[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO48707.1

[Show Plain Result]


## Summary of Sequence Search
    1::472
    1::292     1e-16  32%  416 aa  CCA_THICR RecName: Full=Multifunctional CCA protein;Includes:
    1::286     4e-15  36%  417 aa  CCA_NEIMF RecName: Full=Multifunctional CCA protein;Includes:
    1::286     4e-15  36%  417 aa  CCA_NEIMB RecName: Full=Multifunctional CCA protein;Includes:
    1::286     4e-15  36%  417 aa  CCA_NEIMA RecName: Full=Multifunctional CCA protein;Includes:
    1::286     6e-15  36%  417 aa  CCA_NEIM0 RecName: Full=Multifunctional CCA protein;Includes:
    1::293     6e-15  36%  422 aa  CCA_HAHCH RecName: Full=Multifunctional CCA protein;Includes:
    1::289     2e-14  35%  410 aa  CCA_NEIG2 RecName: Full=Multifunctional CCA protein;Includes:
    1::289     2e-14  35%  410 aa  CCA_NEIG1 RecName: Full=Multifunctional CCA protein;Includes:
    9::185     8e-14  31%  375 aa  CCA_BACHD RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   17::270     4e-13  29%  400 aa  CCA_STAHJ RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::290     4e-13  29%  416 aa  CCA_SHEB2 RecName: Full=Multifunctional CCA protein;Includes:
    1::288     5e-13  35%  411 aa  CCA_TERTT RecName: Full=Multifunctional CCA protein;Includes:
    1::294     9e-13  32%  414 aa  CCA_RALME RecName: Full=Multifunctional CCA protein;Includes:
   21::200     9e-13  35%  403 aa  CCA_LEUCK RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::294     3e-12  37%  416 aa  CCA_XYLFT RecName: Full=Multifunctional CCA protein;Includes:
    1::294     3e-12  37%  416 aa  CCA_XYLF2 RecName: Full=Multifunctional CCA protein;Includes:
   21::231     3e-12  31%  403 aa  CCA_STRU0 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::289     8e-12  31%  412 aa  CCA_BAUCH RecName: Full=Multifunctional CCA protein;Includes:
    1::294     1e-11  37%  416 aa  CCA_XYLFM RecName: Full=Multifunctional CCA protein;Includes:
    1::295     1e-11  32%  411 aa  CCA_ACTP7 RecName: Full=Multifunctional CCA protein;Includes:
    1::295     1e-11  32%  411 aa  CCA_ACTP2 RecName: Full=Multifunctional CCA protein;Includes:
   21::213     2e-11  33%  399 aa  CCA_STRR6 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::213     2e-11  33%  399 aa  CCA_STRPS RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::213     2e-11  33%  399 aa  CCA_STRPN RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::213     2e-11  33%  399 aa  CCA_STRP4 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   26::218     2e-11  32%  401 aa  CCA_STRMU RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::290     2e-11  37%  410 aa  CCA_LEGPH RecName: Full=Multifunctional CCA protein;Includes:
   26::200     2e-11  34%  406 aa  CCA_ENTFA RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::290     2e-11  34%  413 aa  CCA_AERS4 RecName: Full=Multifunctional CCA protein;Includes:
    1::192     3e-11  37%  419 aa  CCA_VARPS RecName: Full=Multifunctional CCA protein;Includes:
    1::290     3e-11  37%  410 aa  CCA_LEGPL RecName: Full=Multifunctional CCA protein;Includes:
    1::289     3e-11  34%  412 aa  CCA_AERHH RecName: Full=Multifunctional CCA protein;Includes:
    1::184     3e-11  39%  419 aa  CCA_ACIAC RecName: Full=Multifunctional CCA protein;Includes:
    1::294     5e-11  36%  416 aa  CCA_XYLFA RecName: Full=Multifunctional CCA protein;Includes:
    1::290     7e-11  34%  411 aa  CCA_PHOPR RecName: Full=Multifunctional CCA protein;Includes:
   26::213     9e-11  33%  403 aa  CCA_STRSY RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   26::213     9e-11  33%  403 aa  CCA_STRS2 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::290     1e-10  37%  410 aa  CCA_LEGPA RecName: Full=Multifunctional CCA protein;Includes:
    1::295     1e-10  31%  419 aa  CCA_MANSM RecName: Full=Multifunctional CCA protein;Includes:
    1::184     1e-10  38%  425 aa  CCA_ACISJ RecName: Full=Multifunctional CCA protein;Includes:
    1::184     2e-10  38%  425 aa  CCA_DIAST RecName: Full=Multifunctional CCA protein;Includes:
    1::181     2e-10  37%  192 aa  CCA_AERHY RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::186     3e-10  32%  411 aa  CCA_RALEH RecName: Full=Multifunctional CCA protein;Includes:
    1::180     4e-10  35%  406 aa  CCA_VIBPA RecName: Full=Multifunctional CCA protein;Includes:
   26::213     4e-10  32%  399 aa  CCA_STRGC RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::206     4e-10  28%  393 aa  CCA_LISMO RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   26::232     4e-10  33%  402 aa  CCA_LACLS RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   26::232     4e-10  33%  402 aa  CCA_LACLM RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   20::205     4e-10  31%  397 aa  CCA_BACCN RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   20::186     6e-10  27%  376 aa  CCA_BACSK RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::182     7e-10  33%  410 aa  CCA_XANCP RecName: Full=Multifunctional CCA protein;Includes:
    1::182     7e-10  33%  410 aa  CCA_XANCB RecName: Full=Multifunctional CCA protein;Includes:
    1::182     7e-10  33%  410 aa  CCA_XANC8 RecName: Full=Multifunctional CCA protein;Includes:
   21::215     7e-10  28%  393 aa  CCA_LISW6 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::204     1e-09  29%  393 aa  CCA_LISMF RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::204     1e-09  29%  393 aa  CCA_LISMC RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::204     1e-09  28%  393 aa  CCA_LISIN RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::206     1e-09  34%  397 aa  CCA_ALTMD RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    4::180     1e-09  35%  400 aa  CCA_ACTSZ RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::295     1e-09  32%  409 aa  CCA_THISH RecName: Full=Multifunctional CCA protein;Includes:
   26::213     1e-09  30%  399 aa  CCA_STRSV RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   26::213     1e-09  30%  402 aa  CCA_STRA5 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   26::213     1e-09  30%  402 aa  CCA_STRA3 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::204     1e-09  31%  397 aa  CCA_LACBA RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    9::194     1e-09  32%  397 aa  CCA_BACCZ RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::206     2e-09  36%  414 aa  CCA_BUCAT RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::206     2e-09  36%  414 aa  CCA_BUCAI RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::206     2e-09  36%  414 aa  CCA_BUCA5 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    9::194     2e-09  30%  397 aa  CCA_BACCR RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    9::194     2e-09  30%  397 aa  CCA_BACC4 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::211     2e-09  29%  402 aa  CCA_STRPM RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::211     2e-09  29%  402 aa  CCA_STRPG RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::211     2e-09  29%  402 aa  CCA_STRPF RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::211     2e-09  29%  402 aa  CCA_STRPD RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::211     2e-09  29%  402 aa  CCA_STRPC RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::211     2e-09  29%  402 aa  CCA_STRPB RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::211     2e-09  29%  402 aa  CCA_STRP8 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::211     2e-09  29%  402 aa  CCA_STRP6 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::211     2e-09  29%  402 aa  CCA_STRP3 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   26::203     2e-09  30%  398 aa  CCA_LACJO RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::180     3e-09  33%  403 aa  CCA_VIBCM RecName: Full=Multifunctional CCA protein;Includes:
