[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO48569.1

[Show Plain Result]


## Summary of Sequence Search
    1::151
   11::156     7e-39  50%  171 aa  TADA_STRP1 RecName: Full=tRNA-specific adenosine deaminase;        
   11::156     2e-38  49%  159 aa  Y196_STRP8 RecName: Full=Uncharacterized deaminase spyM18_0196;    
   11::156     2e-38  49%  171 aa  TADA_STRP6 RecName: Full=tRNA-specific adenosine deaminase;        
   11::156     2e-38  49%  171 aa  TADA_STRP3 RecName: Full=tRNA-specific adenosine deaminase;        
   24::148     2e-35  52%  161 aa  TADA_BACSU RecName: Full=tRNA-specific adenosine deaminase;        
    7::154     3e-35  45%  167 aa  TADA_SHIFL RecName: Full=tRNA-specific adenosine deaminase;        
    6::154     3e-35  45%  172 aa  TADA_SALTY RecName: Full=tRNA-specific adenosine deaminase;        
    6::154     3e-35  45%  172 aa  TADA_SALTI RecName: Full=tRNA-specific adenosine deaminase;        
    7::154     3e-35  45%  167 aa  TADA_ECOLI RecName: Full=tRNA-specific adenosine deaminase;        
 1112::1274    5e-35  49% 1307 aa  Y1872_ARATH RecName: Full=Uncharacterized protein At1g68720;
    7::154     5e-35  45%  167 aa  TADA_ECOL6 RecName: Full=tRNA-specific adenosine deaminase;        
    7::154     5e-35  45%  167 aa  TADA_ECO57 RecName: Full=tRNA-specific adenosine deaminase;        
   15::160     2e-32  44%  173 aa  TADA_HAEIN RecName: Full=tRNA-specific adenosine deaminase;        
    9::148     1e-28  41%  161 aa  Y255_BUCAI RecName: Full=Uncharacterized protein BU255;
    1::144     1e-26  40%  145 aa  Y1426_RICBR RecName: Full=Uncharacterized deaminase RBE_1426;      
    1::149     3e-26  39%  151 aa  TADA_AQUAE RecName: Full=tRNA-specific adenosine deaminase;        
    1::144     2e-25  39%  148 aa  Y819_RICTY RecName: Full=Uncharacterized deaminase RT0819;       
    4::151     4e-25  39%  162 aa  Y236_BUCBP RecName: Full=Uncharacterized protein bbp_236;
    9::150     1e-24  39%  151 aa  Y246_BUCAP RecName: Full=Uncharacterized protein BUsg_246;
    1::144     1e-24  40%  153 aa  Y1285_RICCN RecName: Full=Uncharacterized deaminase RC1285;        
    1::144     6e-24  39%  144 aa  Y1319_RICFE RecName: Full=Uncharacterized deaminase RF_1319;       
    1::144     2e-23  38%  148 aa  Y831_RICPR RecName: Full=Uncharacterized deaminase RP831;       
    8::160     2e-17  33%  170 aa  ADAT2_XENTR RecName: Full=tRNA-specific adenosine deaminase 2;     
   24::176     2e-17  35%  214 aa  ADAT2_DANRE RecName: Full=tRNA-specific adenosine deaminase 2;     
