[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO48689.1

[Show Plain Result]


## Summary of Sequence Search
    1::334
    5::340     1e-16  27%  347 aa  ASRA_SALTY RecName: Full=Anaerobic sulfite reductase subunit
   39::147     4e-05  33%  294 aa  FDNH_SHIFL RecName: Full=Formate dehydrogenase, nitrate-inducible,
   39::147     4e-05  33%  294 aa  FDNH_ECOLI RecName: Full=Formate dehydrogenase, nitrate-inducible,
  242::326     7e-05  34%  355 aa  FWDF_METJA RecName: Full=Polyferredoxin protein fwdF;
  130::210     2e-04  33%  398 aa  VHUB_METVO RecName: Full=Polyferredoxin protein vhuB;
   18::47      2e-04  53%   98 aa  FER3_ANAVT RecName: Full=Ferredoxin-3;AltName: Full=Ferredoxin III;
   78::115     4e-04  42%  153 aa  Y264_METJA RecName: Full=Uncharacterized protein MJ0264;
  242::271     6e-04  40%  357 aa  YCCM_ECOLI RecName: Full=Putative electron transport protein yccM;
  675::756     6e-04  33% 1171 aa  NIFJ_KLEPN RecName: Full=Pyruvate-flavodoxin oxidoreductase;       
  520::535     7e-04  75%  620 aa  Y870_METJA RecName: Full=Uncharacterized protein MJ0870;
   27::123     7e-04  25%  157 aa  VHCB_METVO RecName: Full=Polyferredoxin protein vhcB;
  288::369     7e-04  29%  394 aa  FDHB_METTF RecName: Full=Formate dehydrogenase subunit beta;       
    1::334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLNKSETASLLDKLANEYRVIAPVEKEGLVQFAAIQKGEEAKLDYMNAKKPGKEILFPQSEELYSYTVD
ASRA_SALTY      --ITPDEFSLLIQRLNKKWRVFAPSAEFRGGRFSDTDNGWRDLIWHEKSHMSPNTIIAPITETLFYFDKD
FDNH_SHIFL      ----------------------------------------------------------------------
FDNH_ECOLI      ----------------------------------------------------------------------
FWDF_METJA      ----------------------------------------------------------------------
VHUB_METVO      ----------------------------------------------------------------------
FER3_ANAVT      ----------------------------------------------------------------------
Y264_METJA      ----------------------------------------------------------------------
YCCM_ECOLI      ----------------------------------------------------------------------
NIFJ_KLEPN      ----------------------------------------------------------------------
Y870_METJA      ----------------------------------------------------------------------
VHCB_METVO      ----------------------------------------------------------------------
FDHB_METTF      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AEGVRMQDNVDPKATIVFGMRPCDVKSMVLLDNVFKNDQYEDVYYLTRRANTLIVGLGCNEPSATCFCSS
ASRA_SALTY      TIQIAETDT----SPIIIFARACDINAMSRLDYMYSNGNNSDYSYQLLREHIRFVLIECEESFENCFCVS
FDNH_SHIFL      ----------------------------------------------------------------------
FDNH_ECOLI      ----------------------------------------------------------------------
FWDF_METJA      ----------------------------------------------------------------------
VHUB_METVO      ----------------------------------------------------------------------
FER3_ANAVT      ----------------------------------------------------------------------
Y264_METJA      ----------------------------------------------------------------------
YCCM_ECOLI      ----------------------------------------------------------------------
NIFJ_KLEPN      ----------------------------------------------------------------------
Y870_METJA      ----------------------------------------------------------------------
VHCB_METVO      ----------------------------------------------------------------------
FDHB_METTF      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MSCGPFAKEGSDIFLTDIGEAYVVEGIXXXXXXXXXXXXXXXXXXXXXXXXXXLQEETKADGSVNIEGLA
ASRA_SALTY      MGTNKFSDEGALVSIRDPFIEAAIQGLGQEADYTPSFVSEN-------------RETVVTPDSVCHD--P
FDNH_SHIFL      ----------------------------------------------------------------------
FDNH_ECOLI      ----------------------------------------------------------------------
FWDF_METJA      ----------------------------------------------------------------------
VHUB_METVO      ----------------------------------------------------------------------
FER3_ANAVT      ----------------------------------------------------------------------
Y264_METJA      ----------------------------------------------------------------------
YCCM_ECOLI      ----------------------------------------------------------------------
NIFJ_KLEPN      ----------------------------------------------------------------------
Y870_METJA      ----------------------------------------------------------------------
VHCB_METVO      ----------------------------------------------------------------------
FDHB_METTF      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EKLGGMFEHPYWDSLYEKCLGCGACTYLCPTCHCFDIADEATDCNGCRVRNWDACMFPLFTLHGSGHNPR
ASRA_SALTY      QKIRDILHHPLWDAYDSRCISXXXXXXXXXXXXXYSVFDVAYDENGERRRQWASCMVPGFSDMAGGHGFR
FDNH_SHIFL      ------------------CIGCKACQVACSEWN--DIRDEVGHCVGVSAKSWTVMRFSLIRKDGCMHCED
FDNH_ECOLI      ------------------CIGCKACQVACSEWN--DIRDEVGHCVGVSAKSWTVMRFSLIRKDGCMHCED
FWDF_METJA      ----------------DACVTCGWCAFICPA-EAIEVGELIIDVNACNACGACISICPCSALEF----PK
VHUB_METVO      ----------------EACVGCSECVPVCPV-DAISIEDELADTEKCIYCSVCAQTCPWNAIYVAGKKPS
FER3_ANAVT      ----------------------------------------------------------------------
Y264_METJA      ----------------DKCVGCGLCALACP-FGAIRIDGVAIKCNGCYKRDVEIC---------------
YCCM_ECOLI      ----------------------------------------------------------------------
NIFJ_KLEPN      EKRGIALEVPVWQP--EGCTQCNQCAFICP----------------------HAAIRPAL-LNGEEHDAA
Y870_METJA      ----------------------------------------------------------------------
VHCB_METVO      -----------WDR--EKCEYCGPCAIKCPNDAIMVVNPKGLELPS-RAKTERANEFKMCDLCGTCVSAC
FDHB_METTF      ----------YMDEL-NKCIKCYSCREACPICYCEECSLETKTPEW--IEKGKIPPSPLFHL--------


