLGHRLEFFGQAGRQAVKINGXXXXXXXXXXXXXVIVTPDTLRLVQDGPGVRRGFVDWVAFTC
RECF_PSEPW      FGEVQLSSNLGVSRERAGDFTIRIDGQNAKSXXXXXXXXXXXXINPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_PSEMY      FGQVQLASSNLGIS-RDRQGELQIRIDG-QNARSXXXXXXXXXXXPDSFRLLEGAPKIRRQFLDWGVFHV
RECF_PSEU5      FGQVELHSRALGVS-RDRSGEVRIRIDGQSRSAAELDTLPLQLINPDSFRLLEGAPKLRRQFLDWGVFHV
RECF_RICM5      KAQSKLGLAEFTTQFKRSSNRRITEYNESKIANNELSKFSMVWLTPHMEGIFTSSSSDRRKFLDRIVYNF
RECF_ANADF      AGDFDGPGGTRRVAVQVAPGGRVALLDG--KPQERLDAYAAVCFAPDDLLLVKGGPEGRRRFLD------
RECF_ANADE      XXXXEGPXXXXXXXXXXXXXXXXXSLDGKARLDDYFEGLASVCFSPDDLLLVKAGPDGRRRFLDRAAFNR
RECF_RICAE      KAQSKLGLAEFTTQFKRSSNRRITEYNESKIANNELSKFSMVWLTPHMEGIFTSGSSDRRKFLDRIVYNF
RECF_RICRS      KAQSKLGLAEFTTQFKRSSNRRITEYNESKIANNELSKFSMVWLTPHMEGIFTSGSNDRRKFLDRIVYNF
RECF_RICRO      KAQSKLGLAEFTTQFKRSSNRRITEYNESKIANNELSKFSMVWLTPHMEGIFTSGSNDRRKFLDRIVYNF
RECF_RICPU      KAQSKLGLAEFTTQFKRSSNRRITEYNESKIANNELSKFSMVWLTPHMEGIFTSGSNDRRKFLDRIVYNF
RECF_RICCK      KAQSKLGLAEFTTQFKLSSNRRITEYNESKIANNELSKFSMVWLTPQMEGIFTSGKVERRKFLDRIVYNF
RECF_NOCSJ      XXXXXXXXXXXXLEVELNPGSNRARVNRSPLPRAR-DLVGLVVFSPEDLTLVKGXXXXXXXXXXXXXXXX
RECF_RICCN      KAQSKLGLAEFTTQFKRSSNRRITEYNESKIANNELSKFSMVWLTPHMEGIFTSGSSDRRKFLDRIVYNF
RECF_RHILW      DGMXXXXXXXXXXXXXXXXXARRLRINGTQAKTADTDHLRLLWLTPAMDGLFTGASSDRRRFLDRLVLSL
RECF_AGRVS      DVELGTGSEVLD-----ETAVRRLRINGASRSVDELDHLRVLWLTPAMDGLFTGSSSERRRFLDRLVLSI
RECF_RICAH      KALLQSQLGLAEFSTHIKRNSNRTEYNESKIANNELSKFSMVWLTPQMEGIFTSGSSDRRKFLDRIVYNF
RECF_RICPR      KTLLQSKLGLAELSTHIKRSSNRTEYNASKIANNELSKFNMVWLTPQMEGIFTSSSTDRRKFLDRIVYNF
RECF_RICBR      RALLQSKLGLAEFSTQIKRISNRTEYNNSKIANNELSKFSMVWLTPQMEGIFTSGTSDRRKFFDRIVYNF
RECF_RICB8      RALLQSKLGLAEFSTQIKRISNRTEYNNSKIANNELSKFSMVWLTPQMEGIFMSGTSDRRKFFDRIVYNF
RECF_AGRRK      FAELEGMEDTVEIGTGVDTSARKLRINGTPAKTVDTDHLRVLWLTPAMDGLFTGGSSERRRFLDRLVLSL
RECF_RICFE      KAQSKLGLAEFTTQFKRSSNRRITEYNESKIANNELSKFSMVWLTPQMEGIFTSGSSDRRKFLDRIVYNF
RECF_RHIL3      DGMEGDVXXXXXXXXXXXXXARKLRINGTTAKTADTDHLRLLWLTPAMDGLFTGASSDRRRFLDRLVLSL
RECF_RHIE6      DGMXXXXXXXXXXXXXXXXXXRKLRINGTPAKTADTDHLRLLWLTPAMDGLFTGASSDRRRFLDRLVLSL
RECF_RICTY      KALLQSKLGIADFSTHIKRNSNRTEYNASKIANNELSKFSMVWLTPQMEGIFTSSSTDRRKFLDRIVYNF
RECF_BRUSU      DCMIYXXXXXXXXXXXXXXXXRKVRINGIAASADDLDYARILWVVPSMDGLFTGGASDRRRFLDRMVLAI
RECF_RHIEC      DGMXXXXXXXXXXXXXXXXXXRRLRINGTPAKTADTDHLRLLWLIPAMDGLFTGASSDRRRFLDRLVLSL
RECF_BRUME      DCMIYXXXXXXXXXXXXXXXXRKVRINRIAASADDLDYARILWVVPSMDGLFTGGASDRRRFLDRMVLAI
RECF_BRUAB      DCMIYXXXXXXXXXXXXXXXXRKVRINRIAASADDLDYARILWVVPSMDGLFTGGASDRRRFLDRMVLAI
RECF_BRUA2      DCMIYXXXXXXXXXXXXXXXXRKVRINRIAASADDLDYARILWVVPSMDGLFTGGASDRRRFLDRMVLAI
RECF_AGRT5      FADVDGMDGEVAIGTGIEGDSRRLRLNGVKSVDELTDHLRVLWLTPAMDGLFTGXXXXXXXXXXXXXXXX
RECF_RHIME      DGMEGSVEIXXXXXXXXXXXSRRLRINGTARTVDELDHLRVLWLTPAMDGLFTGPSADRRRFLDRLVLSL
RECF_ANASK      AGDFEGPXXXXXXXXXXXXXXXXXXLDGKARLDDYFEGLASVCFSPDDLLLVKAGPDGRRRFLD------
RECF_RHILO      DGPDGQXXXXXXXXXXXXXXXXXXXXXXATARSAELEWLRVVWLTPAMDALFTGPAADRRRFLDRLVLAI
RECF_SPHWW      XXELSDEVRLGTGTTPAAPERRQVRINGAPASATALEWLSLLWLTPAMDRLFTEGAEGRRRFLDRLVLAI
RAD50_HALVO     TLE-------------------------------------------------------------------
SMC5_SCHPO      EIEMKYDDETVTITRQIQDKSSSFSINATSSITSLMDTFNVQLFLPQDAEFAQLDPMETERAIDHE--GL
RAD50_THEMA     ----------------------------------------------------------------------
SMC4_SCHPO      DSDVEITFKEVNSDFTYVDGSE------------------------------------------------
RAD50_HALSA     ----------------------------------------------------------------------
RAD50_METMA     ----------------------------------------------------------------------
RAD50_PYRHO     ----------------------------------------------------------------------
RAD50_METJA     DFEVNGNNYKIIREYDSGRGGAKLYKNG------------------------------------------
SMC4_ARATH      ----NLDSAGVSVQFE------------------------------------------------------
SMC3_DICDI      ----------------------------------------------------------------------
RAD50_METAC     ----------------------------------------------------------------------
SMC1_SCHPO      TDSSNPTTAYVKLMYELDNGEQR-----------------------------------------------
RECF_AZOVI      FGQVLWNDGRVRNLGVARNGELQIRIDG-QNVRSAAQLLPLQLINPDSFRLLEGAPKVRRQFLDWGVFHV
RAD50_ARCFU     ----------------------------------------------------------------------
YP245_YEAST     N-----HPEMLKLYIRISDSFKYISKSSLERPTS------------------------------------
RAD50_PYRFU     SGEIHAMKRLVGNEWKVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILES-DEAREKVVREVLNL
SMC1A_RAT       ----------------------------------------------------------------------
SMC1A_MOUSE     ----------------------------------------------------------------------
SMC1A_HUMAN     ----------------------------------------------------------------------
SMC1A_BOVIN     ----------------------------------------------------------------------
RAD50_SULSO     ----------------------------------------------------------------------
RAD50_METKA     ----------------------------------------------------------------------
VF050_IIV3      ----------------------------------------------------------------------
SMC1A_XENLA     ----------------------------------------------------------------------
SMC5_TAKRU      ----------------------------------------------------------------------
SMC22_ARATH     ----------------------------------------------------------------------
SMC_MYCTU       YTEVSITRRMFR------DGASEYEINGVQELLSDSGIMHVIVGQGKLEEILQSRPEDRRAFIEEAAGVL
RECF_CAUSK      GTGVELAGAARRI----------VRIDGETVPPGRLDHVRPIWLTPAQDRLFLEAASERRRFFDRLVFAG
RAD50_THEVO     ELYFRSEGHSYRIRRTIERRGKSISTDAIERDGSIIDVFLTSIFVGEMDALVSKDPAERKKILDLNIDRL
SMC4_YEAST      ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
RAD50_PYRAB     ----------------------------------------------------------------------
SMC5_XENLA      ----------------------------------------------------------------------
SMC5_YEAST      ----------------------------------------------------------------------
SMC5_HUMAN      ----------------------------------------------------------------------
RAD50_THEAC     ----------------------------------------------------------------------
SMC_MYCLE       YSEVSITRRMFR------DGASEYEINGVQELLSDSGIMHVIVGQGKLDQILQSRPEDRRTFIEEAAGIL
SMC2_YEAST      ----------------------------------------------------------------------
RAD50_NANEQ     ILEDKGKTYRIRRKWVLENNAK------------------------------------------------
DXS_CLONN       NIALIATGKMVATAIKVQEKMKAMGVN--------ITVINACFVKPIDKSIIKKLVSKNYKIITLEDNVL
SMC21_ARATH     ----------------------------------------------------------------------
RAD50_SULTO     ----------------------------------------------------------------------
RAD50_METMP     ----------------------------------------------------------------------
SUDA_EMENI      ----------------------------------------------------------------------
SMC3_PLAF7      ----------------------------------------------------------------------
RAD50_AQUAE     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SPGYSQLWRQYAKILSQRNSLLKEIRDHRSKQEVLEVWDEQLYRYGAKVIYLRLQVLKKLIPIARKTHFG
RECF_DESRM      SPGYSQLWRQYAKILSQRNSLLKEIRDHRSKQEVLEVWDEQLYRYGAKVIYLRLQVLKKLIPIARKTHFG
RECF_PELTS      HPHYAHCLDRYNRVLSQRNALLREAKEKRTTGGPLEVWDEQLCRYGSRLLFLRVSLLKKFFPAIRALHRE