    1::180     3e-09  33%  403 aa  CCA_VIBCH RecName: Full=Multifunctional CCA protein;Includes:
    1::179     3e-09  35%  413 aa  CCA_NITMU RecName: Full=Multifunctional CCA protein;Includes:
   21::204     3e-09  28%  393 aa  CCA_LISMH RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::194     3e-09  29%  397 aa  CCA_BACSU RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    9::194     3e-09  32%  397 aa  CCA_BACCQ RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    9::194     3e-09  32%  397 aa  CCA_BACC7 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::180     4e-09  42%  407 aa  CCA_VIBVY RecName: Full=Multifunctional CCA protein;Includes:
    1::292     4e-09  32%  413 aa  CCA_VEREI RecName: Full=Multifunctional CCA protein;Includes:
   21::211     4e-09  29%  402 aa  CCA_STRP1 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::182     4e-09  37%  406 aa  CCA_STRM5 RecName: Full=Multifunctional CCA protein;Includes:
    1::205     4e-09  34%  412 aa  CCA_BUCAP RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    9::194     4e-09  32%  397 aa  CCA_BACHK RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    9::194     4e-09  32%  397 aa  CCA_BACC1 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    9::194     4e-09  32%  397 aa  CCA_BACC0 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    9::194     4e-09  32%  397 aa  CCA_BACAN RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    9::194     4e-09  32%  397 aa  CCA_BACAC RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    9::194     4e-09  32%  397 aa  CCA_BACAA RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   26::203     5e-09  29%  398 aa  CCA_LACGA RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    9::194     5e-09  32%  397 aa  CCA_BACC2 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::290     6e-09  30%  416 aa  CCA_SHESR RecName: Full=Multifunctional CCA protein;Includes:
    9::194     6e-09  30%  397 aa  CCA_BACC3 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::180     8e-09  35%  406 aa  CCA_VIBHB RecName: Full=Multifunctional CCA protein;Includes:
    1::180     8e-09  33%  403 aa  CCA_VIBC3 RecName: Full=Multifunctional CCA protein;Includes:
   26::211     8e-09  30%  402 aa  CCA_STRTD RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   26::211     8e-09  30%  402 aa  CCA_STRT2 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   26::211     8e-09  30%  402 aa  CCA_STRT1 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::182     8e-09  35%  406 aa  CCA_STRMK RecName: Full=Multifunctional CCA protein;Includes:
   16::209     8e-09  30%  404 aa  CCA_GEOSW RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::288     8e-09  29%  412 aa  CCA_DECAR RecName: Full=Multifunctional CCA protein;Includes:
    4::186     8e-09  33%  417 aa  CCA_BURP8 RecName: Full=Multifunctional CCA protein;Includes:
    1::182     1e-08  33%  410 aa  CCA_XANOM RecName: Full=Multifunctional CCA protein;Includes:
   24::229     1e-08  30%  400 aa  CCA_OCEIH RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::180     1e-08  41%  407 aa  CCA_VIBVU RecName: Full=Multifunctional CCA protein;Includes:
    1::296     1e-08  29%  416 aa  CCA_HAEIE RecName: Full=Multifunctional CCA protein;Includes:
    1::287     1e-08  30%  407 aa  CCA_CHRVO RecName: Full=Multifunctional CCA protein;Includes:
    1::178     1e-08  32%  411 aa  CCA_BLOFL RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::296     2e-08  29%  416 aa  CCA_HAEIN RecName: Full=Multifunctional CCA protein;Includes:
    1::296     2e-08  29%  416 aa  CCA_HAEIG RecName: Full=Multifunctional CCA protein;Includes:
   26::218     2e-08  33%  398 aa  CCA_LACLA RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::290     3e-08  26%  413 aa  CCA_SHEDO RecName: Full=Multifunctional CCA protein;Includes:
    1::181     3e-08  40%  373 aa  CCA_MARAV RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::180     3e-08  36%  414 aa  CCA_HERAR RecName: Full=Multifunctional CCA protein;Includes:
    9::194     4e-08  31%  397 aa  CCA_BACWK RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::290     5e-08  27%  416 aa  CCA_SHESA RecName: Full=Multifunctional CCA protein;Includes:
    1::295     5e-08  30%  420 aa  CCA_PASMU RecName: Full=Multifunctional CCA protein;Includes:
   21::207     5e-08  28%  396 aa  CCA_LACDB RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::207     5e-08  28%  396 aa  CCA_LACDA RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::209     5e-08  28%  404 aa  CCA_GEOKA RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   16::194     7e-08  33%  376 aa  CCA_COXBU RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   16::194     7e-08  33%  376 aa  CCA_COXBR RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   16::209     7e-08  32%  404 aa  CCA_BACST RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   44::237     9e-08  31%  452 aa  PCNB_HAEIN RecName: Full=Probable poly(A) polymerase;       
   17::200     9e-08  26%  400 aa  CCA_STAES RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   17::200     9e-08  26%  400 aa  CCA_STAEQ RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    4::177     9e-08  34%  369 aa  CCA_FRATN RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   16::194     9e-08  33%  376 aa  CCA_COXBN RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::290     1e-07  27%  416 aa  CCA_SHEB9 RecName: Full=Multifunctional CCA protein;Includes:
    1::290     1e-07  27%  416 aa  CCA_SHEB8 RecName: Full=Multifunctional CCA protein;Includes:
    1::290     1e-07  27%  416 aa  CCA_SHEB5 RecName: Full=Multifunctional CCA protein;Includes:
   26::209     2e-07  29%  397 aa  CCA_LACSS RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::226     2e-07  29%  404 aa  CCA_LACS1 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::288     2e-07  33%  415 aa  CCA_SODGM RecName: Full=Multifunctional CCA protein;Includes:
    1::290     2e-07  32%  407 aa  CCA_ERWT9 RecName: Full=Multifunctional CCA protein;Includes:
    1::182     3e-07  32%  410 aa  CCA_XANAC RecName: Full=Multifunctional CCA protein;Includes:
   26::207     3e-07  31%  407 aa  CCA_LACPL RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   22::204     3e-07  29%  399 aa  CCA_LACAC RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   12::191     3e-07  39%  364 aa  CCA_BORPA RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   12::191     3e-07  39%  364 aa  CCA_BORBR RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::204     3e-07  29%  403 aa  CCA_LACRJ RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::204     3e-07  29%  403 aa  CCA_LACRD RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::182     6e-07  30%  410 aa  CCA_XANC5 RecName: Full=Multifunctional CCA protein;Includes:
   17::205     6e-07  27%  400 aa  CCA_STAAB RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   16::195     6e-07  28%  396 aa  CCA_PEDPA RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::199     6e-07  28%  404 aa  CCA_GEOTN RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    4::177     6e-07  33%  360 aa  CCA_FRATT RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    4::177     6e-07  33%  360 aa  CCA_FRAT1 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::180     8e-07  35%  411 aa  CCA_METFK RecName: Full=Multifunctional CCA protein;Includes:
   12::191     8e-07  38%  364 aa  CCA_BORPE RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::200     1e-06  31%  401 aa  CCA_LEUMM RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::181     1e-06  33%  412 aa  CCA_HAEDU RecName: Full=Multifunctional CCA protein;Includes:
    1::294     1e-06  27%  415 aa  CCA_CUPTR RecName: Full=Multifunctional CCA protein;Includes:
   61::242     1e-06  32%  434 aa  TRNT1_HUMAN RecName: Full=tRNA-nucleotidyltransferase 1,
    1::244     1e-06  29%  419 aa  CCA_BUCBP RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::209     1e-06  29%  397 aa  CCA_ANOFW RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   17::183     2e-06  29%  400 aa  CCA_STACT RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   17::205     2e-06  27%  400 aa  CCA_STAAR RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   17::205     2e-06  27%  400 aa  CCA_STAAN RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   17::205     2e-06  27%  400 aa  CCA_STAAM RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   17::205     2e-06  27%  400 aa  CCA_STAA1 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::182     2e-06  32%  408 aa  CCA_PSEU2 RecName: Full=Multifunctional CCA protein;Includes:
    1::289     2e-06  29%  406 aa  CCA_NITOC RecName: Full=Multifunctional CCA protein;Includes:
   21::204     2e-06  28%  400 aa  CCA_BACP2 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   22::200     2e-06  28%  399 aa  CCA_STAS1 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   17::205     2e-06  27%  400 aa  CCA_STAAW RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   17::205     2e-06  27%  400 aa  CCA_STAAT RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   17::205     2e-06  27%  400 aa  CCA_STAAS RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   17::205     2e-06  27%  400 aa  CCA_STAAE RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   17::205     2e-06  27%  400 aa  CCA_STAAC RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::290     4e-06  27%  414 aa  CCA_SHEFN RecName: Full=Multifunctional CCA protein;Includes:
    1::290     5e-06  32%  407 aa  CCA_PROMH RecName: Full=Multifunctional CCA protein;Includes:
   81::191     5e-06  35%  425 aa  CCA_METCA RecName: Full=Multifunctional CCA protein;Includes:
    1::181     5e-06  39%  414 aa  CCA_BUCCC RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   21::194     5e-06  28%  397 aa  CCA_BACLD RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::182     6e-06  30%  409 aa  CCA_PSESM RecName: Full=Multifunctional CCA protein;Includes:
  146::277     8e-06  31%  465 aa  PCNB_SALTI RecName: Full=Poly(A) polymerase;         Short=PAP;    
    1::178     8e-06  31%  408 aa  CCA_BLOPB RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
  131::294     1e-05  32%  415 aa  CCA_RALEJ RecName: Full=Multifunctional CCA protein;Includes:
    1::290     1e-05  31%  407 aa  CCA_VIBF1 RecName: Full=Multifunctional CCA protein;Includes:
    1::292     1e-05  27%  418 aa  CCA_AZOVD RecName: Full=Multifunctional CCA protein;Includes:
  146::277     2e-05  32%  465 aa  PCNB_SALTY RecName: Full=Poly(A) polymerase;         Short=PAP;    
   21::125     2e-05  35%  400 aa  CCA_LACF3 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   26::200     2e-05  29%  398 aa  CCA_LACCB RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
   26::200     2e-05  29%  398 aa  CCA_LACC3 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::289     3e-05  33%  414 aa  CCA_EDWI9 RecName: Full=Multifunctional CCA protein;Includes:
   21::194     3e-05  27%  396 aa  CCA_BACA2 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::182     5e-05  30%  409 aa  CCA_PSE14 RecName: Full=Multifunctional CCA protein;Includes:
    1::180     5e-05  34%  405 aa  CCA_HAMD5 RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    4::186     5e-05  29%  410 aa  CCA_BURPP RecName: Full=Multifunctional CCA protein;Includes:
   61::242     7e-05  29%  434 aa  TRNT1_MOUSE RecName: Full=tRNA-nucleotidyltransferase 1,
    4::186     9e-05  28%  413 aa  CCA_BURCJ RecName: Full=Multifunctional CCA protein;Includes:
    4::186     9e-05  28%  413 aa  CCA_BURCH RecName: Full=Multifunctional CCA protein;Includes:
    4::186     9e-05  28%  413 aa  CCA_BURCA RecName: Full=Multifunctional CCA protein;Includes:
    4::186     1e-04  29%  413 aa  CCA_BURCC RecName: Full=Multifunctional CCA protein;Includes:
  146::249     2e-04  31%  465 aa  PCNB_ECOLI RecName: Full=Poly(A) polymerase;         Short=PAP;    
  146::249     2e-04  31%  465 aa  PCNB_ECOL6 RecName: Full=Poly(A) polymerase;         Short=PAP;    
  146::249     2e-04  31%  465 aa  PCNB_ECO57 RecName: Full=Poly(A) polymerase;         Short=PAP;    
    1::300     2e-04  28%  424 aa  CCA_POLNA RecName: Full=Multifunctional CCA protein;Includes:
  385::563     3e-04  31%  912 aa  GLND_NOVAD RecName: Full=[Protein-PII] uridylyltransferase;        
    4::186     3e-04  27%  413 aa  CCA_BURVG RecName: Full=Multifunctional CCA protein;Includes:
   92::215     3e-04  36%  484 aa  CCA2_SCHPO RecName: Full=Putative tRNA nucleotidyltransferase 2;   
   65::240     3e-04  34%  546 aa  CCA1_YEAST RecName: Full=tRNA nucleotidyltransferase,
    1::192     4e-04  30%  403 aa  CCA_WIGBR RecName: Full=CCA-adding enzyme;         EC=2.7.7.25;    
    1::472

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSTISMLSQQLSIQTYLVGGAVRDLFLNKIPVDLDFCVTAKVFALAQTLTQQYQGSLVTLDDQREMLRVV
CCA_THICR       ------------MKTYLVGGAVRDALLNIPVYDHDWVVVGATDMLEQGFSQVGKDFPVFLKEEYALARTE
CCA_NEIMF       ------------MQTYLVGGAVRDYLLGLPVKDRDWVV---VGADAQTMLAQHEEYTLARTERKTAKGYV
CCA_NEIMB       ------------MQTYLVGGAVRDYLLGLPVKDRDWVV---VGADAQTMLAQHEEYALARTERKTAKGYV
CCA_NEIMA       ------------MQTYLVGGAVRDYLLGLPVKDRDWVV---VGADAQTMLAQHEEYALARTERKTAKGYV
CCA_NEIM0       ------------MQTYLVGGAVRDYLLGLPVKDRDWVV---VGADAQTMLAQHEEYALARTERKTAKGYA
CCA_HAHCH       ------------MQRYLVGGAVRDALLGLPVKDRDWVVVGAT--PEQMLDQGYQQVGADFPEEHALARTE
CCA_NEIG2       ------------MQTYLVGGAVRDYLLGLPVKDRDWVV---VGADAQTMLAQHEEYALARTERKTAKGYA
CCA_NEIG1       ------------MQTYLVGGAVRDYLLGLPVKDRDWVV---VGADAQTMLAQHEEYALARTERKTAKGYA
CCA_BACHD       LSIVSELRDH-GFEAYIVGGAVRDYHIGRKPKDVDVVTSASPEEIRTLYPHAFQ-----INRQFQTLTVH
CCA_STAHJ       --------EQHGFEAYFVGGSVRDYLMNRHIHDIDITTSAKTIPIGRTINVVYQGTNYEVTTFRAEAEYV
CCA_SHEB2       ------------MKIYLVGGAVRDSLLNLPIKDKDYLVVGATPEQMLQLGYRQVGKLHPKNQQEYALART
CCA_TERTT       ------------MKIYLVGGAVRDQLLGQQMLDAGFKPVGKDFPVF--LHPETQEEYALARQERKTAPGY
CCA_RALME       ------------MQVYAVGGAVRDQLLGKPSQDRDYVVVGATPADMEAAGFKPVGKPVFLHPHRTERKTA
CCA_LEUCK       --------ESAGFEAYFVGGAVRDMLLNKPIHDVDIATSAKALFTKTVDTGIQHGTVMVLDDGYEITTFR
CCA_XYLFT       ------------MKSYLVGGAVRDALLGQPAGDCDWVVTGEEFALARTERKNYRGFIVNADP------TV
CCA_XYLF2       ------------MKSYLVGGAVRDALLGQPAGDCDWVVTGEEFALARTERKNYRGFIVNADP------TV
CCA_STRU0       --------KEAGFEAYFVGGGVRDILLDRPIHDVDIATTKAIFSRTVDIGIEHGTVLVLENDEYEITTFR
CCA_BAUCH       ------------MKKYLVGGAVRDRLL-QIPVERDWVVIGTTLQDMLKAGYQQVGKDFPVHEEYALARIE
CCA_XYLFM       ------------MKSYLVGGAVRDALLGQPAGDCDWVVTGEEFALARTERKNYRGFIVNADP------TV
CCA_ACTP7       ------------MQIYLVGGAVRDQLLNLPVKDRDYLVVGA--TPEQLLAQGYQKEEYALARQERKNGVG
CCA_ACTP2       ------------MQIYLVGGAVRDQLLNLPVKDRDYLVVGA--TPEQLLAQGYQKEEYALARQERKNGVG
CCA_STRR6       --------KEAGFEAYFVGGSVRDALLHSPIHDVDIATTKQIFPRTADIGIEH-GTVLVLDEEYEVTTFR