   25::177     3e-17  33%  191 aa  ADAT2_HUMAN RecName: Full=tRNA-specific adenosine deaminase 2;     
   13::165     3e-17  33%  175 aa  ADAT2_XENLA RecName: Full=tRNA-specific adenosine deaminase 2;     
   25::177     4e-17  32%  191 aa  ADAT2_MOUSE RecName: Full=tRNA-specific adenosine deaminase 2;     
  389::502     1e-16  42%  507 aa  TILS_THET8 RecName: Full=tRNA(Ile)-lysidine synthase;       
  389::502     1e-16  42%  507 aa  TILS_THET2 RecName: Full=tRNA(Ile)-lysidine synthase;       
  238::358     3e-16  31%  389 aa  TAD2_SCHPO RecName: Full=tRNA-specific adenosine deaminase subunit
   25::177     8e-16  33%  191 aa  ADAT2_BOVIN RecName: Full=tRNA-specific adenosine deaminase 2;     
  424::550     3e-15  33%  582 aa  TILS_DEIRA RecName: Full=tRNA(Ile)-lysidine synthase;       
    1::117     3e-15  40%  156 aa  GUAD_BACSU RecName: Full=Guanine deaminase;         Short=GDEase;  
  282::345     5e-14  50%  349 aa  ADAT3_MOUSE RecName: Full=tRNA-specific adenosine deaminase-like
  282::345     2e-13  50%  349 aa  ADAT3_RAT RecName: Full=tRNA-specific adenosine deaminase-like
    1::162     7e-13  33%  250 aa  TAD2_YEAST RecName: Full=tRNA-specific adenosine deaminase subunit
  284::345     1e-12  52%  351 aa  ADAT3_HUMAN RecName: Full=tRNA-specific adenosine deaminase-like
  447::527     3e-12  35%  533 aa  TILS_DEIDV RecName: Full=tRNA(Ile)-lysidine synthase;       
   13::149     3e-12  33%  162 aa  FCYS_SCHPO RecName: Full=Probable cytosine deaminase;       
   21::147     1e-11  35%  158 aa  FCY1_YEAST RecName: Full=Cytosine deaminase;       
  270::336     2e-10  51%  336 aa  ADAT3_DANRE RecName: Full=tRNA-specific adenosine deaminase-like
   15::149     3e-10  33%  356 aa  RIBD_AQUAE RecName: Full=Riboflavin biosynthesis protein
   36::139     3e-09  32%  150 aa  FCA1_CANAL RecName: Full=Cytosine deaminase;       
  165::301     2e-08  33%  315 aa  TAD3_SCHPO RecName: Full=tRNA-specific adenosine deaminase subunit
    2::139     2e-08  35%  368 aa  RIBD_SYNY3 RecName: Full=Riboflavin biosynthesis protein
   26::142     3e-08  34%  361 aa  RIBD_BACSU RecName: Full=Riboflavin biosynthesis protein
    1::143     8e-08  29%  367 aa  RIBD_ECOLI RecName: Full=Riboflavin biosynthesis protein
   26::142     1e-07  34%  371 aa  RIBD_BACAM RecName: Full=Riboflavin biosynthesis protein
   10::149     2e-07  28%  372 aa  RIBD_HAEIN RecName: Full=Riboflavin biosynthesis protein
    1::143     7e-07  34%  147 aa  RIBD1_BUCAI RecName:
  104::149     1e-05  48%  193 aa  DCTD_BPT4 RecName: Full=Deoxycytidylate deaminase;       
  104::149     1e-05  48%  188 aa  DCTD_BPT2 RecName: Full=Deoxycytidylate deaminase;       
   27::143     2e-05  29%  147 aa  RIBD1_BUCAP RecName:
  257::361     2e-05  31%  405 aa  RIB2_SCHPO RecName:
   11::150     2e-05  25%  376 aa  RIBD_CHLPN RecName: Full=Riboflavin biosynthesis protein
  169::281     1e-04  29%  322 aa  TAD3_YEAST RecName: Full=tRNA-specific adenosine deaminase subunit
   50::142     4e-04  36%  372 aa  RIBD_BUCBP RecName: Full=Riboflavin biosynthesis protein
    1::151

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSHALFMREALIEAQKAAVKGEVPIGAVVVWKDEVIGRGYDLRESLCDASAHAEILAMRKAAKHLGDWRL
TADA_STRP1      -----FMQEALKEAEKSLQKAEIPIGCVIVKDGEIIGRGHNAREESNQAIMHAEMMAINEANAHEGNWRL
Y196_STRP8      -----FMQEALKEAEKSLQKAEIPIGCVIVKDGEIIGRGHNAREESNQAIMHAEMMAINEANAHEGNWRL
TADA_STRP6      -----FMQEALKEAEKSLQKAEIPIGCVIVKDGEIIGRGHNAREESNQAIMHAEMMAINEANAHEGNWRL
TADA_STRP3      -----FMQEALKEAEKSLQKAEIPIGCVIVKDGEIIGRGHNAREESNQAIMHAEMMAINEANAHEGNWRL
TADA_BACSU      ----------------------VPIGAVLVINGEIIARAHNLRETEQRSIAHAEMLVIDEACKALGTWRL
TADA_SHIFL      -SHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVMQNYRL
TADA_SALTY      LDHEYWMRHALTLAKRAWDEREVPVGAVLVHNHRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVLQNYRL
TADA_SALTI      LDHEYWMRHALTLAKRAWDEREVPVGAVLVHNHRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVLQNYRL
TADA_ECOLI      -SHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVMQNYRL
Y1872_ARATH     ----IFMREALVEAKKAADTWEVPVGAVLVHDGKIIARGYNLVEELRDSTAHAEMICIREGSKALRSWRL
TADA_ECOL6      -SHEYWMRHAMTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVMQNYRL
TADA_ECO57      -SHEYWMRHAMTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVMQNYRL
TADA_HAEIN      ------MRYALELADKAEALGEIPVGAVLVDDARIIGEGWNLSIVQSDPTAHAEIIALRNGAKNIQNYRL
Y255_BUCAI      -----WMKIALKYAYYAKEKGEIPIGAILVFKERIIGIGWNSSISKNDPTAHAEIIALRGAGKKIKNYRL
Y1426_RICBR     ------MREALKQAEIAFSKNEVPVGAVIVDREKIISKSYNNTEEKNNALYHAEIIAINEACRIISSKNL
TADA_AQUAE      MGKEYFLKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRLNTKYL
Y819_RICTY      ------MEQALKQARLAFDKNEVPVGVVIVYRQKIIVSSHNNIEEKNNALCHAEIIAINEACNLISSKNL
Y236_BUCBP      -SDKYFMKCAIFLAKISEMIGEVPVGAVLVFNNTIIGKGLNSSILNHDPTAHAEIKALRNGAKFLKNYRL
Y246_BUCAP      -----WMKIALKYAYYAEENGEVPIGAILVFQEKIIGTGWNSVISQNDSTAHAEIIALREAGRNIKNYRL
Y1285_RICCN     ------MEQALKQAKIAFDKNEVPVGAVVVDRQKIIASTHNNTEEKNNALYHAEIIAINEACNLISSKNL
Y1319_RICFE     ------MEQALKQAGIAFDKNEVPVGAVIVDRQKIIVSSHNNTEEKNNALYHAEIIAINEACNLISSKNL