RECF_BACCZ      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGAKILQKRFEFLHLLQEWAAPIHRG
RECF_BACCR      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGAKILQKRFEFLHLLQEWAAPIHRG
RECF_BACC4      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGAKILQKRFEFLHLLQEWAAPIHRG
RECF_BACC2      APIYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGAKILQKRFEFLHLLQEWAAPIHRG
RECF_BACWK      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGAKILRKRFEFLHLLQEWAAPIHRG
RECF_BACHK      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGTKILQKRFEFLHLLQEWAAPIHRG
RECF_BACCQ      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGTKILQKRFEFLHLLQEWAAPIHRG
RECF_BACC7      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGTKILQKRFEFLHLLQEWAAPIHRG
RECF_BACC3      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGTKILQKRFEFLHLLQEWAAPIHRG
RECF_BACC1      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGTKILQKRFEFLHLLQEWAAPIHRG
RECF_BACAH      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGTKILQKRFEFLHLLQEWAAPIHRG
RECF_BACC0      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGTKILRKRFEFLHLLQEWAAPIHRG
RECF_BACAN      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGTKILRKRFEFLHLLQEWAAPIHRG
RECF_BACAC      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGTKILRKRFEFLHLLQEWAAPIHRG
RECF_BACAA      APVYLYELSQYQKVLTQRNHLLKKMQGNSKNEEMLDVFTLQLIEHGTKILRKRFEFLHLLQEWAAPIHRG
RECF_BACSU      SPVYLHDLSLYQKILSQRNHFLKQLQTRKTDRTMLDVLTDQLVEVAAKVVVKRLQFTAQLEKWAQPIHAG
RECF_BACCN      APVYLYELSQYQKVLTQRNHLLKAMQG-KNEETMLDVFTLQLIEHGTKILQKRFEFLHLLQEWAAPIHRG
RECF_GEOSW      SPVYIHDLSQYQKLLQQRNHYLKMLQTREQQDEVLDILTEQLIPLAAKITLKRYEFLLLLQKWAAPIHHE
RECF_BACLD      SPVYLHDLSLYQKILSQRNHFLKQLQTRKTDQTMLDVLTEQLTEFAAKVVMKRLQFVDQLEKWAQPIHSG
RECF_GEOKA      SPVYIHDLSQYQKLLQQRNHYLKMMQARRSDEAVLDVLTEQLVLLAAKITLRRRQFLSLLEQWAMPIHYE
RECF_BACSK      SPVYLNSLSLYGKILKQRNVLLKNMQQKRSQNAMVDVLTEQLIDKAAFVMKKRAEFISRLEEWATPIHQS
RECF_BACA2      SAVYLYDLSLYQKILSQRNHFLKQLQSRKTDRTMLDVLTDQLIEAAAKVVAKRLQFTAQLEKWAQPIHSG
RECF_LACS1      DALYLHTLTEYRAVLRQRNKYLKELQTKKATDKVLEILSEQLSESGSQIIFKRLEFLQELEKYADKLHNQ
RECF_PEDPA      SSKYLYNSAQYRSVLKQRNQYIKQLQNPKGDQVYLDVLSDQLAAHGAEIIFQRIQFLKKLEKWSQEVHKE
RECF_GEOTN      SPVYIHDLSQYQKLLQQRNHYLKMMQAREQHDEVLDVLTEQLMVLAAKITLRRRQFLALLEQWAMPIHHE
RECF_EXISA      SPVYLHELNQYLKTLKQRNALLKQLSTKGGDETLLEVLTDQLIELAVKIVMRRYHFIDQLEKWANPIHSG
RECF_OCEIH      QPTYIYHLAQYQKVLKQRNHLLKQLRKPNSDTTMLEVLTDQLIEHASILLERRFIYLELLRKWAQPIHRG
RECF_STACT      SAVYLNDLSQYQRILKQKNNYLKQLQKQKTDRTMLEVLNQQFAEYALKITLKRVHFINELETLAKPIHSS
RECF_BACP2      SAVYLHDLSLYQKILSQRNHYLKQLQTRKTDQAMLEVLTEQLIDAAAKVVKRRLTFTKQLEKWAQPLHFG
RECF_STAS1      SAVYLNDLSQYQRILKQKNNYLKQLQGQKTDSTMLEVLNQQFAEYALKITLRREHFINELESLAKPIHSG
RECF_ENTFA      SPIYLYDLVQYQSVLKQRNQYLKQLAEKKQTDTVLDILTEQLAEFGGKVLYARLGFLKKLEHWANLLHQK
RECF_ALKMQ      APKYYYNLNQYNKILQQRNKLLKY---HKGKKLDLEVWNEQLANIGASLIIYRRNFIKRIAILAKLMHRK
RECF_STAES      SAVYLNDLAQYQRILKQKNNYLKQLQGQKTDTTMLEVLNQQFVEYALKVTLRREHFIKELETLAQPIHAG
RECF_STAEQ      SAVYLNDLAQYQRILKQKNNYLKQLQGQKTDTTMLEVLNQQFAEYALKVTLRREHFIKELETLAQPIHAG
RECF_STAHJ      SAVYLNDLAQYQRILKQKNNYLKQLQGQKQDTTMLEVLNQQFAQYALNVTLRREHFIKELESLAKPIHAG
RECF_HALOH      KPYYHYLLKKYNHILSQRNNLLKELMTNKSDTTLLEVWDEQLVEIGAKIIQNRIEVIDKLKILARLSHRQ
RECF_CLOTH      KPSYFYDLQQYNKVLSQRNMLLKEIQYKRNLLDTLEVWDYKMAELSSRIMTTRSEFIKRLCEISKKIHLK
RECF_CLOTE      SKQYYYNLVQYQKVLNERNMLLKKGGDE--VPNIIGVYDEQLARFGSNIIREREKYLKKLNDIGKKIHLE
RECF_MACCJ      SAVYLNDLSNYQRLLKQKNHLLKQMKSNSNDMTMLEVINEQFAQYAVKLTLRRKMFIEQLETLAIPIHTG
RECF_LACJO      NSEYLYFLSQYRQVLQQRNNYLKQLSIKKANDLVLDVLSDQLAGIAAEIISRRIKYIKKLNSYAQSAHSE
RECF_LACGA      NSEYLYFSSQYRQVLQQRNNYLKQLSIKKANDQVLDVLSDQLAGIAAEIISRRIKYIKKLNSYAKAAHSE
RECF_OENOB      SANYLFNLLQYRSVLKNRNAYLKNIKNPKIDEDYLKVLNDQLIDFGSEIIFQRFVLVKELEKYSYQIHKA
RECF_LACC3      SPKYLYNLSQYKTFLKQRNAYLKQLKYHQAKDLVLDVLTDSLAAFGAELITARAKLLETMSDYAATIQQD
RECF_LACCB      SPKYLYNLSQYKTFLKQRNAYLKQLKYHQAKDLVLDVLTDSLAAFGAELITARAKLLETMSDYAATIQQD
RECF_LACSS      SSKYLYNISQYKSILKQRNQYLKQLQRRQAKDLVLGVLSDQLAAYGAEVTVARRQFLQQMEKWAQKLHQE
RECF_EXIS2      SPVYLHELSQYLKVLKQRNALLKQLSMKGGDETFLDVLTEQMITLAVKIVQRRHHFIAQLEKWARPIHEG
RECF_BREBN      SPTYLYYLSNYNKVLAQRNQLLKDLAMKKSNSEMLAIWNTQLADLAVKLLRKRFEFIRKLETWAQEIHTG
RECF_DESAP      VPGYLTALQLYRRALEQRNHLLR-MGGGRRYSELLDLWTDEVCKYGMMLLSGRLEILKEFAPLACRL-FG
RECF_LEUCK      NPLYLYNITQYRRILKDRNAYLKRLQLKQTKDTVLDVLTDQLVSVGAEVILARQLFVRRLQAAAQPIHAE
RECF_LEUMM      NPLYLYNTTQYKRILKERNAYLKRLQLKQTTDTVLDVLSEQLVDVGSQILIARQEFLNKLELAAQPIHAE
RECF_LACBA      NPRYLYNLSQYRTLLKQRNRYLKDLQHKQNKDLLLSVLSDQLAAFGAEIIAQRLAMLQKLEHWAQAIHGE
RECF_STAAW      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_STAAU      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_STAAT      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_STAAS      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_STAAR      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_STAAN      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_STAAM      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_STAAE      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_STAAC      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_STAA9      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_STAA8      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_STAA2      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_STAA1      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_HELMI      SPAYGDVLSRYARVLTQRNSLLRRLREGSATAAELELWDDQLAPLAVETLARRLDGLARIAPYARQIYRG
RECF_STAAB      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELELLAKPIHAG
RECF_STAA3      SAVYLNDLAQYQRIXXXXXXXXXXXXXXXXXXXMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAG
RECF_LACRJ      SSKYLYNAGQYRTLLRQKNKYLKQLKYRQQTDRVLGVLSDQLAAFGAEVIIARQHFLKHLEGWAADLHQE
RECF_LACRD      SSKYLYNAGQYRTLLRQKNKYLKQLKYRQQTDRVLGVLSDQLAAFGAEVIIARQHFLKHLEGWAADLHQE
RECF_LACPL      SPKYLYNLSQYRTILKXXXXXXXXXXXXXAKDKVLGVLSDQLAAFGAEIIHKRLQLLQQLEKWAQAVHSE
RECF_ALKOO      STKFYYTLSQYNKILQHRNKLLKY---NKGKEIDIEVWDEQLAAAGAWLIVYRRNFIKKISILAKLMHRK
RECF_LISMO      QPIYLHNLSEYQRILQQRNQYLKMLQMKRKVDPILDILTEQFADVAINLTKRRADFIQKLEAYAAPIHHQ
RECF_LISMF      QPIYLHNLSEYQRILQQRNQYLKMLQMKRKVDPILDILTEQFADVAINLTKRRADFIQKLEAYAAPIHHQ
RECF_LISMC      QPIYLHNLSEYQRILQQRNQYLKMLQMKRKVDPILDILTEQFADVAINLTKRRADFIQKLEAYAAPIHHQ
RECF_BACHD      SPVYLHQLAMYQKILLQRNHLLKQLFGKANSDPMLDVLTDQLIEVAVEVTKKRFEFIQLLQRWAEEIHQA
RECF_LISMH      QPIYLHNLSEYQRILQQRNQYLKMLQMKRKVDPILDILTEQFADVAINLTKRRADFIQKLEAYAAPIHHQ
RECF_LISIN      QPIYLHNLSEYQRILQQRNQYLKMLQMKRKVDPMLDILTEQFADVAINLTKRRADFIQKLEAYAAPIHHQ
RECF_LISW6      QPIYLHNLSEYQRILQQRNQYLKMLQMKRKVDPMLDILTEQFADVAINLTKRRADFIQKLEAYAAPIHHQ
RECF_CLONN      NKKYYYSLVRYNKVLNERNTIL---RKWNSNTEVTEVYDHQLSKYGSYIIKERLKYIESLSIRGNKIHKD
RECF_CLOBM      NNVYYHDLVQYNKILSERNTALKNWNNRIN--DIIDVYDEQLSKYGAFIIKERNKYLDKLNIIGKNIHKK
RECF_CLOPH      SKLYLHNLINYNKVLNQRNNLLKQIGFNKSLLDTLYVWDQQLIHFGSALIKERDAFMKSMNELIIALHKK
RECF_LACLA      HAVYLYDSMRYNRALKERNAYLKFDKDKIDKN-FLSVLDGQLAEHGNKIMLERQNFIDKLEVHAKKIHEQ
RECF_LYSSC      SPVYLHDLLTFQKVLKQRNHFLKMNQGKSMSNDVMEVYNEQYIHAATQIIRKRFQFMDLLQEWAEPIHAG
RECF_LACF3      SSKYLYNVSRFNQQLAQRNAYLRQFKGQQSDRILLGVITDQLASVGGEVVVARQQLVKRLGKWAAELHHH
RECF_LACLM      HAVYLYDSMRYNRALKERNAYLK-FDQAKIDKNFLTVLDEQLAEHGNKIMFERKTFIEKLEIHAKKIHEQ