CCA_STRPS       --------KEAGFEAYFVGGSVRDALLHSPIHDVDIATTKQIFPRTADIGIEH-GTVLVLDEEYEVTTFR
CCA_STRPN       --------KEAGFEAYFVGGSVRDALLHSPIHDVDIATTKQIFPRTADIGIEH-GTVLVLDEEYEVTTFR
CCA_STRP4       --------KEAGFEAYFVGGSVRDALLHNPIHDVDIATTKQIFPRTADIGIEH-GTVLVLDEEYEVTTFR
CCA_STRMU       -------------EAYFVGGSVRDVLLGHPIHDVDIASTKKIFPRTVDIGIEH-GTVLVLENGHEVTTFR
CCA_LEGPH       ------------MKVYLVGGAVRDRLLG-IPVQRDFPVTKEEYALARTERKSAPGYYGFICDFSESVT--
CCA_ENTFA       -------------EAYFVGGSVRDALLNKPIHDVDIATSAQIFKRTVDVGIEHGTVLVLMEDQQEVTTFR
CCA_AERS4       ------------MQTYLVGGAVRDRLLGLPQGDRDHLVVGQMLALGFSLHPKTQQEYALARTERKQGRGY
CCA_VARPS       ------------MKTYLVGGALRDRLLGRLPVGRDFPVTREEYALARTERKSAPGY--------------
CCA_LEGPL       ------------MKVYLVGGAVRDRLLG-IPVQRDFPVTKEEYALARTERKSAPGYYGFICDFSESVT--
CCA_AERHH       ------------MQTYLVGGAVRDRLLGLPQGDRDHLVVGQMLALGFTLHPKTQQEYALARTERKQGRGY
CCA_ACIAC       ------------MQIYMVGGAVRDRLLGRLPVGRDFPVTREEYALARTERKSGRG---------------
CCA_XYLFA       ------------MKSYLVGGAVRDALLGQPAGDCDWVVTGEEFALARTERKNYRGFIVNADP------TV
CCA_PHOPR       ------------MQTYLVGGAVRDALLGLKVVDKDWMVVGAT--PEQMLAQGYEGSLHPKTKQEYALART
CCA_STRSY       -------------EAYFVGGSVRDAILGRPIHDVDIATSSYPQETKQIFSRTIDGTVLVLEGKKEITTFR
CCA_STRS2       -------------EAYFVGGSVRDAILGRPIHDVDIATSSYPQETKQIFSRTIDGTVLVLEGKKEITTFR
CCA_LEGPA       ------------MKVYLVGGAVRDRLLG-IPVQRDFPVTKEEYALARTERKSAPGYYGFICDFSESVT--
CCA_MANSM       ------------MQTYLVGGAVRDQLLNLPVKDRDWVVVGATPEQLLSLGYQQVGRDFPVKEEYALARTE
CCA_ACISJ       ------------MQIYMVGGAVRDRLLGRLPVGRDFPVTREEYALARTERKSGRG---------------
CCA_DIAST       ------------MQIYMVGGAVRDRLLGRLPVGRDFPVTREEYALARTERKSGRG---------------
CCA_AERHY       ------------MQTYLVGGAVRDRLLGLPQGDRDHLVVGQMLALGFTLHPKTQQEYALARTERKQGRGY
CCA_RALEH       ------------MQVYAVGGAIRDELLGKPSQDRDYVVVGATPAQMEAAGYKPVGKLHPRTKEEYALART
CCA_VIBPA       ------------MQVYLVGGAVRDQLLGIDSYDNDWVVVGATMMLAQGYTAVGKDFPVFLHPKNKEEHAL
CCA_STRGC       -------------EAYFVGGSVRDALLQRPIHDVDIASTKRIFDRTVDVGIEH-GTVLVLENNREVTTFR
CCA_LISMO       -------------EAYFVGGSVRDYLLNRTISDVDIATSAFPEEVKEIFQSTYDTGIVTVRENNEFYEVT
CCA_LACLS       -------------EAYFVGGSVRDVLLGREIHDVDIATSADIFPYTIDVGIEH-GTVLVLAGKSEAEHYE
CCA_LACLM       -------------EAYFVGGSVRDVLLGREIHDVDIATSADIFPYTIDVGIEH-GTVLVLAGKSEAEHYE
CCA_BACCN       -------------EAYFVGGSVRDFIIDRPIGDIDIATSAKLFPKHVPVGLEH-GTVIVLQDG-EPYEVT
CCA_BACSK       -------------EAYIVGGAVRDYLLGKDVDDVDIATQASPHQVADIFTKG-----VHINQEHKTVLIP
CCA_XANCP       ------------MKIYLVGGAVRDALLGQPAGDRDWVVVGADQAQMQALGYKPVGKDFPVGEEYALARTE
CCA_XANCB       ------------MKIYLVGGAVRDALLGQPAGDRDWVVVGADQAQMQALGYKPVGKDFPVGEEYALARTE
CCA_XANC8       ------------MKIYLVGGAVRDALLGQPAGDRDWVVVGADQAQMQALGYKPVGKDFPVGEEYALARTE
CCA_LISW6       -------------EAYFVGGSVRDYLLCRTISDVDIATSAFPEEVKEIFPSTYDTGIVTVRENKECYEVT
CCA_LISMF       -------------EAYFVGGSVRDYLLNRTISDVDIATSAFPEEVKEIFQTSYDTGIVTVRENNEFYEVT
CCA_LISMC       -------------EAYFVGGSVRDYLLNRTISDVDIATSAFPEEVKEIFQTSYDTGIVTVRENNEFYEVT
CCA_LISIN       -------------EAYFVGGSVRDYLLNRPISDVDIATSAFPEEVKEIFQSTYDTGIVTVRENKECYEVT
CCA_ALTMD       ------------MQVYLVGGAVRDALLNRKVIERDYVVVGATEMLSQGFTQVGKDFPVFLQEEYALARTE
CCA_ACTSZ       ---------------YLVGGAVRDQLLHLPVKDRDWLVVGELLSLGYLQVGKDFPVFIHPETHEEYALAR
CCA_THISH       ------------MKTYLVGGAVRDELLGLPVRERDWVVVGATAAQMLDLGYRQVGR-----DFPVFLHPE
CCA_STRSV       -------------EAYFVGGSVRDALLQRPIHDVDIASTKRIFDRTVDVGIEH-GTVLVLENNREVTTFR
CCA_STRA5       -------------EAYFVGGSVRDVLLDRPIHDVDIATTKQIFKRTVDVGIEH-GTVLVLEKEYEITTFR
CCA_STRA3       -------------EAYFVGGSVRDVLLDRPIHDVDIATTKQIFKRTVDVGIEH-GTVLVLEKEYEITTFR
CCA_LACBA       --------EQAGYEAYFVGGSVRDTILGKEIHDVDIATSAYPDEIKHLFKRTVDGTVMILDHGTETTTFR
CCA_BACCZ       -SIIETLKQQ-GHEAYFVGGSVRDLIIDRPIGDIDIATSAEVMAIRHVPVGLEHGTVIVVENGEEVTTFR
CCA_BUCAT       ------------MKIYLVGGAVRDSLLNLPVKDKDWVVTEKIL-LERNFQQVGKDFPVFLHPERKERKSG
CCA_BUCAI       ------------MKIYLVGGAVRDSLLNLPVKDKDWVVTEKIL-LERNFQQVGKDFPVFLHPERKERKSG
CCA_BUCA5       ------------MKIYLVGGAVRDSLLNLPVKDKDWVVTEKIL-LERNFQQVGKDFPVFLHPERKERKSG
CCA_BACCR       -SIIETLKQQ-GHEAYFVGGSVRDLIIDRPIGDIDIATSAEVMAIPRNVPVGLEHGTVIVVENGEPYEVT
CCA_BACC4       -SIIETLKQQ-GHEAYFVGGSVRDLIIDRPIGDIDIATSAEVMAIPRNVPVGLEHGTVIVVENGEPYEVT
CCA_STRPM       --------KEAGYEAYFVGGSVRDVLLERPIHDVDIATTKAIFNRTVDVGIEH-GTVLVLENEYEITTFR
CCA_STRPG       --------KEAGYEAYFVGGSVRDVLLERPIHDVDIATTKAIFNRTVDVGIEH-GTVLVLENEYEITTFR
CCA_STRPF       --------KEAGYEAYFVGGSVRDVLLERPIHDVDIATTKAIFNRTVDVGIEH-GTVLVLENEYEITTFR
CCA_STRPD       --------KEAGYEAYFVGGSVRDVLLGRPIHDVDIATTKAIFNRTVDVGIEH-GTVLVLENEYEITTFR
CCA_STRPC       --------KEAGYEAYFVGGSVRDVLLERPIHDVDIATTKAIFNRTVDVGIEH-GTVLVLENEYEITTFR
CCA_STRPB       --------KEAGYEAYFVGGSVRDVLLERPIHDVDIATTKAIFNRTVDVGIEH-GTVLVLENEYEITTFR
CCA_STRP8       --------KEAGYEAYFVGGSVRDVLLERPIHDVDIATTKAIFNRTVDVGIEH-GTVLVLENEYEITTFR
CCA_STRP6       --------KEAGYEAYFVGGSVRDVLLERPIHDVDIATTKAIFNRTVDVGIEH-GTVLVLENEYEITTFR
CCA_STRP3       --------KEAGYEAYFVGGSVRDVLLERPIHDVDIATTKAIFNRTVDVGIEH-GTVLVLENEYEITTFR
CCA_LACJO       -------------EAYFVGGSVRDLLLNRHIHDVDIATSAYPMEIKQTIDTGIKHGTVTVLYEGESYEIT
CCA_VIBCM       ------------MQIYLVGGAVRDQLLQLPVYDRDWVVVAMLAAGFQAVGKDFPVFLHPNSKEEHALART
CCA_VIBCH       ------------MQIYLVGGAVRDQLLQLPVYDRDWVVVAMLAAGFQAVGKDFPVFLHPNSKEEHALART
CCA_NITMU       ------------MKTYLVGGSVRDEILGLPVTDHDYVVVGKDFPVF--LHPQSQEQYALARTERKVSRGY
CCA_LISMH       -------------EAYFVGGSVRDYLLNRTISDVDIATSAFPEEVKEIFQTSYDTGIVTVRENNEFYEVT
CCA_BACSU       -------------QAYFVGGAVRDSYMKRTIGDVDIATDARLFQRTVDVGKEH-GTIIVLDETYEVTTFR
CCA_BACCQ       -SIIETLKQQ-GHEAYFVGGSVRDLIIDRPIGDIDIATSAEVMAIRHVPVGLEHGTVIVVENGEEVTTFR
CCA_BACC7       -SIIETLKQQ-GHEAYFVGGSVRDLIIDRPIGDIDIATSAEVMAIRHVPVGLEHGTVIVVENGEEVTTFR
CCA_VIBVY       ------------MEVYLVGGAVRDKLLGYSPVGKDFPVTKQEYALARTERKTGQGY--------------
CCA_VEREI       ------------MQIYMVGGAVRDRLLGRPVHDRDWVVVG-----ATPEQMRAQGYLPVGRDFPVFLHPA
CCA_STRP1       --------KEAGYEAYFVGGSVRDVLLERPIHDVDIATTKAIFNRTVDVGIEH-GTVLVLENEYEITTFR
CCA_STRM5       ------------MKIYLVGGAVRDRLLQRPAGDRDWVVVGA--TPAQMEAQGY--SAVGRDEEYALARTE
CCA_BUCAP       ------------MKVYLVGGAVRDSLLNLPIKDRDWVIVTKEILLKKNFQQVGKDFPVFLHEEYSLARKE
CCA_BACHK       -SIIETLKQQ-GHEAYFVGGSVRDLIIDRPIGDIDIATSAEVMAIRHVPVGLEHGTVIVVENGEEVTTFR
CCA_BACC1       -SIIETLKQQ-GHEAYFVGGSVRDLIIDRPIGDIDIATSAEVMAIRHVPVGLEHGTVIVVENGEEVTTFR
CCA_BACC0       -SIIETLKQQ-GHEAYFVGGSVRDLIIDRPIGDIDIATSAEVMAIRHVPVGLEHGTVIVVENGEEVTTFR
CCA_BACAN       -SIIETLKQQ-GHEAYFVGGSVRDLIIDRPIGDIDIATSAEVMAIRHVPVGLEHGTVIVVENGEEVTTFR
CCA_BACAC       -SIIETLKQQ-GHEAYFVGGSVRDLIIDRPIGDIDIATSAEVMAIRHVPVGLEHGTVIVVENGEEVTTFR
CCA_BACAA       -SIIETLKQQ-GHEAYFVGGSVRDLIIDRPIGDIDIATSAEVMAIRHVPVGLEHGTVIVVENGEEVTTFR
CCA_LACGA       -------------EAYFVGGSVRDLLLNRHIHDVDIATSAYPMEIKQTIDTGIKHGTVTVLYEGESYEIT
CCA_BACC2       -SIIETLKQQ-GHEAYFVGGSVRDLIIDRPIGDIDIATSAEVMAIRNVPVGLEHGTVIVLENGEEVTTFR
CCA_SHESR       ------------MKIYLVGGAVRDSLLNLPIKDKDFMVVGATPEQMQQLGYRQVGKLHPKTQQEYALART
CCA_BACC3       -SIIETLKQQ-GHEAYFVGGSVRDLIIDRPIGDIDIATSALPEEVMGIFPRHVHGTVIVVENGEEVTTFR
CCA_VIBHB       ------------MQVYLVGGAVRDHLLGIDIYDRDWVVVGATIMLSQGYTAVGKDFPVFLHEEHALARTE
CCA_VIBC3       ------------MQIYLVGGAVRDQLLQLPVYDRDWVVVAMLAAGFQAVGKDFPVFLHPNSKEEHALART
CCA_STRTD       -------------EAYFVGGSVRDALLNRPIHDVDIASTKQIFERTVDIGIEH-GTVLVLENEYEVTTFR
CCA_STRT2       -------------EAYFVGGSVRDALLNRPIHDVDIASTKQIFERTVDIGIEH-GTVLVLENEYEVTTFR
CCA_STRT1       -------------EAYFVGGSVRDALLNRPIHDVDIASTKQIFERTVDIGIEH-GTVLVLENEYEVTTFR
CCA_STRMK       ------------MKIYLVGGAVRDRLLQRPAGDHDWVVVGATPAQAQGYTAVGRDFPVFLGEEYALARTE
CCA_GEOSW       --------QQHGYEAYFVGGAVRDLLLNREIGDIDIATS----ALPDEVMQLFP-KTIDIGSQHGTVVVV
CCA_DECAR       ------------MQIYIVGGAVRDELLGRPNADCDYVVVGATTMLAQGFRPVGKDFPVFLHDEYALARTE