                         .         *         .         .         .         .         +:350
query           PGGKARWRQRLMHKFNYFVERYNATACVGCGRCIKNCPVNLDIRQVLADVRxxx
ASRA_SALTY      EKPGERLRYRALHKVNDYKARNGIEMCVGCGRCDDRCPFSLIINKMTAAVR---
FDNH_SHIFL      PGCKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNI-------------
FDNH_ECOLI      PGCKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNI-------------
FWDF_METJA      PKDKAEKVPRII---------VNQNLCVLCGACAKACPVN--------------
VHUB_METVO      K------RQKEIKSFTVTEE------CIGCEKCVEVCP----------------
FER3_ANAVT      -----------------FVEAVNQDKCIGCGRCFKACGRNVLILQAL-------
Y264_METJA      ------------------------------------------------------
YCCM_ECOLI      -----------------FKIRRNAESCIDCGKCAKNCPSRIPVDKLI-------
NIFJ_KLEPN      PVGLLSKPAQGAKEYHYHL-AISPLDCSGCGNCVDICP----------------
Y870_METJA      ----------------------NYNVCVGCGKCIKNCP----------------
VHCB_METVO      PTEALQMGKIVHNEKEYDRIEFTPSLCDSCGACVEICPQNV-------------
FDHB_METTF      --------ERMLHMVD---------SCTNCGQCEELCPAEIPLAKIWHEI----