RECF_LACAC      NAEYLYFASKYRQVLIQKNNYLKQLAKGKAKDQVLDVLSDQLAGIAAELIYRRFKFLTYLSHYASDAYTH
RECF_NATTJ      DPSYDFYLKNYFKALRQRNKLLKTYQDKNTLAQHLPPWNQQLVHYGSKIILKREEVIHKIRLLARLIYRK
RECF_LACLS      HAVYLYDSMRYNRALKERNAYLK-FDQAKIDKNFLTVLDEQLAEHGNKIMFERKTFIEKLEIHAKKIHEQ
RECF_EUBR3      DKIYLSNLSKYNKTLVQRNRLLKDIAYRPDLIDTLQVWDMQLLEYGRHVIKKRREFVNELNEIIQDIHSN
RECF_STREM      KPVYLSDLSHYNHVLKQRNAYLKSV--HQLDSDFLSVLDEQLVTYGSRVMAHRLAFVQSLAKEANKHHQA
RECF_STRGC      KPIYLADLSNYNHVLKQRNSYLK--NSQNIDENFLSVLDEQLIEYGCRVVKHRLDFLKKLEIFAQEKHLD
RECF_STRE4      KPVYLSDLSHYNHVLKQRNAYLKSV--HQLDNDFLSVLDEQLVTYGSRVMAHRLAFVQSLAKEANKHHQA
RECF_STRS7      KPVYLSDLSHYNHVLKQRNAYLKSV--HQLDSDFLSVLDEQLVTYGSRVMAHRLAFVQSLAKEASKHHQA
RECF_STRSV      KPVYLSDLSNYNHVLKQRNAYLK--ANDKVDETFLTVLDEQLVDYGCRVIRHRLDFLQKLESFAQDKHWD
RECF_CLOD6      IPXXXXXXXXXXXXXSQRSRVLKNIH---VDEALLDVYDDTLAKYGSYIYILRRDFIKKIANISENMHMN
RECF_STRMU      KPIYLSDLSNYNHVLKQRNAYLKS--EKKVDTDFLFVLDEQLVDYGSKVIEHRLDFIQNLTKEADKYHFS
RECF_STRA1      KPTYLAELSNYNHVLKQRNTYLK--TTNNVDKTFLSVLDEQLADYGSRVIEHRFDFIQALNDEADKHHYI
RECF_CLOK5      SKKYYYGLVQYNKVLTARNIILKK-WNKGNYIDILQVYDKQLAKYGEVIIKLRNNYLKKLSEKGKVIHSD
RECF_CLOBK      NNVYYHDLVQYNKILSERNTAL--XXXXXXXXXXXXXYDEQLSKYGAFIIKERNKYLDKLNIIGKNIHKK
RECF_CLOBJ      NNVYYHDLVQYNKILSERNTAL--XXXXXXXXXXXXXYDEQLSKYGAFIIKERNKYLDKLNIIGKNIHKK
RECF_CLOB6      NNVYYHDLVQYNKILSERNTAL--XXXXXXXXXXXXXYDEQLSKYGAFIIKERNKYLDKLNIIGKNIHKK
RECF_CLOB1      NNVYYHDLVQYNKILSERNTAL--XXXXXXXXXXXXXYDEQLSKYGAFIIKERNKYLDKLNIIGKNIHKK
RECF_STRU0      KPIYLSDLSNYNYVLKQRNTYLKTISTINS--DFLSVLDEQLADYGSKVIKHRIDFIGELTREANKHHEA
RECF_STRA5      KPTYLAELSNYNHVLKQRNTYLK--TTNNVDKTFLTVLDEQLADYGSRVIEHRFDFIQALNDEADKHHYI
RECF_STRA3      KPTYLAELSNYNHVLKQRNTYLK--TTNNVDKTFLTVLDEQLADYGSRVIEHRFDFIQALNDEADKHHYI
RECF_LACH4      NAEYLYFASKYRQVLLQKNNYLKQLAKGKTKDQVLDVLSDQLAGIAAEVIFRRFKFLRYLSHYASDVYAH
RECF_LACDB      NPEYLYFASQYRQLLQQRNNYLKQLRRQASDQVLLGVLTEQVATAASELIWRRYRYLADLNRYAAEAYRA
RECF_CLOBL      NNVYYHDLVQYNKILSERNTAL--XXXXXXXXXXXXXYDEQLSKYGAFIIKERNKYLDKLNIIGKNIHKK
RECF_STRZJ      KPIYLSDLTNYNHILKQRNTYLKS--DQKIDETFLSVLDDQLVDYGCRVMNHRLDFIKKLESFGRKKHFE
RECF_STRPJ      KPIYLSDLTNYNHILKQRNTYLKS--DQKIDETFLSVLDDQLVDYGCRVMNHRLDFIKKLESFGRKKHFE
RECF_STRP7      KPIYLSDLTNYNHILKQRNTYLKS--DQKIDETFLSVLDDQLVDYGCRVMNHRLDFIKKLESFGRKKHFE
RECF_STRP4      KPIYLSDLTNYNHILKQRNTYLKS--DQKIDETFLSVLDDQLVDYGCRVMNHRLDFIKKLESFGRKKHFE
RECF_LACDA      NPEYLYFASQYRQLLQQRNNYLKQLRRQASDQVLLGVLTEQVATAASELIWRRYRYLADLNRYAAEAYRA
RECF_MOOTA      DRLYCRNLQDYRRILFQRNLLLRAIKAGRGKEGELEPWDIQLLATGKAICEKRSCFLQSLAPRVAATYRD
RECF_CLOAB      DHRYYYKLVQYNKILDQRNIMLRNKKFLNN--DMISVYDEQLSKFGSSLIESRIKYLNKLNEKGKIIHSD
RECF_STRZT      KPIYLSDLTNYNHILKQRNTYLKSAQ--KIDETFLSVLDDQLVDYGCRVMNHRLDFIKKLESFGRKKHFE
RECF_STRZP      KPIYLSDLTNYNHILKQRNTYLKSAQ--KIDETFLSVLDDQLVDYGCRVMNHRLDFIKKLESFGRKKHFE
RECF_STRR6      KPIYLSDLTNYNHILKQRNTYLKSAQ--KIDETFLSVLDDQLVDYGCRVMNHRLDFIKKLESFGRKKHFE
RECF_STRPN      KPIYLSDLTNYNHILKQRNTYLKSAQ--KIDETFLSVLDDQLVDYGCRVMNHRLDFIKKLESFGRKKHFE
RECF_STRPI      KPIYLSDLTNYNHILKQRNTYLKSAQ--KIDETFLSVLDDQLVDYGCRVMNHRLDFIKKLESFGRKKHFE
RECF_STRP2      KPIYLSDLTNYNHILKQRNTYLKSAQ--KIDETFLSVLDDQLVDYGCRVMNHRLDFIKKLESFGRKKHFE
RECF_STRPS      KPIYLSDLTNYNHILKQRNTYLKSAQ--KIDETFLSVLDDQLVDYGCRVMNHRLDFIKKLESFGRKKHFE
RECF_STRPZ      KPVYLSELSHYNHVLKQRNSYLKSAQ--QIDAAFLAVLDEQLASYGARVMEHRIDFINALEKEANTHHQA
RECF_STRP3      KPVYLSELSHYNHVLKQRNSYLKSAQ--QIDAAFLAVLDEQLASYGARVMEHRIDFINALEKEANTHHQA
RECF_STRPG      KPVYLSELSHYNHVLKQRNSYLKSAQ--QIDAAFLAVLDEQLAGYGARVMEHRIDFINALEKEANTHHQA
RECF_STRPD      KPVYLSELSHYNHVLKQRNSYLKSAQ--QIDAAFLAVLDEQLAGYGARVMEHRIDFINALEKEANTHHQA
RECF_STRP8      KPVYLSELSHYNHVLKQRNSYLKSAQ--QIDAAFLAVLDEQLAGYGARVMEHRIDFINALEKEANTHHQA
RECF_STRP6      KPVYLSELSHYNHVLKQRNSYLKSAQ--QIDAAFLAVLDEQLAGYGARVMEHRIDFINALEKEANTHHQA
RECF_STRPF      KPVYLFELSHYNHVLKQRNSYLKSAQ--QIDAAFLAVLDEQLASYGARVMEHRIDFINALEKEANTHHQA
RECF_STRP1      KPVYLSELSHYNHVLKQRNSYLKSAQ--QIDAAFLAVLDEQLASYGARVMEHRIDFINALEKEANTHHQA
RECF_STRPC      KPVYLSELSHYNHVLKQRNSYLKSAQ--QIDAAFLAVLDEQLASYGARVMEHRIDFINALEKEANTHHQA
RECF_STRPM      KPVYLSELSHYNHVLKQRNSYLKSAQ--QIDAAFLAVLDEQLAGYGARVMEHRIDFINALEKEANTHHQA
RECF_STRPB      KPVYLSELSHYNHVLKQRNSYLKSAQ--QIDAAFLAVLDEQLAGYGARVMEHRIDFINALEKEANTHHQA
RECF_EUBE2      DKIYLSNLVNYNKVLNQRNKLLKDIAFSPSEQQTLDIWDMQLVKYGSLIIKGRKSFIEKINTIISDIHSR
RECF_CLOPS      NKRYYHNLVQYNKVLHERNLVLK---NKNINEEMLDIYDIQLAQYGENIIKTRLKYIEQLNKYSKEIHKE
RECF_CLOPE      NKRYYHNLVQYNKVLHERNLVLK---NKNINEEMLDIYDIQLAQYGENIIKTRLKYIEQLNKYSKEIHKE
RECF_CLOP1      NKRYYHNLVQYNKVLHERNLVLK---NKNINEEMLDIYDIQLAQYGENIIKTRLKYIEQLNKYSKEIHKE
RECF_STRTD      KPVYLSDLSNYNHVLKQRNAYLKS--TDKVDINFLSVLDEQLADFGARVIKHRLEFIKQLEEEADGHHSI
RECF_STRT1      KPVYLSDLSNYNHVLKQRNAYLKS--TDKVDINFLSVLDEQLADFGARVIKHRLEFIKQLEEEADGHHSI
RECF_STRT2      KPVYLSDLSNYNHVLKQRNAYLKS--TDKVDINFLSVLDEQLADFGARVIKHRLEFIKQLEEEADGHHSI
RECF_CLOB8      NPNYYFNLVQYNKVLGERNILLK---SRSFSEDILDVYDIQLSKYADYIISKRLEYINKINFYGDIIHRE
RECF_DESHY      HSKHIQLLNAYNKVLQQKNALLKQGQGSKSQIAQIELWNEQILRIGSEIIRNRWEFTGLLSRKGQEIYGQ
RECF_DESHD      HSKHIQLLNAYNKVLQQKNALLKQGQGSKSQIAQIELWNEQILRIGSEIIRNRWEFTGLLSRKGQEIYGQ
RECF_CLOCE      KPSYFYNLQQMSKILKQRNTLLKNISSNPKLMDTVDIWNMRLAEVAAAIIKARRTFSIMLSGMAENQHNF
RECF_STRSY      KPLYLSDLSNYNHVLKQRNTYLKS--TDKIDENFLSVLDQQLAEYGSRVIQHRIDFLKKLEEFGNRKVQE
RECF_STRS2      KPLYLSDLSNYNHVLKQRNTYLKS--TDKIDENFLSVLDQQLAEYGSRVIQHRIDFLKKLEEFGNRKVQE
RECF_ACAM1      EPVYAHLLQQYQQVLKQRNAYLKHHRADDAPQQQLVLWNQQLAASGSRVIQRRQRMLMRLVPLAGHWHQT
RECF_CHLAD      DPHYVRTLAYYQKILLQRNSLLRAWREQRNVDAELGYWDQXXXXXXXXXXXXXXXXVVELSALAGSIYRK
RECF_GEOUR      DVTYLHAYHDYCKILKNRNILLKS-----GEKSGLDVWTEKLAEYGRKVINKRLDYLHEIQELLSKFYND
RECF_CYAA5      EPVYASIIHQYYKILRQRNALLKVIRKTVEEQEQLKVWDQQLAEAGXXXXXXXXXXXXXXXPLAQKWHQE
RECF_THEPX      EKNYLYNLMQYNKILMNRNKLLKSIKEGKSKS-ILEIFDDQLVEYGAKIIVMRQNYLKNVEINIKKFLLE
RECF_THEP3      EKNYLYNLMQYNKILMNRNKLLKSIKEGKSKS-ILEIFDDQLVEYGAKIIVMRQNYLKNVEINIKKFLLE
RECF_SYMTH      SQTYLHHLMAYNRLVAQRNTLLKQVID----EGLMAVYDEQLVETGAQLXXXXXXXXXXLSPIASRYHRM
RECF_ROSCS      DGRYVRTLAHYQKVVQQRNSLLRAWREGRRPDDELAFWDRELAMAGAYLLRERLHAVVDLNALAGPLYCR
RECF_STRGG      SPRMAGVRSDYERVLKQRNTLLKSARRHGGRSSTLDVWDQHLGRVGAELLAQRLDLIATLQPLADKAYGD
RECF_NOSP7      EPVYAHILQQYNHVLRQRNAFLKETLDATSLHSELAVWDAQLATTGTXXXXXXXXXXXXLAPIASAWHAS
RECF_STRAW      SPRMAGVRSDYERVLKQRNTLLKTARRHGGRSSTLDVWDQHLARAGAELLAQRLDLIAALQPLADKAYEQ
RECF_CYAP8      EPIYAHILQQYYQVLRQRNALLKDLRDHLSAQMTLHLWDQQLAETGSXXXXXXXXXXXXLIPLAQIWHQN
RECF_ANASP      EPVYAHILQQYNQVLRQRNAYLKKLQDSTTQDSALAIWDAQLVTTGTKVIXXXXXXXXXXXXXXXXWHTS
RECF_TRIEI      EPVYAHILLQYNQVLRQRNALLKKIRQQKMAAETLALWDAQLATTGSRVIRRRQRLLQKLAPLAGEWHCA
RECF_CHLSY      DPHYVRTLAHYQKILLQRNSLLRAWREQRRVPRHVDAWDQXXXXXXXXXXXXXXXXIVELNDLAGPLYQE
RECF_CHLAA      DPHYVRTLAHYQKILLQRNSLLRAWREQRRVPRHVDAWDQXXXXXXXXXXXXXXXXIVELNDLAGPLYQE
RECF_STRCO      SPRMAGVRSDYDRVLKQRNTLLKSARRHGGRTSTLDVWDQHLARAGAELLAQRLDLIASVQPLADKAYEQ
RECF_CLOBB      SKKYYFNLVQYNKILNERNVILRS-RDFN--KDILEVYDLQLVECADYIVKERLEYIDKINYYGKFIHNE
RECF_CHLT3      NKAYLADLLSYRRVLAQRNKLLADMKHRTFSSPELDVWTXXXXXXXXXIIFRRIHFVRDFAQYLENAYAD
RECF_PARUW      DPLYVHHLNRYGRALKQRNHLLK------MKQQIIDSWEQEMTHSAAYLIQQRYQTITHLQNLAQKYYHL
RECF_CYAP4      EPFYAHLLQQYNHVLRQRNAFLKSYQREGSLDHTLKLWDQQLASTGTXXXXXXXXXXXXXXXXATHWHQA
RECF_CHLPB      NKSYLDDLLQYRRVLQQRNTLLGAVNEKGMDRDSLEVWTEKLTQLACSIVSERLAFIERLFPVYEQLGLG