Y831_RICPR      ------MEQALKQARLAFDKNEVPVGVVIVCRQKIIVSSHNNIEEKKNPLCHAEIIAINTACNLISSKNL
ADAT2_XENTR     -----WMHKAFQMAQDALNNGEVPVGCLMVYDNQVVGKGRNEVNETKNATRHAEMVAIEKNSKKSRDV-F
ADAT2_DANRE     -----WMAKAFDMAVEALENGEVPVGCLMVYNNEIIGKGRNEVNETKNATRHAEMVALDQVL----DWRL
ADAT2_HUMAN     -----WMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIRQSGKSPSEV-F
ADAT2_XENLA     -----WMHKAFQMAQDALNNGEVPVGCLMVYGNQVVGKGRNEVNETKNATQHAEMVAIDQVL----DWCF
ADAT2_MOUSE     -----WMEEAMRMAKEALENIEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCHQHGQ
TILS_THET8      -------------------EGEVPVGAVLVLPGRVL-RAHNRVEGLRDPTAHAEMLLLREAGPEARGGRL
TILS_THET2      -------------------EGEVPVGAVLVLPGRVL-RAHNRVEGLRDPTAHAEMLLLREAGPEARGGRL
TAD2_SCHPO      -----------------------PGSCVFVYKGEVIGRGFNETNCSLSGIRHAELIAIEKILEHYPASVF
ADAT2_BOVIN     -----WMEQAMQMAKDALDNTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQAL----DWCF
TILS_DEIRA      ----------------------VPVGAVVLNADEIVGRGRNTSREDGDMTCHXXXXXXXXXXXXXXTPYL
GUAD_BACSU      MNHETFLKRAVTEGVNAGIGG--PFGAVIVKDGAIIAEGQNNVTTSNDPTAHAEVTAIRKACKVLGAYQL
ADAT3_MOUSE     ----------------------------------------------------------------------
ADAT3_RAT       ----------------------------------------------------------------------
TAD2_YEAST      MQHIKHMRTAVRLARYALDHDETPVACIFVHTPQVMAYGMNDTNKSLTGVAHAEFMGIDQIKAMLGSRGV
ADAT3_HUMAN     ----------------------------------------------------------------------
TILS_DEIDV      ---------------------------------------------------------------------L
FCYS_SCHPO      -----YLREAIKVSQQARDEGQHPFGCIIVDENDNVIMSAGNRVPDGDVTQHAETRAVGLITKTRRD--L
FCY1_YEAST      ------------EAALGYKEGGVPIGGCLINNKDVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKV-Y
ADAT3_DANRE     ----------------------------------------------------------------------
RIBD_AQUAE      ---------SLAKKRKGYTHPNPTVGAVVVKEGKIVGLGYHEKAG----KPHAEVMALGQAGE-----KA
FCA1_CANAL      --------------------------------DTVLGQGHNERIQKHSAILHGEMSALENAGRLPGK-TY
TAD3_SCHPO      --------EDLINAAGASHKGEIGCAAAIYTTDTVLAVSVDERSKLKNPINHCVMNAINLVAKRELSRRQ
RIBD_SYNY3      ISDQTHMRRCLTLA-KTAIGKTAPVGSVIVQGDEIVGQGFHPQA----GQPHGEIFALWEA----GD-RA
RIBD_BACSU      ------------------------VGAVVVKDGQIVGMGAHLKY----GEAHAEVHAIHMAGAH-----A
RIBD_ECOLI      MQDEYYMARALKLAQRGTTHPNPNVGCVIVKDGEIVGEGYHQRA----GEPHAEVHALRMAGE-----KA
RIBD_BACAM      ------------------------VGAVVVKKRQIVGMGAHLQY----GEAHAEVHAINMAGS-----LA
RIBD_HAEIN      ----VFMQRALDLAAKGTTTPNPSVGCVLVKNGEIVGEGFHFKAG----QPHAERVALAQAGENA-----