CCA_BURP8       ---------------YAVGGAIRDELLGMPVQDRDYVVVGATQMIAQGFRPVGKDFPVFLDTQEEYARKT
CCA_XANOM       ------------MKIYLVGGAVRDALLGQPAGDRDWVVVGADQARMEAQGFKPVGKDFPVGEEYALARTE
CCA_OCEIH       ---------------YFVGGCVRDLLLQKDIHDIDIATSATMHLFKKVIPVGIEHGTVIVRHGGESYEVT
CCA_VIBVU       ------------MEVYLVGGAVRDKLLGYSPVGKDFPVTKQEYALARTERKTGQGY--------------
CCA_HAEIE       ------------MKIYLVGGAVRDQLLGLPVKDRDWIVVGADHATLLSLGYQQVGKDFPVKEEYALARTE
CCA_CHRVO       ------------MEIYIVGGAVRDRLLGLPVKDRDWVVVGSTEMLAQGYRPVGKDFPVFLETQEEYARKI
CCA_BLOFL       ------------MKKYLVGGAVRDSLLNLPITEKDWVITGSSAQEMLSIGYEQVG--------KDFPVFL
CCA_HAEIN       ------------MKVYLVGGAVRDQLLGLPVKDRDWIVVGADPATLLSLGYQQVGKDFPVKEEYALARTE
CCA_HAEIG       ------------MKIYLVGGAVRDQLLGLPVKDRDWIVVGADPATLLSLGYQQVGKDFPVKEEYALARTE
CCA_LACLA       -------------EAYFVGGSVRDILLGREIHDVDIATSADIFPYTIDVGIEH-GTVLVLAGKSEAEHYE
CCA_SHEDO       ------------MKIYLVGGAVRDALLGLTIKDKDYLVVGSTPAEMLSLGYRQVGKLHPKNQQEYALARI
CCA_MARAV       ------------MQTYLVGGAVRDKLLGLGVKDRDWVVTGEEYALARTERKQGRGY--------------
CCA_HERAR       ------------MKIYIVGGAVRDELLGVAVKDRDYVVVGA--TPEQMIAQNY---TPVGKDFPVFLHPV
CCA_BACWK       -SIIEMLKQH-GHEAYFVGGSVRDLIIDRPIGDIDIATSAEVMAIRHVPVGLEHGTVIVVEEPYEVTTFR
CCA_SHESA       ------------MKIYLVGGAVRDSLLNLPIKDKDFMVVGATPEQMQQLGYRQVGKLHPKTQQEYALART
CCA_PASMU       ------------MKIYLVGGAVRDQLLNLVVKDRDWVVVGATDLLSQGYQQVGKDFPVFLHPQTKEEYAL
CCA_LACDB       --------EEAGFEAYFVGGCVRDLLLERPIHDVDIATSAYPEEVKETFAKSLHGTVTVLGSSYEITTFR
CCA_LACDA       --------EEAGFEAYFVGGCVRDLLLERPIHDVDIATSAYPEEVKETFAKSIQHGTVTVGSSYEITTFR
CCA_GEOKA       -------------EAYFVGGAVRDLLIGRAIGDVDIATSAEVMRLPKTIDVGSKHGTVVVVHEGTAYEVT
CCA_COXBU       ------------LKVYLVGGAVRDQLLGLPVKEKDWVVTARGF---KPVGKEFPVFLHPETHEEYALKVA
CCA_COXBR       ------------LKVYLVGGAVRDQLLGLPVKEKDWVVTARGF---KPVGKEFPVFLHPETHEEYALKVA
CCA_BACST       --------KQHGYDAYFVGGAVRDLLLGRPIGDVDIATSADVMAIPKTIDXXXXXXXXXXXXXXXAYEVT
PCNB_HAEIN      --------QRQGFEAYIVGGCIRDLLLGKKPKDFDVATNARPEQIQNIFQRQRRFRLAHIMFGRDIIEVA
CCA_STAES       --------QNKGFKAYFVGGSVRDYIMQRPIHDVDITTSASIFDKTIPVGKEHGTNVVFQNDNYEITTFR
CCA_STAEQ       --------QNKGFKAYFVGGSVRDYIMQRPIHDVDITTSASIFDKTIPVGKEHGTNVVFQNDNYEITTFR
CCA_FRATN       ---------------YLVGGAVRDMLLGITPKDKDWVVVGATEMLANGFIKIAANFPVFIHPQTKQEKKT
CCA_COXBN       ------------LKVYLVGGAVRDQLLGLPVKEKDWVVTARGF---KPVGKEFPVFLHPETHEEYALKVA
CCA_SHEB9       ------------MKIYLVGGAVRDSLLNLPIKDKDYLVVGATPEQMLQLGYRQVGKLHPKNQQEYALART
CCA_SHEB8       ------------MKIYLVGGAVRDSLLNLPIKDKDYLVVGATPEQMLQLGYRQVGKLHPKNQQEYALART
CCA_SHEB5       ------------MKIYLVGGAVRDSLLNLPIKDKDYLVVGATPEQMLQLGYRQVGKLHPKNQQEYALART
CCA_LACSS       -------------EAYFVGGSVRDNLLGLPIHDVDIATSAYPAEIKQIFTGIQHGTVMILDHGNEVTTFR
CCA_LACS1       --------REAGFEAYFVGGSVRDTLLGLPIHDVDIASSAYPEEIKQIFSKTVDGTVMVLDHGTEITTFR
CCA_SODGM       ------------MKKYLVGGAVRDGLLQLPVKERDWVVVGAT--PQEMLAQGYQHPVFLHPDSREEYALA
CCA_ERWT9       ------------MKTYLVGGAVRDGLLNLPVKDKDWVVVGA--SPQQMLDRGYQ------QVGRDFPVFL
CCA_XANAC       ------------MKIYLVGGAVRDALLEQPAGDRDWVVVGADQAQMEAQGFKPVGKDFPVGEEYALARTE
CCA_LACPL       -------------EAYFVGGCVRDTILGKPLHDVDIATSAFPAEVKQLFTGIEHGTVMILDNGYETTTFR
CCA_LACAC       --------EDAGFEAYFVGGSVRDVLLDRHVHDIDITTSAYPEEVKETVTVLYEG------ESYEITTFR
CCA_BORPA       ------------LQVYIVGGAVRDGLLGLIPVGGDFPVTKEEYALARTERKSGRGYK-------------
CCA_BORBR       ------------LQVYIVGGAVRDGLLGLIPVGGDFPVTKEEYALARTERKSGRGYK-------------
CCA_LACRJ       --------EEAGYEAYFVGGCVRDTILHDEIHDIDIATSAKAIFNHTVDTGIEHGTVMILDHGTETTTFR
CCA_LACRD       --------EEAGYEAYFVGGCVRDTILHDEIHDIDIATSAKAIFNHTVDTGIEHGTVMILDHGTETTTFR
CCA_XANC5       ------------MKIYLVGGAVRDALLEQPAGDRDWVVVGADQAQMEAQGFKPVGKDFPVGEEYALARTE
CCA_STAAB       --------QDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT-----IPVGKEHGTINVV
CCA_PEDPA       --------EDAGFDAFFVGGSVRDTLLNKPIHDVDIASSAYPAEIKHIFTGIEHGTVMVIHDGEEVTTFR
CCA_GEOTN       -------------EAYFVGGAVRDLLLGRPIGDVDIATSAEVMAIPKTIDVGSKHGTVVVVHEGTAYEVT
CCA_FRATT       ---------------YLVGGAVRDMLLGITPKDKDWVVVGATEMLANGFIKIAANFPVFIHPQTKQEYAL
CCA_FRAT1       ---------------YLVGGAVRDMLLGITPKDKDWVVVGATEMLANGFIKIAANFPVFIHPQTKQEYAL
CCA_METFK       ------------MRIYTVGGAVRDRLLGLPVKDRDHVVVGSTPEAMVQLGYRPVGK-----DFPVFLHPV
CCA_BORPE       ------------LRVYIVGGAVRDDLLGLIPVGGDFPVTKEEYALARTERKSGRGYK-------------
CCA_LEUMM       --------EDAGFEAYFVGGSVRDTMLGKTIHDVDIASSAEVKSLFHNTTGIQHGTVMVLDHGTEITTFR
CCA_HAEDU       ------------MQIYLVGGAVRDQLLNLPIKDRDFLVVGAT--AKELINQGYQQQEYALARQERKSGTG
CCA_CUPTR       ------------MQVYAVGGAIRDELLGKPSQDRDYVVVGATPAEMEAAGYRPVGKLHPRTQEEYALART
TRNT1_HUMAN     ----------------IAGGAVRDLLNGVKPQDIDFATT----ATPTQMKEMFQSAGIRMINNREKHGTI
CCA_BUCBP       ------------MKVYLVGGAIRNKFLNLPVQDRDWVVVGATPEILLSLKFKQVGSLARVD---RKIGVG
CCA_ANOFW       -------------EAYFVGGAVRDYLLQRPIGDIDIATSAEVMAIPRTVPVGIAHGTVMVIERGISYEVT
CCA_STACT       --------QDNGYEAYYVGGAVRDYLMDRPIHDIDITTSASPDEIEGIFT-----NTIPIGKEHGTINVV
CCA_STAAR       --------QDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT-----IPVGKEHGTINVV
CCA_STAAN       --------QDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT-----IPVGKEHGTINVV
CCA_STAAM       --------QDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT-----IPVGKEHGTINVV
CCA_STAA1       --------QDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT-----IPVGKEHGTINVV
CCA_PSEU2       ------------MQIYKVGGAVRDRLLGQPVTDIDWVVVG-----ASTEDMLIKGYRPVGTDFPVFLHPL
CCA_NITOC       ------------MEVYLVGGAVRDKLLGRPVKERDYVVTTPANLLAQGYRPVGKDFPVFLHPQTQEEYAL
CCA_BACP2       -------------QAYFVGGAVRDVLLGR-EIGXXXXXXXXXXXXVESLFEKTHGTVIVLHDSYEVTTFR
CCA_STAS1       -------------QAYFVGGSVRDYLMNRPIHDIDITTSATPDEIEKTIPIGREHGTINVIYKGEQYEVT
CCA_STAAW       --------QDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT-----IPVGKEHGTINVV
CCA_STAAT       --------QDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT-----IPVGKEHGTINVV
CCA_STAAS       --------QDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT-----IPVGKEHGTINVV
CCA_STAAE       --------QDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT-----IPVGKEHGTINVV
CCA_STAAC       --------QDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT-----IPVGKEHGTINVV
CCA_SHEFN       ------------MKIYLVGGAVRDTLLKQTVVDKDYVVVGEMLALGQQVGKDFPVFLHPKTQQEYALART
CCA_PROMH       ------------MKIYLVGGAVRDQLLNLPVKDRDWVV---VGATPETLLQQYQQVFLHPDTHEEYALAR
CCA_METCA       ----------------------------------------------------------------------
CCA_BUCCC       ------------MKIYLVGGAIRDRLLN-IPVDRDWVVVG-IRDPKEMLKKNYQGFPVFIHEEYSLARVG
CCA_BACLD       -------------QAYFVGGAVRDAQMNRDVGDIDIATDASIFPKTVDVGKEH-GTIIVL-FEGESYEVT
CCA_PSESM       ------------MQIYKVGGAVRDRLLGQPVTDIDWVVVG-----ASTEDMLVKGYRPVGTDFPVFLHPL
PCNB_SALTI      ----------------------------------------------------------------------
CCA_BLOPB       ------------MEKYLVGGAVRDALL-KLPVEKDWVVVGSSPQEMLNIGYEQVG--------KDFPVFL
CCA_RALEJ       ----------------------------------------------------------------------
CCA_VIBF1       ------------MKIYLVGGAVRDSLLNIDVKDKDWVVVGKMDSLGQTVGQDFPVFLNPKTKEEYALART
CCA_AZOVD       ------------MRIYKVGGAVRDRLLGRPVSEVDWVVVGASAEELLALGYRPVGADFPVGEEYALARTE
PCNB_SALTY      ----------------------------------------------------------------------
CCA_LACF3       --------EEAGFEAYFVGGCVRDTILNLPIHDIDIATSAYPAEIKQIFSRTVHGTVMILDHGTETTTFR
CCA_LACCB       -------------EAYFVGGSVRDAILGLPIHDVDIASSAYPAEIKRIFTGIEHGTVMVLDHGTEVTTFR
CCA_LACC3       -------------EAYFVGGSVRDAILGLPIHDVDIASSAYPAEIKRIFTGIEHGTVMVLDHGTEVTTFR
CCA_EDWI9       ------------MKTYLVGGAVRDKYLQLPTQDRDWVVVAPQTLLAQGYQQVGKDFPVFLHPRSKEEYAL
CCA_BACA2       -------------QAYFVGGAVRDSYMKRKIGDVDIATSARLFKRTVDVGKEH-GTVIVLDETYEVTTFR