RECF_RENSM      HPRFAGLRADYERVLKQRNALLKSARGHRSRQSTIEVWDQHFANHAAQLLSARLKVLEQLKPEMSRAYQE
RECF_CLOBA      SKKYYFNLVQYNKILNERNVILRS-RDFN--KDILEVYDLQLVECADYIVKERLEYIDKINYYGKFIHNE
RECF_ARTS2      MPRHSATRTDYDRVLKQRNALLKSGRSGKGHEATLDVWDQHMARAGAELLYARLELVERIRPHLKAAYAQ
RECF_CYAP7      EPIYAHILSQYYQVLKQRNALLKKIRQQEEDSQQLKLWDSQLAETGSXXXXXXXXXXXXXXPLAQKWHAN
RECF_MICAN      EPLYVHILQQYNQVLRQRNALLKEIRKQELEGKVLKLWDLQLAETGSXXXXXXXXXXXXXIPLAQKWHES
RECF_ANAVT      EPVYAHILQQYNQVLRQRNAYLKKLQDSTTQDSALAIWDAQLVTTGTKVIXXXXXXXXXXXXXXXXWHTS
RECF_CORJK      YPRLAAVKADYDKALRQRNALLRQSADAESALATLDVWDSQLAALGAQIMSARVQIVHDLAPHLQQTYQS
RECF_ACIC1      RPRLFAVRAEYEKALRQRNAFLRAVAQQQVDRNSLDVWNLHFXXXXXXXXXXXXXXVHELAPFVEKAYAA
RECF_HERA2      DGRYVRALSRYNQVLTQRNGLLRTSRERAASEQDLAFWDEELAKAGVYVLRERRRAVTTLDQLAQRLYAE
RECF_GEOBB      DLGYLTAYHDYAKILKNRNALLKV-----NETTGIEVWTEQLVQAALLVIERRKAYLDRIGKLLQGFYSE
RECF_CORDI      KPRLGGVKADYDKVLRQRNSLLKTARGYGADDSTLDVWDSQLARLGGQLIHARHSVVRELGPLVHDAYAR
RECF_GLOVI      EPVYTNVLAQFVQALHQRNALLRSTESPDALAEQLPCWDDLLVRAATPVMRRRHRLIERLAPLARRWHGS
RECF_MYCGI      RPRIAAVRADYDKVVRQRTALLKRFRGDRGALETLDVWDGHLAAHGAQLIAARVDLVHELAPEVEKAYQL
RECF_GEOSM      DLGYLTAYHDYAKILKNRNALLKV-----NETAGIEVWTEQLVQAALLVIERRKAYLDRIGRLLQGFYSE
RECF_THEFY      APRYAGVRSDYERVLKQRNALLKSAAHHRGGRDLLDVWDEHLAQIGXXXXXXXXXXXXXXQPLAAKAYGE
RECF_CHLTR      SDKYTEHISLYHKALDQRNASIK-----AQNQKAISAWNSPLIAYGSLVAFLRNECTKKLNTIFQTLWDN
RECF_CHLTB      SDKYTEHISLYHKALDQRNASIK-----AQNQKAISAWNSPLIAYGSLVAFLRNECTKKLNTIFQTLWDN
RECF_CHLTA      SDKYTEHISLYHKALDQRNASIK-----AQNQKAISAWNSPLIAYGSLVAFLRNECTKKLNTIFQTLWDN
RECF_CHLT2      SDKYTEHISLYHKALDQRNASIK-----AQNQKAISAWNSPLIAYGSLVAFLRNECTKKLNTIFQTLWDN
RECF_CORGL      QPRMAGVKADYDKVLKQRNALLKTTEEGAAALSTLDTWDGQLARLGAEVMAARFALLNELGPKIYEAYTT
RECF_CHLTE      DRKYLSDLLLYRRILQQRNALLSSEQDPRVIDSALDVLTDQLVAIATEIVLVRKRFIEHFTSMLGGVYQW
RECF_PROA2      SKSYXXXXXXXXXXXXXXNALLHSSWDRSSPAPDMNIWTELLAESGAFIIKERMDFLDEFQPYFSNAYAI
RECF_CORGB      QPRMAGVKADYDKVLKQRNALLKTTEEGAAALSTLDTWDGQLARLGAEVMAARFALLNELGPKIYEAYTT
RECF_THERP      DXXXXXXXXXXTRILEHRNSLLKSLRDQRAADEQLAYWDEQLVTYGAYLLVARLRFLAEWGPRLRDHFQA
RECF_CHLP8      DRKYLSDLLLYRRILQQRNALLSSEQDPRFIDSALDVLTDQLVATATEIVLVRKRFIEHFTSMLGDVYQW
RECF_CHLMU      SEKYTGQIALYHKALDQRNAAIK-TQDYKT----IAAWNSPLIAYGSLVALLRYECAKKL----HKIFQN
RECF_CHLFF      DPQYKHTLSYYHRALLQRNSLLK------TKQSTLSVWDEQLATLGAYLTLSRFTCCEQLNQLVQK--LW
RECF_SYNWW      SNEYFKLDNYXXXXXXXXXXXXXEETNSRSFAIINDIFMD----LAAQLLISRLNLINVLDEAIQEIYPQ
RECF_GEOSF      DITYLSVYHAYSKILKNRNMLLK-----RGEKASFDIWTEKLVEQGKNIIXXXXXXXXXXXXXXKRFYRE
RECF_SYNY3      EPLYAHLLGQYQHIVKQRNALLKSLRQQEESTASLSLWDQQLVEMGTXXXXXXXXXXXXXXXXXQEWHGR
RECF_GEOLS      DAAFLSDYHTYYRILKQRNALLKT-----NQQAGLDLWTEQLATAGIRLMQHRQHYTSRLNQLLQQKYQQ
RECF_COREF      RPRMAGVKADYDKVLKQRNALLKALRRGYGTEETLDTWDGQLARLGAEVMAARFALVQDLSSQIRDAYQT
RECF_TROWT      RPMMLDIYSAYDRTLKQRNSLLKSFRKSSCKSDLLDIWTQKLVELGLEIVNARKRLLKILNPKISEFYSK
RECF_TROW8      RPMMLDIYSAYDRTLKQRNSLLKSFRKSSCKSDLLDIWTQKLVELGLEIVNARKRLLKILNPKISEFYSK
RECF_CHLL2      DCRYLQSMLNYXXXXXXXXXXXXXXKERVQSIEMLNVLTEQLSEYAADIVFARLRFLDEILP-GLKAILS
RECF_MYCSS      RPSIAGVRADYDRVIRQRTALLKSARGDRSVLETLDVWDXXXXXXXXXXXXXXXDLVHHLAPEVEKAYQL
RECF_MYCSK      RPSIAGVRADYDRVIRQRTALLKSARGDRSVLETLDVWDXXXXXXXXXXXXXXXDLVHHLAPEVEKAYQL
RECF_MYCSJ      RPSIAGVRADYDRVIRQRTALLKSARGDRSVLETLDVWDXXXXXXXXXXXXXXXDLVHHLAPEVEKAYQL
RECF_ARTAT      VPRHAATRSDYDRVLKQRNALLKSARTGKGHEATLDVWDQHMARAGAELLHARLELVERLRPHLNSAYAQ
RECF_CORA7      TPRLAGVKADYDKVLKQRNALLKSASDGASALATLDVWDTQLSSLGAQVIQARLALVDELRELIPAAYAG
RECF_THEEB      XXXXXXXXXTYQKALRQRNALLKQAGSQGWDEALWQAWNQQLVINGTXXXXXXXXXXXXXAPLAQDWHRV
RECF_LEPIC      DPFYLEFLLEYNKILKHRNALLKSGNLDISH---LSIWDKKIVEKGIFILNKRREVVLELNSFYRVNLDK
RECF_LEPIN      DPFYLESLLEYNKILKHRNALLKSGNPDISH---LSIWDKKIVEKGIFILNKRREVVLELNSFYRVNLDK
RECF_CLAMS      XXXXAGVLSDYDRALKQRNTLLKSARARGMKADTLDIWDERLVAIGSQIIAARGALVESLQPELARAYLA
RECF_SALRD      RSVYMETLMKYRRARRQRNEVLRSYKKRSAPDELLAPWTEKLVGLGSRIVHRRQQFLQAFADDLEEAYRR
RECF_MYCVP      RPRIAAVRADYDKVVRQRTALLKRYRGDRGALETLDVWNGHLASHGAQLISARVQLVNELAPEVEKAYQL
RECF_LEIXX      NPRLSAVIAEYERVLKQRNTLLKSARASRFREDTLDIWDDRLLTLGAELINARLDLMARLSNPLVAAYRS
RECF_PROVI      DRRYLDNLLIYXXXXXXXXXXXXXXXXSPGKRSMLQLWSENLASSAASVTAGRVRFLAEFHPFVELLHRD
RECF_FLAJ1      DSTYLHQLIQYQKVIVQRNALLKYFANHTFDNDTLSIYNEQLNEFGKSIFEKRKEFLEEFIPIFNVHHQA
RECF_LEPBL      DPFYLECLLEYNKILKHRNALLKTGISDASH---LSIWDRKLIEKGVLILNKRKEIVFGLNSFYQPNLNK
RECF_LEPBJ      DPFYLECLLEYNKILKHRNALLKTGISDASH---LSIWDRKLIEKGVLILNKRKEIVFGLNSFYQPNLNK
RECF_ARTCA      VPHHAATRSDYDRVLKQRNALLKSARAGRAHEATLDVWDQHMAKAGXXXXXXXXXXXXXXXPHLARAYAE
RECF_SYNE7      QPIYAHLQQQYGRVLRQRNALLR--RAESLDLALLAPLNWQLAQLGVHIMRRRSRAIQRLVPLAAHWHRE
RECF_PELLD      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEMLDLWTENLADLAAGVTLRRISFLGELSVYFEPLQTS
RECF_FLAPJ      DNQYLQGLILYQKVLSQRNALLKYFAVNRFETGTLDIYNEQLNDLGQSIFEKRKQFLNDFIPIFNSFYQN
RECF_SYNP6      QPIYAHLQQQYGRVLRQRNALLR--RAESLDLALLAPLNWQLAQLGVHIMRRRSRAIQRLVPLAAHWHRE
RECF_MYCPA      RPAIAAVRADYDKVLRQRTALLKSLRGDRGALDTLDVWDSRLAEYGAQLMAARIDLVNQLAPEVEKAYQL
RECF_THETN      DKNYFFDLLQYNKTLSNRNSXXXXXXXXXXXXXXXXXFDEKLAEYGARIIKVRNNYLEKLKNSMSK--FL
RECF_SYNJB      EPAYLGLVEQYRQILRQRNALLKDPAAAGDKFSQMDFWDAQLATTGSXXXXXXXXXXXXXXXXXXHWHRV
RECF_KINRD      WPRIAGVRADYDRILRQRTALLKSMRSGRADTHTLDVWDEHLATTGAEXXXXXXXXXXXXXXPTDSAYRA
RECF_CARHZ      SKTYLLNLIYYQKVLTNKNALLKQVWN---VDNLIEAWNYKLAEFGAEIIKEREKCLKILNDIINELNAQ
RECF_SYNJA      EPAYLGLVEQYRQILKQRNALLKDPLAAGDKVPQMAFWDAQLATLGSXXXXXXXXXXXXXXXXXXXWHQA
RECF_MYCTU      XXXXXXXXXEYERVLRQRTALLKSVRGDRGVFDTLEVWDSRLAEHGAELVAARIDLVNQLAPEVKKAYQL
RECF_MYCTA      XXXXXXXXXEYERVLRQRTALLKSVRGDRGVFDTLEVWDSRLAEHGAELVAARIDLVNQLAPEVKKAYQL
RECF_PROAC      WPRMAAVKSDYERVLKQRNALLKSLKGRSAGAEIMDIWDNELATIGAELLSARLDTLSAVMPLTSAAYRE
RECF_CHLCV      DPQYKHTLSYYHRALLQRN-----XXXXXXXXXXXXVWDEQLATLGAYLTVSRYFCCEQLNQLVQE--LW
RECF_PELCD      RPSFLDHARAYQRCLRQRNILLKS----GAAAPIVLPWTEELIQTGAMVXXXXXXXXXXXXXXXXDIYRE
RECF_MYCBT      XXXXXXXXXEYERVVRQRTALLKSVRGDRGVFDTLEVWDSRLAEHGAELVAARIDLVNQLAPEVKKAYQL
RECF_MYCBO      XXXXXXXXXEYERVVRQRTALLKSVRGDRGVFDTLEVWDSRLAEHGAELVAARIDLVNQLAPEVKKAYQL
RECF_MYCSM      RPALAGVRADYDKVVRQRTALLKRYRGDRSVIDTLEVWDXXXXXXXXXXVASRVKLVEELQPEVEKAYQL
RECF_MYCS2      RPALAGVRADYDKVVRQRTALLKRYRGDRSVIDTLEVWDXXXXXXXXXXVASRVKLVEELQPEVEKAYQL
RECF_NOCFA      LPRLAGVRADYDRVLRQRSALLKTAGRHRSTADLLDVWDGHLAGHAAVLVAQRLRLVHDLFPYLAEAYRS
RECF_GEOSL      DXXXXXXXXXXXXXXKQRNALLR-----RGERDGLEVWTIQLAEAGARLMVKRRAYLSQIEPLVRQFYRD
RECF_DEIRA      SARYGEQLSRYERTVSQRNAALRG-----GEEWAMHVWDDVLLKLGTEIMLFRRRALTRLDELAR-----
RECF_MYCA1      RPAIAAVRADYDKVLRQRTALLKSLRGDRGALDTLDVWDSRLAEYGAQLMAARIDLVNQLAPEVEKAYQL
RECF_FRAAA      TPRMAAVLADYDRVLKQRSTXXXXXXXXXXXXXTLDVWDGYLASYGAELLTARLALVEALRPXXXXXXXX
RECF_SYNP2      EPVYARILQEYQQVLKQRNALLRTAKKHRNQAAIXXXXXXXXXXXXXXXXXXXXXXXXXLMPLAQAWHRD
RECF_ACHLI      SKTYLRNLNSYKKILKQRNALLKKNR-NLTDYTFLNILGEQLYDVGIQIFDERQKFIE-----------A
RECF_DEIDV      SARYAQQLARYDRTVSQRNAALRS-----GEEWAMHVWDDALVKLGSDIMLFRRRAL---------TRXX
RECF_ACHLA      SKTYLRNLNSYKKILKQRNALLKKNR-NLTDYTFLNILGEQLYDVGIQIFDERQKFIE-----------A
RECF_SALTO      QPRYAGVRTDYERVVRQRNALLRTAYLARGDLSTLAVWDDHLARHGAELLAGRLDLVAALAPHVNRXXXX
RECF_LEPBP      NRYYLKQLIEYERLIKQRNAALK--KENASDREI-GIWDEPIIEHDSEIREIRTKTIQSLAGYFHQNLLQ