RIBD1_BUCAI     MNDIFYMKRA-IELSKLGEFTTAPVGCVIVKNNIIVGEGWHEQAGKNHAEINALIMAGEKA---------
DCTD_BPT4       ---------------------------------------------------HAELNAILFAARNGSS--I
DCTD_BPT2       ---------------------------------------------------HAELNAILFAARNGSS--I
RIBD1_BUCAP     ------------------------VGCVIVQNKKIVGEGWHKKY----GENHAEINALNMAGE-----KA
RIB2_SCHPO      -NHEEYMLKALNEAKKCETDSAFCVGAVIVQNGKIVSTGYSRERP---GNTHAEECAIEKFMLKNPTDSL
RIBD_CHLPN      -----FMRRAIEIGEKGRITAPPNVGCVVVQENRIIGEGFHAYA----GGPHAEELAIQNAS-----MPI
TAD3_YEAST      -------RASTLSVKMATAGKQFPMVSVFVKKDKVVAEGRNCENSL--PIDHSVMVGIRAVGERLREGVD
RIBD_BUCBP      ---------------------------------------------------HAEIYALKTSGE-----KA


                         .         .         *         .         .         .         .:140
query           NDATLYVTVEPCAMCAGAIVQFRINRLVYGAPNAKSGSVDTILNIVQEARFNHRVEVIAGILEDQCKEII
TADA_STRP1      LDTTLFVTIEPCVMCSGAIGLARIPHVIYGASNQKFGGVDSLYQILTDERLNHRVQVERGLLAADCANIM
Y196_STRP8      LDTTLFVTIEPCVMCSGAIGLARIPHVIYGASNQKFGGADSLYQILTDERLNHRVQVERGLLAADCANIM
TADA_STRP6      LDTTLFVTIEPCVMCSGAIGLARIPHVIYGASNQKFGGADSLYQILTDERLNHRVQVERGLLAADCANIM
TADA_STRP3      LDTTLFVTIEPCVMCSGAIGLARIPHVIYGASNQKFGGADSLYQILTDERLNHRVQVERGLLAADCANIM
TADA_BACSU      EGATLYVTLEPCPMCAGAVVLSRVEKVVFGAFDPKGGCSGTLMNLLQEERFNHQAEVVSGVLEEECGGML
TADA_SHIFL      IDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLHHPGMNHRVEITEGILADECAALL
TADA_SALTY      LDTTLYVTLEPCVMCAGAMVHSRIGRVVFGARDAKTGAAGSLIDVLHHPGMNHRVEIIEGVLRDECATLL
TADA_SALTI      LDTTLYVTLEPCVMCAGAMVHSRIGRVVFGARDAKTGAAGSLIDVLHHPGMNHRVEIIEGVLRDECATLL
TADA_ECOLI      IDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLHHPGMNHRVEITEGILADECAALL
Y1872_ARATH     ADTTLYVTLEPCPMCAGAILQARVNTLVWGAPNKLLGADGSWIRLFPGGEGNXKMTIRRGVLESECAQTM
TADA_ECOL6      IDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLHHPGMNHRVEITEGILADECAALL
TADA_ECO57      IDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLHHPGMNHRVEITEGILADECAALL
TADA_HAEIN      LNSTLYVTLEPCTMCAGAILHSRIKRLVFGASDYKTGAIGSRFHFFDDYKMNHTLEVTSGVLAEECSQKL
Y255_BUCAI      LNTTLYVTLQPCIMCCGAIIQSRIKRLVFGANCNSSDHRFSLKNLFCDPQKDYKLDIKKNVMQRECSDIL
Y1426_RICBR     SDYDIYVTLEPCAMCAAAIAHSRLKRLFYGASDSKHGAVESNLRYFNSKACFHRPEIYSGIFAEDSALLM
TADA_AQUAE      EGCELYVTLEPCIMCSYALVLSRIEKVIFSALDKKHGGVVSVFNILDEPTLNHRVK-WXXXXXXXXXXXX
Y819_RICTY      NDYDIYVTLEPCAMCASAISHSRLKRLFYGASDSKQGAVESNLRYFNSSACFHRPEIYSGILSEHSRFLM
Y236_BUCBP      LHTTLYVTLEPCIMCYGAIIHSRISRLVFGAKYKNLQKYICCKNHFFINKNFRKISITQEVLESECSNLL
Y246_BUCAP      VNTTLYVTLQPCMMCCGAIINSRIKRLVFGA-SYKDLKKNPFXXXXXXXXXXXXXXXXXHIMRNECAKIL