CCA_PSE14       ------------MQIYKVGGAVRDRLLGQPVTDIDWVVVG-----ASTEDMLVKGYRPVGTDFPVFLHPL
CCA_HAMD5       ------------MNVYLVGGAVRNRLL-KLPVERDWVVVGATPEEMLLLGYKKVGKNFPVETKEEYALAR
CCA_BURPP       ---------------YAVGGAIRDELLGVPVQDRDYVVVGAT--PEQMVAQGYRDFPVFLHPQRTERKTA
TRNT1_MOUSE     ----------------IAGGAVRDLLNGVKPQDVDFATTATPTQMKEMF---QSAGIRMINNKGEKHGTI
CCA_BURCJ       ---------------YAVGGAIRDELLGVPVQDRDYVV---VGATPEQMTAQGFRPVVFLHPQTQTERKT
CCA_BURCH       ---------------YAVGGAIRDELLGVPVQDRDYVV---VGATPEQMTAQGFRAVVFLHPQTQTERKT
CCA_BURCA       ---------------YAVGGAIRDELLGVPVQDRDYVV---VGATPEQMTAQGFRAVVFLHPQTQTERKT
CCA_BURCC       ---------------YAVGGAIRDELLGVPVQDRDYVV---VGATPEQMTAQGFRPVVFLHPQTQTERKT
PCNB_ECOLI      ----------------------------------------------------------------------
PCNB_ECOL6      ----------------------------------------------------------------------
PCNB_ECO57      ----------------------------------------------------------------------
CCA_POLNA       ------------MKIYMVGGAVRDKLLGLPVTDHDWVV---VGATPEALTAQ--GFLPVGKDEYALARTE
GLND_NOVAD      ----------------------------------------------------------------------
CCA_BURVG       ---------------YAVGGAIRDALLGVPVQDRDYVVVGATQMAAQGFRPVGKDFPVFLDTQEEYARKT
CCA2_SCHPO      ------------------------------------------------------GKLTVNPDQSKHLETA
CCA1_YEAST      ----------------ITGGWVRDKLLGQGSHDLDIAISGEQFALNEYLQQHYAKYGAKPHNIHKIDKNP
CCA_WIGBR       ------------MKKYLVGGAVRDGLLNMPIKEKDWVVVESTPEEMIKLGYKPVGKSFPVHEEHALARTE


                         .         .         *         .         .         .         .:140
query           TNSWHLDFSPLRDEILEKDLFARDFTLNAMALPVSMGINKYNWQNQIQDPTXXXXXXXXXXXRAASSSSI
CCA_THICR       RKSFEVSFDP--TVTLEDDLIRRDLTINAMA---------QDAEGQIVDPYGGQQDLADKVLRHV-SEAF
CCA_NEIMF       GFSFHAD----KDVTLEQDLMRRDLTINAMAQDAD---------GKIIDPFGGQRDLAAGILRHVSPA-F
CCA_NEIMB       GFSFHAD----KDVTLEQDLMRRDLTINAMAQDAD---------GKIIDPFGGQRDLAAGILRHVSPA-F
CCA_NEIMA       GFSFHAD----KDVTLEQDLMRRDLTINAMAQDAD---------GKIIDPFGGQRDLAAGILRHVSPA-F
CCA_NEIM0       GFSFHAD----KDVTLEQDLMRRDLTINAMAQDAG---------GKIIDPFGGQRDLAAGILRHVSPA-F
CCA_HAHCH       RKSFICDFSP--DISLEDDLLRRDLTINAMAM---------DDDGNLVDPFNGRQDLEARILRHV-SPAF
CCA_NEIG2       GFSFHAD----KDVTLEQDLMRRDLTINAMAQDAD---------GKIIDPFGGQRDLAAGILRHVSPA-F
CCA_NEIG1       GFSFHAD----KDVTLEQDLMRRDLTINAMAQDAD---------GKIIDPFGGQRDLAAGILRHVSPA-F
CCA_BACHD       LQKVAIEVSTLRGGSIEDDLCSRDFTINAMALAMN---------GDIIDPTGGKTDLENGVIRSHPEARF
CCA_STAHJ       DHRRPSEVYFVRD--LKEDLQRRDFTINAIAMDKNFNIYDY-FEGDVALNQHIIKTVGDAKER------F
CCA_SHEB2       ERKIGLGYGGFSDVTLEQDLLRRDLTINAIA---------QDEKGNLYDPFNGIEDLNARLLRHVSDAFV
CCA_TERTT       TGAFHAD----ETVTLEQDLLRRDLTINAIAMEEGTIIDPYNGKRDIETRTLRHV-----------SQAF
CCA_RALME       VGYKGFAFYTGADVTLEEDLVRRDLTINAMAQAVD---EHDNLVGPVIDPYGGQKDLAARKFRHV-SDAF
CCA_LEUCK       TESTYTDFRR-PDKVLAEDLKRRDFTINAIAMTKD---------GDIIDLFDGLTDMAQKRIRAVGDAEV
CCA_XYLFT       T--------------LEQDLQRRDFTINAIARDQTNGIDPYGGVNDLEQRVLRHI-----------SPAF
CCA_XYLF2       T--------------LEQDLQRRDFTINAIARDQTNGIDPYGGVNDLEQRVLRHI-----------SPAF
CCA_STRU0       TEDIYVDYRRPSNRSLEEDLKRRDFTVNALALDET---------GQVIDKFHGLQDLKRKELRAVGKAEF
CCA_BAUCH       KKSTGFTYKASSEITLEEDLKRRDLTINAIACDENGSIDPYNGQRDLNQRWLRHV-----------SEAF
CCA_XYLFM       T--------------LEQDLQRRDFTINAIARDQSTLIDPYGGVNDLEQRVLRHI-----------SPAF
CCA_ACTP7       YNGFLCDFSP--DVTLEQDLIRRDLTINAIAQDAS---------GQIFDPYGGKQDLANRLLRHISPAFS
CCA_ACTP2       YNGFLCDFSP--DVTLEQDLIRRDLTINAIAQDAS---------GQIFDPYGGKQDLANRLLRHISPAFS
CCA_STRR6       TEDVYVDYSFVRS--LEEDLKRRDFTVNAFALDET---------GEIVDLFHGLEDLEKQVLRAVASERF
CCA_STRPS       TEDVYVDYSFVRS--LEEDLKRRDFTVNAFALDET---------GEIVDLFHGLEDLEKQVLRAVASERF
CCA_STRPN       TEDVYVDYSFVRS--LEEDLKRRDFTVNAFALDET---------GEIVDLFHGLEDLEKQVLRAVASERF
CCA_STRP4       TEDVYVDYSFVRS--LEEDLKRRDFTVNAFALDET---------GEIVDLFHGLEDLEKQVLRAVASERF
CCA_STRMU       TEDLYVDYRRPSQRSLEEDLKRRDFTINAFALDEKANIDKFNGLVDLEQKIL----------RAVGNAAF
CCA_LEGPH       ---------------LEEDLARRDLTINAMAM---------DEQGNLIDPYQGQRDLEEKLLRHVSSAFV
CCA_ENTFA       TESTYQDFRR-PDEVLKEDLKRRDFTINALALDST---------GEIIDLFDGIEDLTNQTIRAVGNERF
CCA_AERS4       TG-FVCHASP--EVTLEQDLLRRDLTINAIA---------EDEEGRLHDPYGGIQDLEQRMLRHV-SPAF
CCA_VARPS       -RGFTVHASP--DVTLEQDLARRDLTVNAIALPAEFVGTDGRFEGKLADPFHGRRDLEHKLLRHV-TDAF
CCA_LEGPL       ---------------LEEDLARRDLTINAMAMDEQGNIDPYQGQRDLEEKLLRHV-----------SSAF
CCA_AERHH       T-GFVCHASP--EVTLEQDLLRRDLTVNAIA---------EDEAGQLHDPYGGIEDLKQRLLRHV-SPAF
CCA_ACIAC       YRGFVVDTAP--DVTLEQDLSRRDLTINAMAV---RGEDPAAW--ELVDPYGGARDLQAKLLRHV-TDAF
CCA_XYLFA       T--------------LEQDLQRRDFTINAIAHDQTNDIDPYGGVNDLEQRILRHI-----------SPAF
CCA_PHOPR       ERKSGKGYTGFPDVTLEQDLMRRDLTINAIAQEKGRLIDPYNGQQDLDNKILRHV-----------SPAF
CCA_STRSY       TEEEYVDFRRPSQRSLEEDLKRRDFTVNAFAL---------DEEAQIVDLFDGMTDLENRTLRAVGAERF
CCA_STRS2       TEEEYVDFRRPSQRSLEEDLKRRDFTVNAFAL---------DEEAQIVDLFDGMTDLENRTLRAVGAERF
CCA_LEGPA       ---------------LEEDLARRDLTINAMAMDEQGNIDPYQGQRDLEEKLLRHV-----------SPAF
CCA_MANSM       RKSFICDFSP--HISLEQDLIRRDLTINAIA---------QDNQGKFIDPYEGISDLKNRTLRHI-SPAF
CCA_ACISJ       YRGFVVQTSP--DVTLEEDLSRRDLTINAIAASAA-----WTGAEDLFDPYGGARDLQARVLRHV-TDSF
CCA_DIAST       YRGFVVQTSP--DVTLEEDLSRRDLTINAIAASAD-----WTGAEDLFDPYGGARDLQARVLRHV-TDSF
CCA_AERHY       T-GFVCHASP--EVTLEQDLLRRDLTVNAIA---------EDEEGRLHDPYGGIQDLERRVLRHV-SPAF
CCA_RALEH       ERKTAMGYKGFADVTLEDDLVRRDLTINAMARAVDA---DGNLTGPVIDPHGGQRDLAARLFRHV-SDAF
CCA_VIBPA       SGSGYTGFDCFFDPTLEEDLIRRDLTINAMAMDDS---------GQLYDPYGGQADLNNRILRHVSDAFV
CCA_STRGC       TEDVYVDYRPSKVSFLEEDLKRRDFTINALALDEN---------GQLIDLFQGLDDLENRILRAVGTPAF
CCA_LISMO       TFRTEGTYEDFRSEVLEEDLQRRDFTMNAIAMDEHFALDPFSGQEAIKNKAIKAV--------GKASERF
CCA_LACLS       ITTFHVDF--VRD--LREDLKRRDFTVNAFAC---------DFEGQIIDLFDGLTDLKERRLTAVGSARF
CCA_LACLM       ITTFHVDF--VRD--LREDLKRRDFTVNAFAC---------DFEGQIIDLFDGLTDLKERRLTAVGSARF
CCA_BACCN       TFRTESDYEDFRRRSLEEDLKRRDFTMNAIAMNEDGEIDLFGGQEAIQKREIVTVGN--------AAERF
CCA_BACSK       GEKGPIEITTYKGETLAEDLQKRDFTINALAMTET---------REVIDPYGGRQDLQKRLLRSYDAQKL
CCA_XANCP       RKSFVVDADP--SVTLEEDLLRRDFTINAIARDEASG--------EVFDPYGGVRDLQQRVLRHVGPAFV
CCA_XANCB       RKSFVVDADP--SVTLEEDLLRRDFTINAIARDEASG--------EVFDPYGGVRDLQQRVLRHVGPAFV
CCA_XANC8       RKSFVVDADP--SVTLEEDLLRRDFTINAIARDEASG--------EVFDPYGGVRDLQQRVLRHVGPAFV
CCA_LISW6       TFRTEGTYEDFRSEVLKEDLQRRDFTMNAIAMDEHF---------ELHDPFFGQLAIQNKEIKAVGKASF
CCA_LISMF       TFRTEGTYEDFRSEVLEEDLKRRDFTMNAIAMDEHFA---------LQDPFSGQLAIQNKEIKAVGKASF
CCA_LISMC       TFRTEGTYEDFRSEVLEEDLKRRDFTMNAIAMDEHFA---------LQDPFSGQLAIQNKEIKAVGKASF
CCA_LISIN       TFRTEGTYEDFRSEVLEEDLLRRDFTMNAIAMDENF---------KLHDPFSGQLAIQNKEIKAVGKASF
CCA_ALTMD       RKSGYTGFDASSSVTLEEDLLRRDLTVNAIA--------QDNLGNLI-DPYGGKKDLENHLLRHV-SEAF
CCA_ACTSZ       TEKFICDFSP--DITLEDDLIRRDLTINAIA---------QDKNGKLYDPYHGIEDLNNRLLRHISPS-F
CCA_THISH       THEEHALARTERDVTLEEDLLRRDLTINAMARDEAGGIDPFNGRADLEARLLRHV-----------SPAF
CCA_STRSV       TEDVYVDYRPSKVSFLEEDLKRRDFTINALALDEN---------GQVIDLFQGLDDLENQILRAVGTAAF
CCA_STRA5       TEEVYVDYRRPSQRSLEEDLKRRDFTVNAFAL---------NEDGEVIDLFHGLDDLDNHLLRAVASERF
CCA_STRA3       TEEVYVDYRRPSQRSLEEDLKRRDFTVNAFAL---------NEDGEVIDLFHGLDDLDNHLLRAVASERF
CCA_LACBA       SESTYTDFRR-PDQVLAEDLKRRDFTINALAMKED---------GTVIDLFDGLADLKHRQIRAVGDPQF
CCA_BACCZ       TESEYEDFSVQFVRSLEEDLKRRDFTMNAIAMTEEERIDLFAGQEAIQKREIVTV--------GTAADRF
CCA_BUCAT       KGYTGFDTDCNSDVTLEEDLIRRDLTINAIA--------QDEYGNYI-DPFQGKKDIECGLIRHVSESFI
CCA_BUCAI       KGYTGFDTDCNSDVTLEEDLIRRDLTINAIA--------QDEYGNYI-DPFQGKKDIECGLIRHVSESFI
CCA_BUCA5       KGYTGFDTDCNSDVTLEEDLIRRDLTINAIA--------QDEYGNYI-DPFQGKKDIECGLIRHVSESFI