RECF_LEPBA      NRYYLKQLIEYERLIKQRNAALK--KENASDREI-GIWDEPIIEHDSEIREIRTKTIQSLAGYFHQNLLQ
RECF_MYCLE      QPVIAAVRADYDKVLRQRTALLKSLRSDQGVLDTLDVWDTRLAEHGAELMAARIDLVNQLAPEVEKAYQL
RECF_MYCLB      QPVIAAVRADYDKVLRQRTALLKSLRSDQGVLDTLDVWDTRLAEHGAELMAARIDLVNQLAPEVEKAYQL
RECF_GEOMG      DXXXXXXXXXXXXXXKQRNALLK-----RGSREGLDIWTGQLAEAGTRLMVKRMGYLAEIEPLVQRFYRE
RECF_BEUC1      SPRLAGVRSEYERVLRQRTALLKSAGPARRRSRTLDVWDGHLARAGAELVAARVRLVQDLRPHVGATYEQ
RECF_CLAM3      XXXXAGVLSDYDRALKQRNTLLKSARARGMKADTLDIWDERLVAIGSQIIAARGALVEALQPELARAYLA
RECF_SALAI      QPRYAGVRADYERVVRQRNALLRTAYLARGDLSTLAVWDDHLARHGAELLAGRLDLVAALAPHVTRXXXX
RECF_CHLAB      DPQYKHSLSYYHRALLQRN-----XXXXXXXXXXXXVWDEQLATLGSYLCLSRYTCCAQLNQLIQT--LW
RECF_DEIGD      SARYGQQLARYERTVAQRNAALKAGEDW-----AMHVWDDALVKLGTDIMLFRRRALTRLDELAR-----
RECF_SHEB2      DPQFYGAWTNVRRVLKQRNQLLR----NGSSYSNIQFWDQEFVRYAEQVTEIRNHYVDSLNELLK----G
RECF_RHOSR      IPRMAAVRADYDRVLRQRSALLKTAEDGASALATLEVWDXXXXXXXXXXXXXXXXXVHDLAPHLAESYQS
RECF_SHEB9      DPQFYGAWTNVRRVLKQRNQLLR----NGSAYSNIQFWDQEFVRYAEQVTEIRNHYVDSLNELLK----G
RECF_SHEB5      DPQFYGAWTNVRRVLKQRNQLLR----NGSAYSNIQFWDQEFVRYAEQVTEIRNHYVDSLNELLK----G
RECF_SHEB8      DPLFYGAWTNVRRVLKQRNQLLR----NGSSYSNIQFWDQEFVRYAEQVTEIRNHYVDSLNELLK----G
RECF_XYLFT      EPDFLDLWRRYTHVLKQRNSLLKQ----KEELAMLEAWDQKLSEVGEQLTFRRFQYLERLIPLISKIHFN
RECF_XYLF2      EPDFLDLWRRYTHVLKQRNSLLKQ----KEELAMLEAWDQKLSEVGEQLTFRRFQYLERLIPLISKIHFN
RECF_CYTH3      DHVYLDALIRYNHFIKQRNALLKQAADGMLVDRILDAYDHNLLQSGKIIAQKRDEYLKRLLPIFQEYYSL
RECF_BIFLI      EPGYMQTLQQFTRIAKQRATLLKQLNANANNGQPLEIWTGQFIEAGVVLTRMRAHVISLLAEPFAAIYAD
RECF_SHESW      DPQFYGAWTNVRRVLKQRNQLLR----NGAVYTHIQFWDQEFVRYAEQVTEIRNHYVDSLNGLLK----G
RECF_SHEPC      DPQFYGAWTNVRRVIKQRNQLLR----NGAVYTHIQFWDQEFVRYAEQVTEIRNHYVDSLNGLLK----G
RECF_MYCMM      RPTIAGVRADYDKVLRQRTALLKSVRGDRGALDTLDVWDSRLAQHGAELMAARIDLVRLLAPEVEKAYQL
RECF_SACEN      APRYAGVRSDYDRVLRQXXXXXXXXXXXXXXXRTLEVWDGHLARYGAELLAGRLDLVAAIAPHVTSAYAN
RECF_RHOOB      IPRMAAVRADYERVLRQRSALLKTXEDGASALATLEVWDXXXXXXXXXXXXXXXXXVHDLAPHLAESYQS
RECF_MYXXD      FPAFLRESREYXXXXXXXXXXXXE--GHTVDAVYLEAYDETLAKAGARIYSRRRALMAELAPRAQATFAS
RECF_GRAFK      DQSYLNKLLQYTKLVSQRNSLLKYFAANNTERDTLEVYNLQMSSLGQDLFEKRKEFLKEFIPIFNKRYAD
RECF_BIFAA      LPRYAQSLQQFTHVAKQRAALLKQLSDEYGRQAVLEVWTGQFIALGVQLTKDRNDVIGLLREPFTRIYAS
RECF_SHESR      DPQFYAAWVNVRRVLKQRNQLLR----NNSSYEQIQYWDREFVRYTEQVTEIRNRYVDSLNELLK----G
RECF_SHESA      DPQFYAAWVNVRRVLKQRNQLLR----NNSSYDQIQYWDREFVRYTEQVTEIRNRYVDSLNELLK----G
RECF_MYCUA      RPTIAGVRADYDKVLRQRTALLKSVRGDRGALDTLDVWDSRLAQHGAELMAARIDLVRLLAPEVEKAYQL
RECF_SHESM      DPQFYAAWVNVRRVLKQRNQLLR----NNSSYDQIQYWDREFVRYTEQVTEIRNRYVDSLNELLK----G
RECF_IDILO      EHSFYSDWVAYTQLLKQRNSLLKQVREDR-------YWKEQLAYYGERISKSREKYLEE-----------
RECF_RHOE4      IPRMAAVRADYDKVLRQRSALLKXXXESDNVLSTLEVWDXXXXXXXXXXXXXXXELVHDLAPHLAESYRS
RECF_PSYIN      DPIFYPNWSRIKRLLKQRNAALKQCKTYNE----LQIWDNELCILSEEISQQREAYFELLMPLVKQT---
RECF_XYLFM      EPDFLDLWRCYTHVLKQRNSLLKQ----KEELAMLEAWDQKLSEVGEQLTFRRFQYLERLIPLISKIHFN
RECF_XANAC      EPDFLTLWRRYARALKQRNALLKQ----GAQPRMLDAWDNELAESGETLTSRRMRYLERLVPVADAI---
RECF_SHEON      DPQFYAAWMNVRRVLKQRNQMLR----NGSPYDQIQYWDREFIRYTEQVTEIRNRYVDSLNELLK----G
RECF_XYLFA      EPDFLDLWRCYTHVLKQRNSLLKQ----KEELAMLEAWDQKLSEVGEQLTFRRFQYLERLIPLISRI---
RECF_XANC5      EPDFLTMWRRYARALKQRNALLKQ----GAQPRMLDAWDHELAESGESLTSRRTRYLERLVPVADAI---
RECF_PSEHT      EHEFFFLWQSFNKVLKQRNALLKS--KPKNYFDQIKFWDKEFVRLAEQINKLRMAYISRF-----KQQF-
RECF_STRM5      EPDFLSLWRRYSRALKQRNALLKQ----GGPSRMLDTWDHELAEAGEPLTSRRQHYLERL---QQRT---
RECF_PARD8      DKPYLHALIQYNKALLQRNTLLKDQSMDASLYEVLEM---QLGMYGQIVYEKRKKLVEDFTPIFNEYYQT
RECF_STRMK      EPDFLSLWRRYSRALKQRNALLKQ----GGPSRMLDTWDHELAEAGEPLTSRRQHYLERL---QQRTVAL
RECF_OPITP      DAGYLRALQTYSRALADRNALLK--RGNAADAE-LDAFEQQXXXXXXXXXXXXXXXXXXXXXXXXXXYDR
RECF_NITOC      EPGFHDLWWCYQRTLKQRNHVL---RVHKSWQQEINAWNKKLSTYGEQITSLREAILFKLQDSVSQAHQP
RECF_SHEAM      SKQFHLAWMNTRRILKQRNQLLRD----GASYEHIAFWDKELIRYALEVTAIRNDYVGSLNGVLK----G
RECF_XANCP      EPDFLALWRRYARALKQRNALLKQ----GAQPQMLDAWDHELAESGSXXXXXXXXXXXXXVPVA------
RECF_XANC8      EPDFLALWRRYARALKQRNALLKQ----GAQPQMLDAWDHELAESGSXXXXXXXXXXXXXVPVA------
RECF_SHEPW      DPRFYAAWVNVRRILKQRNQLLRD----ESPYSSIQFWDKEFIRYAELVTEIRKQYVDSLNEL-------
RECF_SHEPA      DPRFYAAWVNVRRILKQRNQLLRDGSPYSS----IQFWDKEFIRYAELVTDIRKQYVDSLNELLK----G
RECF_PORGI      DPRYLSALIQYNRHLQQRNTMLKQDRHDDALMDVLEL---QMGSYAAEICNKRSRFIEDFLPVFNDLYSD
RECF_XANOR      EPDFLALWRRYVRALKQRNALLKQ----GAQPRMLDAWDHELAESGETLTSRRMRYLERLIPVADVIAPS
RECF_SHEFN      DPHFYQAWVNTRKVLKQRNQLLR----NQSSYNQIQFWDKELVRYAEQVTDIRNQYVDSLNVLLK----G
RECF_PORG3      DPRYLSALIQYNRHLQQRNTMLKQDRHDDALMDVLEL---QMGSYAAEIYNKRSRFIEDFLPVFNDLYSD
RECF_XANOM      EPDFLALWRRYVRALKQRNALLKQ----GAQPRMLDAWDHELAESGETLTSRRMRYLERLIPVADVIAPS
RECF_SHEWM      DKSFHSAWANVKRILKQRNQLLK----NQVSYSQIQFWDKELVRYSELVTLIRKEYVDSL----------
RECF_SHESH      DKSFHSAWVNVKRILKQRNQLLK----NETSYSQIQFWDKELVRYSEVVTDIRTRYVNSL----NEQLKG
RECF_PROMI      EPRFFAAWSDLKRVLKQRNAALRQASSYRQ----LLPWDKELILLTEQISQWRAEYTE-----------D
RECF_PROMH      EPRFFAAWSDLKRVLKQRNAALRQASSYRQ----LLPWDKELILLTEQISQWRAEYTE-----------D
RECF_MICLC      RPALGEAAADYERVLRQRNALLKSGRGSREEDATLAVWDEHLCAAXXXXXXXXXXXXXXXXXPLQEMYAA
RECF_SHIFL      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ERWT9      EPGFFHAWSNLRRLLKQRNAALRQV----SRYQQIRAWDQELAPLAEQISQWRAAYSEAIAA-------D
RECF_ECOSE      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAQY-----------SAG
RECF_YERPY      EPGFFTAWSNLKRLLKQRNAALRQV----SRYTQIRAWDQEIIPLAERISEWRXXXXXXXXXXXXXT---
RECF_YERPS      EPGFFTAWSNLKRLLKQRNAALRQV----SRYTQIRAWDQEIIPLAERISEWRXXXXXXXXXXXXXT---
RECF_YERPG      EPGFFTAWSNLKRLLKQRNAALRQV----SRYTQIRAWDQEIIPLAERISEWRXXXXXXXXXXXXXT---
RECF_YERPE      EPGFFTAWSNLKRLLKQRNAALRQV----SRYTQIRAWDQEIIPLAERISEWRXXXXXXXXXXXXXT---
RECF_YERPB      EPGFFTAWSNLKRLLKQRNAALRQV----SRYTQIRAWDQEIIPLAERISEWRXXXXXXXXXXXXXT---
RECF_YERP3      EPGFFTAWSNLKRLLKQRNAALRQV----SRYTQIRAWDQEIIPLAERISEWRXXXXXXXXXXXXXT---
RECF_SHIF8      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECO7I      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_SHIBS      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKEL-----------IPLVEQISTWRAEYSAG
RECF_SHEHH      DKSFHLAWANVRRILKQRNQLLK----NQVSYSQIQYWDKELVRYSEQVTEIRKQYVDSLNEQLK----G
RECF_ESCF3      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_SHISS      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_SERP5      EPGFFTAWSNLKRLLKQRNAALRQV----SRYAQIRAWDQEL-------IPLAERISEWRXXXXXXXXXX
RECF_ECOUT      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECOSM      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECOLU      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECOLI      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECOLC      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECOL6      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECOK1      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECOHS      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECODH      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECOBW      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECO8A      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECO81      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECO5E      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECO57      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECO55      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECO45      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECO27      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_ECO24      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SAG