Y1285_RICCN     NDYDIYVTLEPCAMCAAAIAHSRLKRLFYGASDSKHGVVESNLRYFNSSACFHRPEIYSGILAEDSGLLM
Y1319_RICFE     NDYDIYVTLEPCAMCAAAIAHSRLKRLFYGASDSKHGAVESNLRYFNSSVCFYRPEIYSGILAEDSRLLM
Y831_RICPR      NDYDIYVTLEPCAMCASAISHSRLKRLFYGASDSKHGAVESNLRYFNSNSCFYRPEIYSGILSEHSRFLM
ADAT2_XENTR     ENIVLYVTVEPCIMCAGALRLLKIPLVVYGCRNERFGGCGSVLNVAGDPDTGTEFKYIGGYQAEKAVELL
ADAT2_DANRE     RETVLYVTVEPCIMCAAALRLLRIPFVVYGCKNERFGGCGSVLDVSSDPHTGTSFKCIAGYRAEEAVEML
ADAT2_HUMAN     EHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNRPFQCIPGYRAEEAVEML
ADAT2_XENLA     ENIVLYVTVEPCIMCAGALRLLKIPLVVYGCRNERFGGCGSVLNVSGDPDTGTKFKCIGGYQAEKAIELL
ADAT2_MOUSE     SPSTLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNRPFQCIPGYRAEEAVELL
TILS_THET8      -----YVTLEPCLMCHHALAQAGV-EVVYGAENLKEGAL---------TRFGLPTRARGGVRERECAKLL
TILS_THET2      -----YVTLEPCLMCHHALAQAGV-EVVYGAENLKEGAL---------TRFGLPTRARGGVRERECAKLL
TAD2_SCHPO      KETTLYVTVEPCLMCAAALKQLHIKAVYFGCGNDRFGGCGSVFSINKDQSIDPSYPVYPGLFYSEAVMLM
ADAT2_BOVIN     EHTVLYVTVEPCIMCAAALRLMRIPLVVYGCQNERFGGCGSVLDIASAPSTGKPFQCTPGYRAEEAVEML
TILS_DEIRA      SDCTLVVTLEPCPMCLGAALEARIGHIVYGAANPKAGALGGVSDLLAD-HWGWRPTVQGGVRAGEAARLL
GUAD_BACSU      DDCILYTSCEPCPMCLGAIYWARPKAVFYAAEHAEAGFDDSFI---------------------------
ADAT3_MOUSE     ----LYVTREPCVMCAMALVHARIQRVFYGAP-SPDGALGTLFRVHARPDLNHRFQVFRGILEDQCRQL-
ADAT3_RAT       ----LYVTREPCVMCAMALVHARIQRVFYGAP-SPDGALGTRFRVHARPDLNHRFQVFRGILEDQCRQL-
TAD2_YEAST      KDITLYVTVEPCIMCASALKQLDIGKVVFGCGNERFGGNGTVLSVVPKNNSAAGYESIPGILRKEAIMLL
ADAT3_HUMAN     ----LYVTREPCAMCAMALVHARILRVFYGAP-SPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCR---
TILS_DEIDV      TGCTLVVTLEPCPMCLGAALEARVERIVYGASNPKAGALGGVSDLL-SSHWGHVPAVTGGVRAQDAARVL
FCYS_SCHPO      EKCTLYTSTEPCAMCSGAIFWSGIRRMIFGLSNQKSGECPPLYINSRDGAASHPIEVVGPYIEDE-----
FCY1_YEAST      KDTTLYTTLSPCDMCTGAIIMYGIPRCVVGEVNFKSKG---------EKYLQTRGHEVVVVDDERCKKIM
ADAT3_DANRE     ----LYVTREPCVMCAMALVHSRISRVFYGASTA-DGAFGSRYKIHCQKDLNHRFEVFKGVMEDLCKE--
RIBD_AQUAE      KGATLYVTLEPCTPCTDAIIRSGIKRVVVATPNPLMSGKG-----VEKLR-NAGIEVDVGVCEEEARELN
FCA1_CANAL      KDCTIYTTLSPCSMCTGAILLYGFKRVVMGE------NVNFLGN--EKLLIENGVEVV-NLNDQECIDLM
TAD3_SCHPO      NDLTVVMTHEPCVMCSMGLLHSRIRRLIYCKKQPLTGGIESLYGIHWRAELNHRYLAYSG----------
RIBD_SYNY3      KGATLYVNLEPCPPCTEAIIQAGIAKVVVGMVDPNPLVAGKGISRLRQA----GIEVKVGVEEEACQRLN
RIBD_BACSU      EGADIYVTLEPCSPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEA----GIEVREGILADQAERLN
RIBD_ECOLI      KGATAYVTLEPCSPCCDALIAAGVARVVASMQDPNPQVAGRGLYRLQQA----GIDVSHGLMMSEAEQLN
RIBD_BACAM      KGADLYVTLEPCSPCAELIMKSGIKRVFIAVEDPNPLVAGKGITMLEEA----GIEVKTGLLRQQAEELN