CCA_BACCR       TFRTESEYEDFRRRSLEEDLKRRDFTMNAIAMTEEKMVDLFAGQEAIQQREIVTVGN--------AADRF
CCA_BACC4       TFRTESEYEDFRRRSLEEDLKRRDFTMNAIAMTEEKMVDLFAGQEAIQQREIVTVGN--------AADRF
CCA_STRPM       TEDVYVDYRRPSQRSLEEDLKRRDFTVNALALDEN---------GQVIDKFRGLIDLEQKRLRAVGKAEF
CCA_STRPG       TEDVYVDYRRPSQRSLEEDLKRRDFTVNALALDEN---------GQVIDKFRGLIDLKQKRLRAVGKAEF
CCA_STRPF       TEDVYVDYRRPSQRSLEEDLKRRDFTVNALALDEN---------GQVIDKFRGLIDLEQKRLRAVGKAEF
CCA_STRPD       TEDVYVDYRRPSQRSLEEDLKRRDFTVNALALDEN---------GQVIDKFRGLIDLKQKRLRAVGKAEF
CCA_STRPC       TEDVYVDYRRPSQRSLEEDLKRRDFTVNALALDEN---------GQVIDKFRGLIDLEQKRLRAVGKAEF
CCA_STRPB       TEDVYVDYRRPSQRSLEEDLKRRDFTVNALALDEN---------GQVIDKFRGLIDLEQKRLRAVGKAEF
CCA_STRP8       TEDVYVDYRRPSQRSLEEDLKRRDFTVNALALDEN---------GQVIDKFRGLIDLKQKRLRAVGKAEF
CCA_STRP6       TEDVYVDYRRPSQRSLEEDLKRRDFTVNALALDEN---------GQVIDKFRGLIDLKQKRLRAVGKAEF
CCA_STRP3       TEDVYVDYRRPSQRSLEEDLKRRDFTVNALALDEN---------GQVIDKFRGLIDLEQKRLRAVGKAEF
CCA_LACJO       TFRTESGYQDFRDHVLSEDLKRRDFTINALAMDV---------DGNIIDHFDGLGDLEKHLIRAVAENRF
CCA_VIBCM       ERKTSVGYTGFADVTLEEDLLRRDLTINAMAQDNS---------GQLIDPYGGQRDLAAKVLRHVSPAFV
CCA_VIBCH       ERKTSVGYTGFADVTLEEDLLRRDLTINAMAQDNS---------GQLIDPYGGQRDLAAKVLRHVSPAFV
CCA_NITMU       -KGFEVYASP--EVTLQEDLARRDLTINAIA--------KDEYGNII-DPFGGIADLEAGVLRHIGPA-F
CCA_LISMH       TFRTEGTYEDFRSEVLEEDLKRRDFTMNAIAMDEHFALDPFSGQLAIQNKEIKAV--------GKASERF
CCA_BACSU       TESDYVDFRRPSESSLEEDLKRRDLTINAMAMTADGKVLDYFGGKKDIDQKVIRTV-------GKPEDRF
CCA_BACCQ       TESEYEDFSVQFVRSLEEDLKRRDFTMNAIAMTEEKMVDLFAGQEAIQKREIMTVGN--------AADRF
CCA_BACC7       TESEYEDFSVQFVRSLEEDLKRRDFTMNAIAMTEEKMVDLFAGQEAIQKREIVTVGN--------AADRF
CCA_VIBVY       -KGFECFFSP--DVTLEEDLLRRDLTINAIAMD-SQGVDPYGGQQDLQDRILRHV-----------SEAF
CCA_VEREI       TRE---EYALARTETLQEDLSRRDLTINAIATSADA-----SGAGCLIDPHHGARDIAARVLRHVSTA-F
CCA_STRP1       TEDIYVDYRRPSQRSLEEDLKRRDFTVNALALDEN---------GQVIDKFRGLIDLKQKRLRAVGKAEF
CCA_STRM5       RKSFVVDADPA--VTLEEDLQRRDFTINAIACDEDTG--------TLVDPYGGVRDIEQRVLRHVGPAFV
CCA_BUCAP       RKSFHTEFS--SDVTLEEDLIRRDLTINAIA---------QDENGNYIDPFQGRKDLNLRLLRHV-SESF
CCA_BACHK       TESEYEDFSVQFVRSLEEDLKRRDFTMNAIAMTEEGEVDLFAGQEAIQKREIVTVGN--------AADRF
CCA_BACC1       TESEYEDFSVQFVRSLEEDLKRRDFTMNAIAMTEEGEVDLFAGQEAIQKREIVTVGN--------AADRF
CCA_BACC0       TESEYEDFSVQFVRSLEEDLKRRDFTMNAIAMTEEGEVDLFAGQEAIQKREIVTVGN--------AADRF
CCA_BACAN       TESEYEDFSVQFVRSLEEDLKRRDFTMNAIAMTEEGEVDLFAGQEAIQKREIVTVGN--------AADRF
CCA_BACAC       TESEYEDFSVQFVRSLEEDLKRRDFTMNAIAMTEEGEVDLFAGQEAIQKREIVTVGN--------AADRF
CCA_BACAA       TESEYEDFSVQFVRSLEEDLKRRDFTMNAIAMTEEGEVDLFAGQEAIQKREIVTVGN--------AADRF
CCA_LACGA       TFRTESGYQDFRDHVLSEDLKRRDFTINALAMGV---------DGNVIDHFDGLGDLDKHLIRAVAENRF
CCA_BACC2       TESEYEDFSVQFVRSLEEDLKRRDFTMNAIAMTEEGEVDLFAGQEAIQQREIVTVGN--------AADRF
CCA_SHESR       ERKVGLGYGGFSDVTLEQDLLRRDLTINAIA---------QDEAGNLHDPFHGIADIEARQLRHVSAAFS
CCA_BACC3       TESEYEDFSVQFVRSLEEDLKRRDFTMNAIAMTEEGEVDLFAGQEAIQKREIVTVGN--------AADRF
CCA_VIBHB       RKSGYTGFECFFDQTLEEDLIRRDLTINAMAM---------DEDGNLYDPYGGQKDIDAKVLRHVSQAFV
CCA_VIBC3       ERKTGVGYTGFADVSLEDDLLRRDLTINAMAQDNS---------GQLIDPYGGQRDLAAKVLRHVSPAFV
CCA_STRTD       TEDVYVDYSVSFVRSLEEDLKRRDFTVNAFALNENAEIDKFNGLADLDNRVLRAV--------GKAEERF
CCA_STRT2       TEDVYVDYSVSFVRSLEEDLKRRDFTVNAFALNENAEIDKFNGLADLDNRVLRAV--------GKAEERF
CCA_STRT1       TEDVYVDYSVSFVRSLEEDLKRRDFTVNAFALNENAEIDKFNGLADLDNRVLRAV--------GKAEERF
CCA_STRMK       RKSFVVDADP--GVTLEEDLQRRDFTINAIACDEETG--------TLVDPYGGVRDIEQRVLRHVGPAFV
CCA_GEOSW       HNGISYEVTTFRTESLYEDLQRRDFTMNAIAMDAGKLIDPFGGQEAIANRIICTV--------GDPKARF
CCA_DECAR       RKTGHFIFHAAADVTLEEDLARRDLTINAMAKAAGTLVDPFNGQQDLASKTLRHV-----------GPAF
CCA_BURP8       SAGYHFQFFYAPDVTLEDDLARRDLTINAMAREVTPDIDPFNGREDLEHRVFRHV-----------SDAF
CCA_XANOM       RKSGRVDADPL--VTLEEDLLRRDFTINAIARDEDTGFDPYNGARDLQARVLRHV-----------GPAF
CCA_OCEIH       TYRQDGEYTDHRNDVLAEDLRRRDFTINALAMDTS---------GQITDLFHGQDDLKKKLIRTVGNAEF
CCA_VIBVU       -KGFECFFSP--DVALEEDLLRRDLTINAIAMD-SQGVDPYGGQQDLQNRILRHV-----------SEAF
CCA_HAEIE       RKSFICDFSP--TITLEQDLIRRDLTINAMA---------QSEDGEIIDPYGGKQDLENRILRHI-SPAF
CCA_CHRVO       AKGYHFTFHTSPEVTLEEDLARRDLTINAIAEAA---------DGSLTDPYGGQEDLKAGVLRHV-SEAF
CCA_BLOFL       HPKSHEEYALARTETIEEDLYRRDLTINAMAYDMNGNLDPYNGQKDIQ-----------LRLLRHVSNAF
CCA_HAEIN       RKSFICDFSP--TITLEQDLIRRDLTINAMA---------QSEDGEIIDPYGGKQDLENRILRHI-SPAF
CCA_HAEIG       RKSFICDFSP--TITLEQDLIRRDLTINAMA---------QSEDGEIIDPYGGKQDLENRILRHI-SPAF
CCA_LACLA       ITTFHVDF--VRD--LREDLKRRDFTINAFACDVN---------GQIIDLFDGLTDLKERRLTAVGSARF
CCA_SHEDO       TGTGYDGFSCDANESLEEDLLRRDLTINAIA---------QDEQGQLHDPYGGQQDIIHKQLRHVSQAFV
CCA_MARAV       -HGFSVYSAP--DVSLEDDLRRRDLTINAMA---------ETENGDLVDPFNGHADLEQKKLRHV-SEAF
CCA_HERAR       T---HEEYALARTETLEEDLIRRDLTVNAMAKDA---------DGRIIDPFGGRRDLEQKIFRHV-SSAF
CCA_BACWK       TESEYEDFSVQFVRSLEEDLKRRDFTMNAIAM---------TEEGEMVDLFAGKEAIRLKEITTVGDAAF
CCA_SHESA       ERKVGLGYGGFSDVTLEQDLLRRDLTINAIA---------QDEAGNLYDPYHGIADINARQLRHVSAAFA
CCA_PASMU       ARTFICDFSPTIS--LEQDLSRRDLTINALAQDLDGKI--YDFYGGLTDLKQRLLRHV--------SPAF
CCA_LACDB       TESGYQDFR-RPDKVLDEDLKRRDFTINALAM---------NRQGEIIDLFDGLGDLKRRVIKAVAEDRF
CCA_LACDA       TESGYQDFR-RPDKVLDEDLKRRDFTINALAM---------NRQGEIIDLFDGLGDLKRRVIKAVAEDRF
CCA_GEOKA       TFRTDGDYEDHRRRSLEEDLKRRDFTMNAIAMDEGTIIDPFGGQEAIERRLICTV--------GAADERF
CCA_COXBU       KGYKGFTFYAAPDVSLEEDLKRRDLTINAIATPEGQLIDPYGGQEDLKNKVLRHV-----------SVAF
CCA_COXBR       KGYKGFTFYAAPDVSLEEDLKRRDLTINAIATPEGQLIDPYGGQEDLKNKVLRHV-----------SVAF
CCA_BACST       TFKTDGDYEDYRRRSLEEDLKRRDFTMNAIAM------DEYG---TIIDPFGGREAXXXXXXXTVGEAEF
PCNB_HAEIN      TRANHSDARNLRDNVIEQDAARRDFTVNAL---------YYNPQNTLRDYFEGIKDLKAGKLRLIGDTRY
CCA_STAES       SEDEYIDHRRPSEVYFVRDLYQRDFTMNAIAMDLNYRLYDYNGQQDINNRVIRTV--------GVPSERF
CCA_STAEQ       SEDEYIDHRRPSEVYFVRDLYQRDFTMNAIAMDLNYRLYDYNGQQDINNRVIRTV--------GVPSERF
CCA_FRATN       ANGYHVNFS--KYITLEDDLKRRDLTINSIAI---------DQNNKVIDPFNGQADLQNRILRHTSIAFI
CCA_COXBN       KGYKGFTFYAAPDVSLEEDLKRRDLTINAIATPEGQLIDPYGGQEDLKNKVLRHV-----------SVAF
CCA_SHEB9       ERKIALGYGGFSDVTLEQDLLRRDLTINAIA---------QDEKGNLYDPFNGIEDINARLLRHVSDAFV
CCA_SHEB8       ERKIGLGYGGFSDVTLEQDLLRRDLTINAIA---------QDEKGNLYDPFNGIEDINARLLRHVSDAFV
CCA_SHEB5       ERKIGLGYGGFSDVTLEQDLLRRDLTINAIA---------QDEKGNLYDPFNGIEDINARLLRHVSDAFV
CCA_LACSS       TETGYQDFSVTFVRSLEEDLKRRDFTINALAMRAD---------GEIIDLFDGIADLKAHKIRAVADERF
CCA_LACS1       TESTYQDYRPDKVEFLEEDLKRRDLTINALAM---------DDKGKIIDLFDGLKDLKNGIIRAVGNPEF
CCA_SODGM       SGQGYTGFSP--EVTLEEDLRRRDLTINAIARDDEGNIDPYQGQQDIRQRWLRHV-----------SDAF
CCA_ERWT9       HPESHEEYALARTETLEQDLARRDLTINAIAQDAG---------GNYCDPYGGRADLQQRLLRHVSGA-F
CCA_XANAC       RKSGRVDADP--SVTLEEDLLRRDFTINAIARDEDTG--------QLFDPYNGVRDLQARVLRHVGPAFI
CCA_LACPL       TESGYQDFR-RPDQVLKEDLKRRDFTINALAMTAN---------GEVIDLFDGLADMEQGILRAVAEERF
CCA_LACAC       TESGYQDFR-RPDHVLDEDLKRRDFTINALAMDI---------RGQIIDLFNGVEDLKKRVIRAVGNTRF
CCA_BORPA       ----GFTFYTGADVTLEQDLQRRDLTVNAIARTP---------QGELVDPLDGVADVRARVLRHV-GEAF
CCA_BORBR       ----GFTFYTGADVTLEQDLQRRDLTVNAIARTP---------QGELVDPLDGVADVRARVLRHV-GEAF
CCA_LACRJ       TESGYQDYRR-PDKVLSEDLQRRDFTINALAL---------REDGEVIDLFDGLEDLQKHLIKAVGNPNF
CCA_LACRD       TESGYQDYRR-PDKVLSEDLQRRDFTINALAL---------REDGEVIDLFDGLEDLQKHLIKAVGNPNF
CCA_XANC5       RKSGRVDADP--SVTLEEDLLRRDFTINAIARDEETG--------ELFDPYNGARDLQARVLRHVGPAFV
CCA_STAAB       FNNENYEVTTFRAEELYEDLQRRDFTMNAIAMDTAYKLYDYDGQQDINNRIIRTV--------GIAAERF
CCA_PEDPA       TESGYQDFR-RPDQVLKEDLMRRDFTINAFAL---------KEDRTVIDIFDGLSDLEHKIIRAVGDERF
CCA_GEOTN       TFRTDGDYEDHRRRSLEEDLKRRDFTMNAIAM---------DEHGTIIDPFGGQEAIEKRLIRTVADARF