RECF_BACFN      DKEYLDALIRYNKALVQRNTLLKS--EQPIEEELFLVWEEMMAQAGEVVFRKREAFISEFIPIFQSFYSY
RECF_METCA      EQGYLDLLRRFSRTLEQRNAVLRGDAPGSS----LAAWSGELARWGTMIAELRSSYLDRI-----RMHFG
RECF_ECOL5      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEY-----------SGG
RECF_BACFR      DKEYLDALIRYNKALVQRNTLLKS--EQPIEEELFLVWEEMMAQAGEVVFRKREAFISEFIPIFQSFYSY
RECF_AZOPC      DKEYLRTLIYYNQALQQRNFLLRNALPSLSGEE-FEIWEEQMGTTGEIIYQKRKNFTTDFLPLFKEYYYT
RECF_YERE8      EPGFFMAWSNLKRLLKQRNAALRQV----SRYTQIRAWDQEIIPLAERISEWRXXXXXXXXXXXXXT---
RECF_SACD2      KHEFKTAWANYVKCVKQRNSLL---RHDKIAYSDLRPWDEQIAGLAATIDECRVECITPLIQ-AFKALMG
RECF_BACTN      DKEYLEALIRYNKALAQRNTLLKS--EFPVEEELFLVWEEMMAQAGEIVFRKREAFIEEFIPIFQSFYSF
RECF_PSEA6      EHSFLTCSNAYSRLLKHNNALCKQQVGYANPQRV--YWTDLLAQYGSELTEFRNAMMTRLIPL-------
RECF_BACV8      DKEYLDALIRYNKALTQRNALLKS--EQEFDEELMLVWEEMMASAGEVVFKKRSEFIAEFIPTFQSFYSY
RECF_SHIB3      EPGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELIPLAEQISTWRAEYSA-----------G
RECF_SHIDS      ESGFFTAWSNLKRLLKQRNAALRQV----TRYEQLRPWDKELILLAEQISTWRAEY-----------SAG
RECF_MARAV      EPSFSSLWQQVQRVTSQRNQML---RNGRLDESLMRVWDSQYGALAESLSDIRETVFQRF-------KIA
RECF_SALTY      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_SALPK      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_SALPA      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_SALNS      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_SALHS      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_SALTI      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_SALSV      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEY---SIAIAQ----D
RECF_SALPC      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_SALG2      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_SALEP      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_SALDC      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_SALCH      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_SALA4      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_ACTPJ      YTEFYSCWANLKRLLKQRNAALHQVRSYAE----LKPWDIELAKLAEIVSQMRASYAEALRPEIEKTQFF
RECF_SHELP      DKSFYTAWANVRRILKHRNQMLKS----ETPYQQIQFWDKELVRYAEIVTEIRKRYVGSL-------NER
RECF_SALPB      EVGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_ACTPL      YTEFYSCWANLKRLLKQRNAALHQVRSYAE----LKPWDIELAKLAEIVSQMRASYAEGLRPEIEKTQFF
RECF_ACTP2      YTEFYSCWANLKRLLKQRNAALHQVRSYAE----LKPWDTELAKLAEIVSQMRANYAEALRPEIEKTQFF
RECF_SODGL      EPGFFTAWSNLRRLLKQRNAALRQV----SRYQQLRVWDQEL-----------IPLANRISEWRXXXXXX
RECF_PSEPF      EPRFMATWQRLQKALRQRNSWLR----HGTLDAVSQVWDRELCQASAEIDEYRRAYIKALKPVFEQTL--
RECF_SALAR      EAGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMADT---
RECF_PASMU      HNHFHLAWVNLNRLLKQRNAALQQATHY----QALEIWDRELVKLAHQVSEWRAQYAEALRP--------
RECF_ACTP7      YTEFYSCWANLKRLLKQRNAALHQVRSYAE----LKPWDIELAKLAEIVSQMRASYAEALRPEIEKTQFF
RECF_PSEE4      EPRFMATWQRLQKALRQRNSWLR----HGTLDAVSQAWDRELCLASAEIDEYRRNYIKALKPVFERT---
RECF_EDWI9      ERSFFTAWNNLRRVLKQRNAALRQV----TRYAQIRPWDQELVPLAEQVSALRAAYSEAIAQ-------D
RECF_SHEDO      DEQFYTAWSNVKRILKQRNQLL---RNGSSYGNIL-FWDKELVRYAEQVTQIRNHYVDSLNEL-------
RECF_PHOLL      EPRFFSAWVNLKRLLKQRNAALRQV----TRYSQIRPWDQELIPLANQINQWRGEYVTNITQ-------D
RECF_CITK8      EVGFFTAWSNLKRLLKQRNAALRQV----SRYEQLRPWDKELIPLAEQISTWRAEYSAGIAQDMADT---
RECF_THISH      DPAYHDHWRRYRHLLCQRNAALRD----RSPARLLSAWDTALGEAGSALDLARATHLQTLLPYLDSLKQE
RECF_PSESM      EPRFMSTWQRLQKALKQRNSWLRHGTLDAASQ---AAWDRELCLASDEIDEFRRAYIKALKPVFEKTL--
RECF_TERTT      KQEFKHYWKLYARCIKQRNSLLR--RDKITRSELLP-WDQELTKAAQHIESMRSEVFELF-----QTHFG
RECF_SODGM      EPAFFTAWSNLRRLLKQRNAALRQV----SRYQQLRVWDQEL-----------IPLANRISEWRXXXXXX
RECF_MARMS      DKDFIQAWRGWQKALKQRNTLL---RRGKISLSLLAAFDQELIRLGEQVNQSRKAYVEKLTP-----HF-
RECF_HAEIN      QTSFYSAWSNLNRLLKQRNAALAQNQPY----SAIKIWDVELAKLAHQVSEWRAEYAEALSP--------
RECF_HAEDU      HLEFYSYWANLKRLLKQRNAALPQVKSYSE----LKAWDIELVRLAHLVTKMRTEYAEALRPEIEKTRFF
RECF_THICR      NADFIHLWRHYQRALKQRNHALKK----RLPASQIQLWDAQLVDAAEKIDVIRADYITRLTPYL------
RECF_ENTS8      EPGFFVAWSNLKRLLKQRNAALRQV----TRYEQLRPWDRELVPLAEQISQWRASYSEAIANDMADTEFS
RECF_CELJU      EHQFYPQWKSLQRCLKHRNSLLR--RDRIDPFE-LSTWDQELVQLTEQIHCFREQCMALFVPVFEQQEFV
RECF_PSEU2      EPRFMATWQRLQKALKQRNSWLRHGTLDAASQ---AAWDRELCSASDEIDEFRRAYIKALKPVFEQTL--
RECF_PSEA8      EPRFLPVWQRLQKALRQRNSWLRHGKLDPASQ---AAWDRELSLASDEIDAYRRSYIQALKPVFEETLAE
RECF_HAEI8      QTSFYSAWSNLNRLLKQRNAALAQNQPY----SAIKIWDVELAKLAHQVSQWRAEYAEALRP--------
RECF_PSEF5      EPRFMSTWQRLQKALRQRNSWLRHGTLDAASQ---AAWDRELCQASAEIDEYRRAYIKALKPVFERXXXX
RECF_MANSM      QPNFHSAWSALHRLLKQRNAALNQTYDY----NMLKPWDMELAKLAHQVSQWRADYAEALSP--------
RECF_HAHCH      EHQFKVVWQNWXXXXXXXXXXXXSGNISRSE---LSAWDNQYVAYSDEISRYRDAYFAXXXXXXXXXXXX
RECF_VIBVY      EPAFYDAWGRFKRLNKQRNALLKSAKSYQE----LSYWDKEMARLAELISQWRADYVAQMQSKAEQL---
RECF_PSEPK      EPRFLPAWQRLQKALRQRNSWLRHGTLDPASQ---AAWDRELCLASAEIDEYRRNYIKALKPVFERT---
RECF_PSEPG      EPRFLPAWQRLQKALRQRNSWLRHGTLDPASQ---AAWDRELCLASAEIDEYRRNYIKALKPVFERT---
RECF_PSEP1      EPRFLPAWQRLQKALRQRNSWLRHGTLDPASQ---AAWDRELCLASAEIDEYRRNYIKALKPVFERT---
RECF_ERWCT      EPGFFAAWSNMKXXXXXXXXXXXXV----SHYGQLRAWDQELVPLAERISEWRAQYSAAIAN-------D
RECF_VIBCM      EPAFFDAWGRFKRLSKQRNALLKSAQSYRE----LSYWDQELARLAEQIDQWRESYVNQLKNVA------
RECF_VIBCH      EPAFFDAWGRFKRLSKQRNALLKSAQSYRE----LSYWDQELARLAEQIDQWRESYVNQLKNVA------
RECF_VIBC3      EPAFFDAWGRFKRLSKQRNALLKSAQSYRE----LSYWDQELARLAEQIDQWRESYVNQLKNVA------
RECF_PSEAE      EPRFLPVWQRLQKALRQRNSWLRHGKLDPASQ---AAWDRELSLASDEIDAYRRSYIQALKPVFEETLAE
RECF_PSEAB      EPRFLPVWQRLQKALRQRNSWLRHGKLDPASQ---AAWDRELSLASDEIDAYRRSYIQALKPVFEETLAE
RECF_ENT38      EAGFFNAWSNLKRLLKQRNAALRQV----TRYAQVRPWDEQISRYSAGIAEDMADTCKQFLPEFSLT-FS
RECF_PSEA7      EPRFLPVWQRLQKALRQRNSWLRHGKLDPASQ---AAWDRELSLASDEIDAYRRSYIQALKPVFEETLAE
RECF_COLP3      KHDSSKQWREFNRVLKQRNACIR----HNLDKATFDYWTGLFCQLSEQVAEVRSQYITNLIELPYWLEIL
RECF_VIBVU      EPAFYDAWGRFKRLNKQRNALLKSAKSYQE----LSYWDKEMARLAELISQWRADYVAQMQSKAEQL---
RECF_PECCP      EPGFFAAWSNMKXXXXXXXXXXXXV----SHYGQLRAWDQELVPLAERISEWRAQYSAAIANDIATT---
RECF_ACIAD      EPEFYFAWQYYSRALKQRNMLLKTKRQLSLAE--LEPWNKMLSEYGEMLHSQRLVTVERW-KXXXXXXXX
RECF_KLEP7      EAGFFTAWSNLKRLVKQRNAALRQV----SRYAQLRPWDLELIPLAEQISRWRAEYSAAIVEDMADT---
RECF_ACIBS      EPEFYFAWQYYSRALKQRNTLLKTRRNLSLAD--LEPWNKMLSNYGEILHSQRLSIVEQWNVYFQNDLSQ
RECF_KLEP3      EAGFFTAWSNLKRLVKQRNAALRQV----SRYAQLRPWDLELIPLAEQISRWRAEYSAAIVEDMADT---
RECF_VIBHB      EPAFYDAWGRFKRLNKQRNALLKTARSYRE----LSYWDQEMAHLAENISQWRALYIEQMKTVA-ETICQ
RECF_ACIBY      EPEFYFAWQYYSRALKQRNTLLKTRRNLSLAD--LEPWNKMLSDYGEILHSQRLSIVEQWNVYFQNDLSQ
RECF_ACIBT      EPEFYFAWQYYSRALKQRNTLLKTRRNLSLAD--LEPWNKMLSDYGEILHSQRLSIVEQWNVYFQNDLSQ
RECF_ACIBC      EPEFYFAWQYYSRALKQRNTLLKTRRNLSLAD--LEPWNKMLSDYGEILHSQRLSIVEQWNVYFQNDLSQ
RECF_ACIB5      EPEFYFAWQYYSRALKQRNTLLKTRRNLSLAD--LEPWNKMLSDYGEILHSQRLSIVEQWNVYFQNDLSQ
RECF_ACIB3      EPEFYFAWQYYSRALKQRNTLLKTRRNLSLAD--LEPWNKMLSDYGEILHSQRLSIVEQWNVYFQNDLSQ