RIBD_HAEIN      KGATAYVTLEPCAPCALGLIEAGVVKVIAAMQDPNPQVAGKGLKMLSDA----GIESTVNLLNDQAEKIN
RIBD1_BUCAI     QGGTAYVTLEPCPPCCNALIKSGINRVVISDPNPKSGNGILYLK-------KHGICVKTGLLSKESKQYN
DCTD_BPT4       EGATMYVTLSPCPDCAKAIAQSGIKKLVY-----------------------------------------
DCTD_BPT2       EGATMYVTLSPCPDCAKAIAQSGIKKLVY-----------------------------------------
RIBD1_BUCAP     KGSTAYITLEPCPPCCDAIIQSGIKNVIISSPNPKV-SGKGVLYLRKKG-----ISVKIGLMSKESQKYN
RIB2_SCHPO      EGAIMYSTMEPCSSCTDLIVKQKFSTVVLGS---------------------------------------
RIBD_CHLPN      SGSDVYVSLEPCSPCANLLIKHKVSRVFVALVDPDPKVAGQGIAMLRQA----GIQVYVGIGESEAQASL
TAD3_YEAST      EDANVYLTHEPCSMCSMALIHSRVRRVVFLTEMQRTGSL-------------------------------
RIBD_BUCBP      KGATAYITLEPCSPCCVALTKYGISRVVIATPNPKSGNGVKWLK-------KHGILVTIGTLSKESIKIN


                         +         .         .         .         .         *         .:210
query           QNFFRELRKNK
TADA_STRP1      QTFFRQGRERK
Y196_STRP8      QTFFRQGRERK
TADA_STRP6      QTFFRQGRERK
TADA_STRP3      QTFFRQGRERK
TADA_BACSU      SAFFREL----
TADA_SHIFL      SDFFRMRRQ--
TADA_SALTY      SDFFRMRRQ--
TADA_SALTI      SDFFRMRRQ--
TADA_ECOLI      SDFFRMRRQ--
Y1872_ARATH     QQFFQLRRKKK
TADA_ECOL6      SDFFRMRRQ--
TADA_ECO57      SDFFRMRRQ--
TADA_HAEIN      STFFQKRREEK
Y255_BUCAI      INFFQ------
Y1426_RICBR     KGFFKKIR---
TADA_AQUAE      XXFFKKLRNN-
Y819_RICTY      KEFFQKMR---
Y236_BUCBP      SSFFKRKRK--
Y246_BUCAP      SNFFKNKR---
Y1285_RICCN     KEFFKRIR---
Y1319_RICFE     KEFFKRIR---
Y831_RICPR      QEFFQRIR---
ADAT2_XENTR     KTFYKQENPN-
ADAT2_DANRE     KTFYKQENPN-
ADAT2_HUMAN     KTFYKQENPN-
ADAT2_XENLA     KTFYKQENPN-
ADAT2_MOUSE     KTFYKQENPN-
TILS_THET8      RDFFARLRE--
TILS_THET2      RDFFARLRE--
TAD2_SCHPO      REFY-------
ADAT2_BOVIN     KTFYKQENPN-
TILS_DEIRA      REVFGEVRR--
GUAD_BACSU      -----------
ADAT3_MOUSE     -----------
ADAT3_RAT       -----------
TAD2_YEAST      RYFY--VRQNE
ADAT3_HUMAN     -----------
TILS_DEIDV      RDSFQELRQRR
FCYS_SCHPO      -----------
FCY1_YEAST      KQFIDE-----
ADAT3_DANRE     -----------
RIBD_AQUAE      EDFFTYITQER
FCA1_CANAL      AKFIKE-----
TAD3_SCHPO      -----------
RIBD_SYNY3      EAF--------
RIBD_BACSU      EKFLHFMR---
RIBD_ECOLI      KGFLKRMR---
RIBD_BACAM      KMFLHFMR---
RIBD_HAEIN      KGFLKRMRQ--
RIBD1_BUCAI     KGFFKRMK---
DCTD_BPT4       -----------
DCTD_BPT2       -----------
RIBD1_BUCAP     KGFFKRMR---
RIB2_SCHPO      -----------
RIBD_CHLPN      QPYLYQRTHN-
TAD3_YEAST      -----------
RIBD_BUCBP      KGFFQRM----