RECF_VIBPA      EPAFYDAWGRFKRLNKQRNALLKTASSYRE----LSYWDQEMARLAENISQWRSLYIEQMKTVA-ETICQ
RECF_VIBFM      EPAFYDAWSRVKRLTKQRNALLKTANSYRE----LSYWDLELAQLSEKIDQWRVDYINH-----------
RECF_PSE14      EPRFMVTWQRLQKALKQRNSWLRHGTLDAASQ---AAWDRELCYASDEIDEFRRAYIKALKPVFEQTL--
RECF_SYNPX      EPVYADLLGRYNXXXXXXXXXXXXGAQTNPNQRLLDAFDVQMALVSTXXXXXXXXXXXXLEPIARRWQSH
RECF_ACTSZ      RPNFHSAWSALNRLLKQRNAALQQTYDYTD----LQVWDVELSKLAHQVSLWRTDYAEALRPEIEQT---
RECF_TREPA      NPLYLEYLQKYHALTKTKNREIKE-----KRVQLLDALDTQIATVGFDLVQWRTQLVRDFNVIFTK-YYE
RECF_FRAP2      DKTFLKIWQQTKFLIKQRNSALKQ----NYPKAYINGIDKKLCEFADILDYKRQAYFIKLKP---KIYEV
RECF_VIBF1      EPAFYDAWSRVKRLTKQRNALLKTANSYRE----LSYWDLELAQLSEKIDQWRVDYINH-----------
RECF_PSEPU      EPRFLPAWQRLQKALRQRNSWLRHGTLDPASQ---AAWDRELCLRSAEIDEYRRNYIKALKPVFERT---
RECF_PSEFS      EPRFMATWQRLQKALRQRNSWLRHGTLDAASQ---AAWDRELCLASDEIDEYRRAYIKALKPVFEQXXXX
RECF_HAES2      NASFYNAWSSLNRLLKQRNSALQQVCSY----EKLKIWDRELTKLAYQVSYWREAYAE-----------A
RECF_HAES1      NASFYNAWSSLNRLLKQRNSALQQVCSY----EKLKIWDRELTKLAYQVSYWREAYAE-----------A
RECF_VIBSL      ESGFYDAWGRVKRLNKQRNALLKTATHYRE----LSYWDQELARLAESISQWRATYVEQLKEVA------
RECF_PROMM      EPIYSDLISRFNKXXXXXXXXXXXXXPIQERDSLLDAFDVQMALVSTXXXXXXXXXXXXXXXXXXXWQET
RECF_COXBN      EPSFFSIWQRLQRSLKQRNAALK------AKLPLGEIWDKMLVEDGERLHQLRQNVVTEFRPLF------
RECF_ALISL      EPAFYEAWSRVKRLTKQRNALLKTAQSYRE----LSYWDLELANLAEKIDQWRVDYINH-----------
RECF_COXBU      EPSFFSIWQRLQRSLKQRNAALK------AKLPLGEIWDKMLVEDGERLHQLRQNVVTEFKPLF------
RECF_COXBR      EPSFFSIWQRLQRSLKQRNAALK------AKLPLGEIWDKMLVEDGERLHQLRQNVVTEFKPLF------
RECF_COXB2      EPSFFSIWQRLQRSLKQRNAALK------AKLPLGEIWDKMLVEDGERLHQLRQNVVTEFKPLF------
RECF_COXB1      EPSFFSIWQRLQRSLKQRNASLK------AKLPLGEIWDKMLVEDGERLHQLRQNIVTEFKPLF------
RECF_HAEPS      NTDFYHNWNSLKRLLKQRNAALVQTRHYNE----LKPWDVELSKFAQIVSQSRAVYVESILTIEKNCQFF
RECF_ANAD2      WPAVLGEAREYVXXXXXXXXXXXX-----GPAEVEASFREPLVRAGARILVRRRDLVAELAPRLQAAFAE
RECF_FRATW      DKTFLKIWQQTKFLVKQRNSALKQ---NYPYSYILSI-DKKLCEFAEILDYKRQAYFTKLKPKIYESHF-
RECF_FRATT      DKTFLKIWQQTKFLVKQRNSALKQ---NYPYSYILSI-DKKLCEFAEILDYKRQAYFTKLKPKIYESHF-
RECF_FRATM      DKTFLKIWQQTKFLVKQRNSALKQ---NYPYSYILSI-DKKLCEFAEILDYKRQAYFTKLKPKIYESHF-
RECF_FRAT1      DKTFLKIWQQTKFLVKQRNSALKQ---NYPYSYILSI-DKKLCEFAEILDYKRQAYFTKLKPKIYESHF-
RECF_CHRSD      KHEFFEAWRRVRRALKHRNALLRHDRDARS----MRVWEQELAHWSELLDALRSEYMAQFAKAFEDT-XX
RECF_SYNSC      EPVYADLMAXXXXXXXXXXXXXXXXXSSGERHALLEAFDVQMALVSTXXXXXXXXXXXXXEPIAQRWQTH
RECF_FRATN      DKTFLKIWQQTKFLVKQRNSALKQ---NYPYSYILSI-DKKLCEFAEILDYKRHAYFTKLKPKIYESHF-
RECF_FRATO      DKTFLKIWQQTKFLVKQRNSALKQ---NYPYSYILSI-DKKLCEFAEILDYKRQAYFTKLKPKIYESHF-
RECF_FRATH      DKTFLKIWQQTKFLVKQRNSALKQ---NYPYSYILSI-DKKLCEFAEILDYKRQAYFTKLKPKIYESHF-
RECF_FRATF      DKTFLKIWQQTKFLVKQRNSALKQ---NYPYSYILSI-DKKLCEFAEILDYKRQAYFTKLKPKIYESHF-
RECF_AZOVD      EQRFLPAWHRLQTALRQRNSWLRHGRIDPVSQ---AAWDRELCLASEEIDSYRRSYIQVLKPVFESVLHE
RECF_MAGSM      GRQQGALSHAVVAGDYQXXXXXXXXXXXXPRVEAGEAWESQLATLGAKMARNRYQVLQRLQPHLDRMLED
RECF_PSEPW      EPRFMPAWQRLQKALRQRNSWLRHGTLDPASQ---AAWDRELCLASAEIDEYRRNYIKALKPVFEQT---
RECF_PSEMY      EHRFLGAWQRLQKALRQRNSWLRHGTLDGASQ---AAWDRELCSASQEIDTYRRAYIQALKPVFERXXXX
RECF_PSEU5      EHRFMSAWXXXXXXXXXXNSWLR----HGTLDSASDAWSRELSLASDEIDGYRRAYIQALKPVFEXXXXX
RECF_RICM5      DPKHTELVSKYEYYMHERNKILEDIRD----DNWLKIIEEKMADISNHIANNRLKTLE-----------F
RECF_ANADF      ----------------------------------------------------------------------
RECF_ANADE      WPAVLGEAREYVXXXXXXXXXXXS-----GTAEVEASFREPXXXXXXXXXXXXXXXXXXXXPRLRAAFAE
RECF_RICAE      DPKHAELVSKYEYYMHERNKILEDIRD----DNWLKIIEEKMADISNHIANNRLKTLE-----------F
RECF_RICRS      DPKHAELVSKYEYYMHERNKILEDIRD----DNWLKIIEEKMADISNHIANNRLKTLE-----------F
RECF_RICRO      DPKHAELVSKYEYYMHERNKILEDIRD----DNWLKIIEEKMADISNHIANNRLKTLE-----------F
RECF_RICPU      DPKHAELVSKYEYYMHERNKILEDIRD----DNWLKIIEEKMADISNHIANNRLKTLE-----------F
RECF_RICCK      DPKHAELVGKYEYYMHERNKILEEIQD----DNWLKIIEEKMADISNHIAVNRLKTLEFMQQTINNLE--
RECF_NOCSJ      XXXXXGVRADYDRVLRQRNTLLKTARSRSVALDTLAVWDAHXXXXXXXXXXXXXXXXXXXXPYVGKAYET
RECF_RICCN      DPKHAELVSKYEYYMHERNKILVEDRRDDNWLKIIEEKMADISNHIAKTLEFMQQAIDDLENEFPKADLS
RECF_RHILW      DPAHGRRASDFERAMRSRNKLLDEGRFDPSWLAGIE---EQMASLGIAMALARQEMLGLLTRLIEETRET
RECF_AGRVS      DPQHGRRASDFERAMRSRNKLLSEGRFDASWLAGIE---QQMAALGIAMALARQEMMRLLAALIEQRREP
RECF_RICAH      YPKHAELVSKYEYYMHERNKILAEIRD----DNWLKIIEGKMADMSSHIANNRLKTLEFMQQAIDELE--
RECF_RICPR      DTKHAALLNKYEYYMHERNKILAEIRDN----NWLKIIEEKMADISNNIANNRLKTIR------------
RECF_RICBR      DPKHAELVSKYEHYMQERNKILAEDMWDNNWLKTIEMADTSIYNNRLKTLEFMQQAIDDLENEFPKAELS
RECF_RICB8      DPKHAELVSKYEHYMQERNKILAEDMWDNNWLKTIEMADTSIYNNRLKTLEFMQQAIDDLENEFPKAELS
RECF_AGRRK      DPAHGRRASDFERAMRSRNRLLSESRFDPSWLAGIE---EQMASLGIAMALARQEMLGLLTRLIAETREA
RECF_RICFE      DSKHAELVSKYEYYMYERNKILAEIRD----DNWLKIIEEKMADMSSHIANNRLKTLEFMQQAIDELE--
RECF_RHIL3      DPAHGRRASDFERAMRSRNKLLDEGRFDPSWLAGIE---EQMASLGIAMALARQEMLGLLTRLIEETRET
RECF_RHIE6      DPAHGRRASDFERAMRSRNKLLDEGRFDPSWLAGIE---EQMASLGIAMALARQEMLGLLARLIEERPES
RECF_RICTY      DTKHAELLNKYEYYMHERNKILAEIRDNKXXXXXXXXXXXXXXXXRLKTIRFMQQAIDEIENEFPKADLS
RECF_BRUSU      DTAHGKRVLDYEKAMRSRNRLL---NDGSNDDQWLDAIENQMAELG------------------------
RECF_RHIEC      DPAHGRRASDFERAMRSRNKLLD---DGRFDPSWLAGIEEQMASLGIAMALARQEMXXXXXXXXXXXXXS
RECF_BRUME      DTAHGKRVLDYEKAMRSRNRLL---NDGSNDDQWLDAIENQMAELG------------------------
RECF_BRUAB      DTAHGKRVLDYEKAMRSRNRLL---NDGSNDDQWLDAIENQMAELG------------------------
RECF_BRUA2      DTAHGKRVLDYEKAMRSRNRLL---NDGSNDDQWLDAIENQMAELG------------------------
RECF_AGRT5      XPGHGRRASDFEKAMRGRNRLLSEGRFDPVWLDGIEKQMAELGISMAVARYEMLGLLKTLIE-GRAGNAA
RECF_RHIME      DPEHGRRASEFDRAMRSRNRLLSEFRPDPAWLSAIE---REMAGLGISMALARQEMLGLLSALVERSRSD
RECF_ANASK      ----------------------------------------------------------------------
RECF_RHILO      DPGHGQRALDYEKAMRGRNRLLTDSRDDR-----------------------------------------
RECF_SPHWW      EPGHARHVSRYDAAMRARNKLL--AAEGPPDAAWLDALEAQLGQHGQAIXXXXXXXXXXXXXXXXXXXXX
RAD50_HALVO     ----------------------------------------------------------------------
SMC5_SCHPO      LPAHEKLRKREREILQNKNQGQSTLNSLKDRQQALEK-EVNIFKEREKISYIEMLGLAKMLVIYRE----
RAD50_THEMA     ----------------------------------------------------------------------
SMC4_SCHPO      ----------------------------------------------------------------------
RAD50_HALSA     ----------------------------------------------------------------------
RAD50_METMA     ----------------------------------------------------------------------
RAD50_PYRHO     ----------------------------------------------------------------------
RAD50_METJA     ----------------------------------------------------------------------
SMC4_ARATH      ----------------------------------------------------------------------
SMC3_DICDI      ----------------------------------------------------------------------
RAD50_METAC     ----------------------------------------------------------------------
SMC1_SCHPO      ----------------------------------------------------------------------
RECF_AZOVI      EQRFLPAWDRLQTALRQRNSWLRHGRIDPVSQ---AAWDREL----------------------------
RAD50_ARCFU     ----------------------------------------------------------------------
YP245_YEAST     ----------------------------------------------------------------------
RAD50_PYRFU     DK-FETAYKKLSELKKTINNRIKEYRDILARTENIE----------------------------------
SMC1A_RAT       ----------------------------------------------------------------------
SMC1A_MOUSE     ----------------------------------------------------------------------
SMC1A_HUMAN     ----------------------------------------------------------------------
SMC1A_BOVIN     ----------------------------------------------------------------------
RAD50_SULSO     ----------------------------------------------------------------------
RAD50_METKA     ----------------------------------------------------------------------
VF050_IIV3      ----------------------------------------------------------------------
SMC1A_XENLA     ----------------------------------------------------------------------
SMC5_TAKRU      ----------------------------------------------------------------------
SMC22_ARATH     ----------------------------------------------------------------------
SMC_MYCTU       ----------------------------------------------------------------------
RECF_CAUSK      EPAHAGHANAYDKAQRERMRLLTDAAE--SGQPADAVWXXXXXXXXXTLMALQAEIDSRGDRPFPRARLA
RAD50_THEVO     EAGYLLLKEDYDYLKNELQSKINEIDNNNKQIEELE----------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
RAD50_PYRAB     ----------------------------------------------------------------------
SMC5_XENLA      ----------------------------------------------------------------------
SMC5_YEAST      ----------------------------------------------------------------------
SMC5_HUMAN      ----------------------------------------------------------------------
RAD50_THEAC     ----------------------------------------------------------------------
SMC_MYCLE       ----------------------------------------------------------------------
SMC2_YEAST      ----------------------------------------------------------------------
RAD50_NANEQ     ----------------------------------------------------------------------
DXS_CLONN       SGGFGESVLQYANSLITTNSINSE----------------------------------------------
SMC21_ARATH     ----------------------------------------------------------------------
RAD50_SULTO     ----------------------------------------------------------------------
RAD50_METMP     ----------------------------------------------------------------------
SUDA_EMENI      ----------------------------------------------------------------------
SMC3_PLAF7      ----------------------------------------------------------------------
RAD50_AQUAE     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LTGGTEELQAKYLSSLVLEPGLSEGQIYQVFSSSSKKIRQMELKRCQTLLGPHRDDLSLAINGVEAKTFG
RECF_DESRM      LTGGTEELQAKYLSSLVLEPGLSEGQIYQVFSSSSKKIRQMELKRCQTLLGPHRDDLSLAINGVEAKTFG
RECF_PELTS      LTEGAENIEISYLSSLKIGEECGEDEIYERFSGELRLVRDEEIARMQTLVGPHRDDLHIKVDGHDARVYC
RECF_BACCZ      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLLGPHRDDLQFFVNSKNVQVFG
RECF_BACCR      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_BACC4      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_BACC2      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_BACWK      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLLGPHRDDLQFFVNSKNVQVFG
RECF_BACHK      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_BACCQ      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_BACC7      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_BACC3      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_BACC1      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_BACAH      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_BACC0      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_BACAN      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_BACAC      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_BACAA      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_BACSU      ISRGLEELTLKYHTALDVSDPLDLSKIGDSYQEAFSKLREKEIERGVTLSGPHRDDVLFYVNGRDVQTYG
RECF_BACCN      ISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFG
RECF_GEOSW      ISRGLETLQIQYRPSVDVSEKIELSRIIEAYSEKFATIKEREIQRGMTLAGPHRDDIAFSVNGKDVQIFG
RECF_BACLD      ISRGLEELTLKYHTSLHVSDSPDLSKMINSYQETFSKLRDKEIERGVSLSGPHRDDVLFYVNGRDVQTYG
RECF_GEOKA      ISRGAEQLCIRYEPSVDVSEKAELSRIVEAYSETFAAMREREVQRGTTLVGPHRDDIAFFVNGKNVQTFG
RECF_BACSK      ISRGKEMLTLSYIPSIEVSDIENMSKIKEDLYKAYETKRETEVRRGTTLFGPHRDDVSFSVNGLDVQSYG
RECF_BACA2      ISRGLEELTLKYHTALDVSDPKDLSKIGNSYQESFSKLKEKEIERGVTLFGPHRDDVLFYVNGRDVQTYG
RECF_LACS1      ITQGKEHLQFQYESTLKEYQGKSVLELKQSLIEQYKTMMDKEIFQGTTLLGPHRDDVRFMLNDKNVQVYG
RECF_PEDPA      ISQGKEKLSFQYVSPISSDQADTTEKIYAALQALFQKQREKELQQGKTLVGPHLDDVRFMVNDKNVSTFG
RECF_GEOTN      ISRGAERLHIRYEPSVDVSEKAELSRIVEAYSETFAAMREREIQRGTTLVGPHRDDIAFIVNGKNVQTFG
RECF_EXISA      ITRDLETLTIQYVSDTFQKERFSKEQMFETYRQKFDKIRENERRRGVTLFGPHRDDFELYVNNRNVQTFG
RECF_OCEIH      ISRELEQLEIQYSPSIEVSEDANKEKIGNIYQMKFAEVKQKEIERGTTLAGPHRDDLIFFVNGKDVQTYG
RECF_STACT      ITDERETLDLEYRPSLKLSEETDEAKLYEEVQKLLQDNMEREIERGVALYGPHRDDLGFKVNEMDAQTYG
RECF_BACP2      ISRELETLTLQYHTAIEVSEASDLSKIKNSYEESFQKLRDREIDRGVTLWGPHRDDLLFFVNGRDVQTYG
RECF_STAS1      ITNERETLSLNYLPSIKLEKDKSETERLEEVLTILNDNMEREKDRGVCLYGPHRDDLGFNVNGMDAQTYG
RECF_ENTFA      ISHGRETLTIDYASSIPIDTDLSLEAXXXXXXXXXXXXRKRELFKANTFLGPHRDDLLFIVNGQNVQTYG
RECF_ALKMQ      ITDGIETLEIEYKSSVLIKDHDTVDQIRVGFLKELNQSADEERRRGVTLVGPHRDDLNFNINGLEVKTYG
RECF_STAES      ITNDQETLTLDYVPSLKLEANQSE-LIEEVLALLNDNL-QREKERGVCLYGPHRDDLSFNVNGMDAQTYG
RECF_STAEQ      ITNDRETLTLDYVPSLKLEANQSE-LIEEVLALLNDNL-QREKERGVCLYGPHRDDLSFNVNGMDAQTYG
RECF_STAHJ      ITNERETLSLTYLPSIKLSD-MSKGEQTEVITLLNDNIKR-EMDRGVCLFGPHRDDLGFNVNDMDAQTYG
RECF_HALOH      ITDGLENITLSYESSLSRXXXXXXXXXXXXFRNKLVNNRNEEITRGYTLAGPQRDDLKITMNGIDIRKYG
RECF_CLOTH      LTDGSEIMEIKYSPSVDLHDLSNPSEIKNEFIRQLNSIRDIELKRCVTLIGPHRDDYEMELNGLNLKMFG
RECF_CLOTE      ITSDKEEISFTYLSS-IKNKNMDDGKIEEIFLQEIIKNRNSDIEKRYTSVGPHRDDFLININNVNTRSYG
RECF_MACCJ      ITKDKERLSLRYNASLNYE--LAEQEMFEETIRILNANMGKEIERTQSLYGPHRDDLSFKINDIDVQTYG
RECF_LACJO      ISGQAEKLQIFYRPSVKITPDDDVETIYQKVITSYKKNRPNEIRKGTTLSGPHRDDLDFLINDKNAHDFA
RECF_LACGA      ISGQAEKLQIFYRPSVKIIPEDNVETIYRKVITSYKKNRPNEIRKGTTLSGPHRDDLEFLINEKNAHDFA
RECF_OENOB      ISRN-EKLTIKYASFSGIDDQSTKEEISKIFNNQLLKNKTRELFLKSTSVGPHHDDLKFSINGKEVGSFA
RECF_LACC3      ITKGRESLHFSYQTQV--DPSLNSEQVYTALGEMFAKQQAREIEQGTSLVGPQRDDVLFIVNDKDVANFG
RECF_LACCB      ITKGRESLHFSYQTQV--DPSLDSEQVYTALGEMFAKQQAREIEQGTSLVGPQRDDVLFIVNDKDVANFG
RECF_LACSS      ITKDREVLTFKYQSQIPEEQDQSVEELYQQFQTLYEKQQIREVEQGTTLIGPHRDDVQFLVNDKDVQAFG
RECF_EXIS2      ISRGQEQLVLIYRSDTFSNDLLDVEGMTASYMQKFGKMKTNEIRRGVTLFGPHRDDFEMEVNGRNVQTYG
RECF_BREBN      ITDGRERLSLHYVNSSPVTEEMTIDQAVDKMLAAYEEVRDREIMRGSTLIGPHRDDFSLKVNNMDVQTYG
RECF_DESAP      AWAG-EELAVRYRSSVGLSNGVGAGDLRETLAA----VRQDEIRAGQTQAGPHLDDLAFMVNGKEGRPFA
RECF_LEUCK      VSNQREQLTLVYQTSIDFEEHADLEQIKATFAATLNRQRTREVMQGSTVVGPHRDDLQFIVNENDVAVFG
RECF_LEUMM      ISDQREALKLRYMSSVDFASDASLEEVKSVFADALSRQRSREIMQGSTMVGPHRDELQFDVNGNNVAIFG
RECF_LACBA      ISQQREELTFHYATQVADDQLTDVPTITAALSALYAKQQDKELYQGTTLVGPHRDDLHFQVNGKNVQTFG
RECF_STAAW      ITNDKEALSLNYLPSLKFDYAQNEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYG
RECF_STAAU      ITNDKEALSLNYLPSLKFDYAQNEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYG
RECF_STAAT      ITNDKEALSLNYLPSLKFDYAQNEAARLEEIMSILSDNMQREKERGISLFG