CCA_FRATT       ARSFEVNFS--KYITLEDDLKRRDLTINSIAI---------DQNNKVIDPFNGQADLQNRILRHTSIAFI
CCA_FRAT1       ARSFEVNFS--KYITLEDDLKRRDLTINSIAI---------DQNNKVIDPFNGQADLQNRILRHTSIAFI
CCA_METFK       T---HEEYALARTETLEQDLARRDLTINAIA---------EDEHGNLIDPYHGVADLHAKVLRHV-SPAF
CCA_BORPE       ----GFTFYTGADVTLEQDLQRRDLTVNAIARTP---------QGELVDPLDGVADVRARVLRHV-GEAF
CCA_LEUMM       VESTYTDFR-RPDHVLEEDLKRRDFTINALAM---------RHDGEVLDLFDGLEDMKKGVIRAVGDAEF
CCA_HAEDU       YTGFVCDFSP--NVTLEQDLIRRDLTINAMAQDLTSG--------QIFDPFGGKTDLANRLLRHI-SDAF
CCA_CUPTR       ERKTAMGYKGFADVTLEDDLVRRDLTINAMARAVDA---DGNLTGPVIDPHGGQRDLAARLFRHV-SDAF
TRNT1_HUMAN     TARLHFEITTLRIDVTQKDAERRDLTINSMFLGFDGTL--FDYFNGYED-----LKNKKVRFVGHAKQRI
CCA_BUCBP       HTGFSFDYS--NKVTLKEDLMRRDLTINAIA--------QDNNGNYI-DPFKGIRDIKNRILRHV-SPAF
CCA_ANOFW       TEGRYEDYRRPKDRSLNEDLQRRDFTMNAIAM------NEY---GEIIDPFGGVEALKQRIIETVGAERF
CCA_STACT       YNHENYEVTTFRAEDLYKDVERRDFTINAIAMDNQFNIKDYNGYSDIQNKLIKTVGNPY--------ERF
CCA_STAAR       FNDENYEVTTFRAEELYEDLQRRDFTMNAIAMDTANKLYDYDGQQDINNRIIRTV--------GIAEERF
CCA_STAAN       FNDENYEVTTFRAEELYEDLQRRDFTMNAIAMDTAYKLYDYDGQQDINNRIIRTV--------GIAEERF
CCA_STAAM       FNDENYEVTTFRAEELYEDLQRRDFTMNAIAMDTAYKLYDYDGQQDINNRIIRTV--------GIAEERF
CCA_STAA1       FNDENYEVTTFRAEELYEDLQRRDFTMNAIAMDTAYKLYDYDGQQDINNRIIRTV--------GIAEERF
CCA_PSEU2       TNEEYFVFHASPEVTLEQDLIRRDLTINAMAEDKDGNLDPYNGQKDLQARILRHV-----------SPAF
CCA_NITOC       ARTFEVDAAP--DVTLEEDLQRRDLTINAIAEAA---------DGSLLDPFGGQQDLARGILRHV-SPAF
CCA_BACP2       TESEYEDFRRPKEVALKEDLLRRDLTINAMAMDIN---------GEIIDHVGGKQDIERKRIQTVGDPAF
CCA_STAS1       TFRSEGDYDDHRNEVLYDDVQRRDFTMNAIAMDINYQIFDYEGQQDIKHQLIRTV--------GNPDERF
CCA_STAAW       FNDENYEVTTFRAEELYEDLQRRDFTMNAIAMDTAYKLYDYDGQQDINNRIIRTV--------GIAEERF
CCA_STAAT       FNDENYEVTTFRAEELYEDLQRRDFTMNAIAMDTAYKLYDYDGQQDINNRIIRTV--------GIAEERF
CCA_STAAS       FNDENYEVTTFRAEELYEDLQRRDFTMNAIAMDTAYKLYDYDGQQDINNRIIRTV--------GIAEERF
CCA_STAAE       FNDENYEVTTFRAEELYEDLQRRDFTMNAIAMDTAYKLYDYDGQQDINNRIIRTV--------GIAEERF
CCA_STAAC       FNDENYEVTTFRAEELYEDLQRRDFTMNAIAMDTAYKLYDYDGQQDINNRIIRTV--------GIAEERF
CCA_SHEFN       TGYGYQGFSANKDVTLSEDLLRRDLTINAIA---------QDEHGTLTDPFHGIADINAKILRHV-SDAF
CCA_PROMH       TESGYTGFTAAPDVTLEDDLQRRDLTINAIA---------YSAKGEYIDPYHGIDDIHAKLLRHV-SDAF
CCA_METCA       ------------DVTLEQDLERRDLTINAMA---------ETPDGRLVDPFGGRRDLEARLLRHV-SSAF
CCA_BUCCC       HTGFLFDFSSRIT--LKEDLKRRDLTINAIAQDSSGKIDFFNGKKDIQKKILRHV-----------SYSF
CCA_BACLD       TFRAELEYEDYRRKSLKEDLKRRDLTINAMAMEEGRLIDYFGGLRDIRERLIQTV--------GDPAERF
CCA_PSESM       TNEEYFVFHASPDVTLEQDLIRRDLTINAMAEDKDGNLDPYNGQQDLEARVLRHV-----------SPAF
PCNB_SALTI      ----------LRDNIIEEDAQRRDFTINSLYYSVA--------DFTVRDYVGGMQDLQEGVIRLIGNTRY
CCA_BLOPB       HPESHEEYALARTETIEEDLYRRDLTINAMA---------YDSHGNLIDPYHGQRDIKLRLLRHVSHT-F
CCA_RALEJ       ------------------------------------------------------------------SEAF
CCA_VIBF1       ERKSGQGYKGFTDVTLEEDLLRRDLTINAIA-QADNGIDPYNGQQDIIDRTLRHV-----------SDAF
CCA_AZOVD       RKSGRFTFHASPEVTLEEDLLRRDLTINAMA---------EDEQGRLIDPCHGRRDLEQRWLRHV-SPAF
PCNB_SALTY      ----------LRDNIIEEDAQRRDFTINSLYYSVA--------DFTVRDYVGGMQDLQEGVIRLIGNTRY
CCA_LACF3       TESGYQDFSVTFVRSLKEDLQRRDFTINALAL--------------------------------------
CCA_LACCB       TESRYQDFRR-PDHVLAEDLKRRDFTINALAV---------RHDGTIIDLFDGLKDLQHHQLRAVGNERF
CCA_LACC3       TESRYQDFRR-PDHVLAEDLKRRDFTINALAV---------RHDGTIIDLFDGLKDLQHHQLRAVGNERF
CCA_EDWI9       ARTFSTYFAP--DVTLEQDLLRRDLTINAMA---------EDDEGQLIDPYGGXXXXXXXXXXHVSEAFV
CCA_BACA2       AESEYKDYR--RPEALSEDLKRRDLTINAMAMSA---------EGELLDYFGGAHDIGQKLIRTVGNDRF
CCA_PSE14       TNEEYFVFHASPEVTLEQDLIRRDLTINAMAEDKDGNLDPYNGQKDLEARILRHV-----------SPAF
CCA_HAMD5       TEEGHTGFACYADVTLEEDLLRRDLTINAIAC---------NDKGDLIDPYQGEKDLNQLILRHVSEAFI
CCA_BURPP       AGYHGFQFFYAPDVTLEEDLARRDLTINAMAREVRPDIDPFNGQGDVQ----------ARVFRHVSDAFL
TRNT1_MOUSE     TARLHFEVTTLRIDVTQKDAERRDLTINSMFLGFDGTL--FDYFNGYAD-----LKNKKVRFVGHAKQRI
CCA_BURCJ       AAGYHFQFHYAPDVTLDEDLARRDLTINAMAREVS---PEGTLVGPVIDPFDGQADLRARVFRHVSDAFV
CCA_BURCH       AAGYHFQFHYAPDVTLDEDLARRDLTINAMAREVS---PEGALVGPVIDPFDGQADLRARVFRHVSDAFV
CCA_BURCA       AAGYHFQFHYAPDVTLDEDLARRDLTINAMAREVS---PEGALVGPVIDPFDGQADLRARVFRHVSDAFV
CCA_BURCC       AAGYHFQFHYAPDVTLDEDLARRDLTINAMAREVS---PEGALVGPVIDPFDGQADLRARVFRHVSDAFV
PCNB_ECOLI      ----------LRDNIIEEDAQRRDFTINSLYYSVA--------DFTVRDYVGGMKDLKDGVIRLIGNTRY
PCNB_ECOL6      ----------LRDNIIEEDAQRRDFTINSLYYSVA--------DFTVRDYVGGMKDLKDGVIRLIGNTRY
PCNB_ECO57      ----------LRDNIIEEDAQRRDFTINSLYYSVA--------DFTVRDYVGGMKDLKDGVIRLIGNTRY
CCA_POLNA       RNSARFEVYAAPEVTLEQDLARRDLTINSIAAPAHPDSAKGLFEDALVDPYGGQRDLQAKVLRHVTDAFR
GLND_NOVAD      -----------------------------------------------------------------AEDTF
CCA_BURVG       AAGYHFQFYYAPDVTLDEDLARRDLTINAMAREVSPDGTLI---GPVIDPFDGQADLRARVFRHVSDAFV
CCA2_SCHPO      TLSLFIDFVGLRAETVETDALRRDFTVNTLFFNIRT--------EKIEDITKRGYKDLQTKVLVTPISPL
CCA1_YEAST      EKSKHLDFVNLRSEKYEEDALRRDATLNALFYNIHKGEVEDFTKRGLQD-----LKDGVLRTPLPAKQTF
CCA_WIGBR       RKNGYFKLYTSSKITLEEDLKRRDLTINAIAKDKNGNIDPYGGIKDLYEKKLKHI-----------SNSF


                         +         .         .         .         .         *         .:210
query           QQDPLRSLRGIRFAATYNLAIIPETMVLLRQGTRRIEQIAGERLWHELAILFKLPITSFWINYMDQELHF
CCA_THICR       AEDPLRVLRVARFAAAFGFTLAPETAALMKSASGELSALTPERVWQEVVKALNTQTPSVFFEVLD-HVNA
CCA_NEIMF       AEDPVRILRTARFAARYRFEIAEETIKLMRQMVEEADALVAERVWQEFA---------------------
CCA_NEIMB       AEDPVRILRTARFAARYKFEIAEETIKLMRQMVEEADALVAERVWQEFA---------------------
CCA_NEIMA       AEDPVRILRTARFAARYKFEIAEETIKLMRQMVEEADALVAERVWQEFA---------------------
CCA_NEIM0       AEDPVRILRTARFAARYRFEIAEETIKLMRQMVEEADALVAERVWQELA---------------------
CCA_HAHCH       TEDPLRVLRVARFASRYGFTVAPETLQLMQQASGELKALTAERVWQETALGQKQPRVYFQVL---KDAHA
CCA_NEIG2       AEDPVRILRAARFAARYGFEIAEETIKLMRQMVEEADALVAERVWQELA---------------------
CCA_NEIG1       AEDPVRILRAARFAARYGFEIAEETIKLMRQMVEEADALVAERVWQELA---------------------
CCA_BACHD       KEDPLRMLRAPRFASELGFTVAKGTAEAIKGSCSLLADVAVERVEKELTQL-------------------
CCA_STAHJ       KEDALRILRGLRFQSQLNFTIEGDTFEAMKHQIADVEHLSIERIVVELKKLIKQNVSQSYLNLID--LNF
CCA_SHEB2       -EDPLRILRVARFAARFHFHIAAETLALMRQASDELNALTAERVWQEVDKSLGGPHPEVFFEVLHQ-CGA
CCA_TERTT       CEDPVRILRIARFAARYHFRIAPETLALMRDMVQEVDHLVAERVWKELSRALEEQHPAIFIQTLREALHR
CCA_RALME       AEDPVRILRVARFAARFHFTVAPETVALMRKDAGEVDALVPERVWQELSLMEAKPSRMFDVL---RECGA
CCA_LEUCK       REDALRIMRALRFSAQLGFDIAPHTKAALKQIGRNLEKIAVERI--------------------------
CCA_XYLFT       AEDPLRVLRAARFLAPLGFSIAPETLAMMRQANGELNSLIPERIWKEL----------------------
CCA_XYLF2       AEDPLRVLRAARFLAPLGFSIAPETLAMMRQANGELNSLIPERIWKEL----------------------
CCA_STRU0       QEDALRIMRGFRFAASLDFKIEDETFEAMKTHAHLLQKISVERSFIELDKLFMAPNWKLGLTYF-IEAQA
CCA_BAUCH       CEDPLRVLRVARFAAQLNFRIVPETRLMMQHMISELPLLSPERIWKE---------TEKALATRDPQIYF
CCA_XYLFM       AEDPLRVLRAARFLAPLGFSIAPETLAMMRQANGELNSLIPERIWKEL----------------------
CCA_ACTP7       EDPXXXXXXXXXXXXXHSLGIAPETVKLMQEMTAELAHLTAERVWLETQKAFATDNPQIYFEVL-REIGA
CCA_ACTP2       EDPXXXXXXXXXXXXXHSLGIAPETVKLMQEMTAELAHLTAERVWLETQKAFATDNPQIYFEVL-REIGA
CCA_STRR6       NEDALRIMRGFRFQASLGFALEPETFKAMKTLTPLLEKISVERTFVEFD---KLLLAPFW----------
CCA_STRPS       NEDALRIMRGFRFQASLGFALEPETFKAMKTLTPLLEKISVERTFVEFD---KLLLAPFW----------
CCA_STRPN       NEDALRIMRGFRFQASLGFALEPETFKAMKTLTPLLEKISVERTFVEFD---KLLLAPFW----------
CCA_STRP4       NEDALRIMRGFRFQASLGFALEPETFKAMKTLTPLLENISVERTFVEFD---KLLLAPFW----------
CCA_STRMU       NEDALRIMRGLRFAAQLNFDIEKKTFIAMREHAPLLEKISVERSFIEFDKLLRAPYWRKGIN--------
CCA_LEGPH       -EDPVRVLRVARFASRFHFRIANETRLLMKQG--ELAHLIPERVWQE------------WQKSL-EEKNP
CCA_ENTFA       HEDALRMMRGLRFASQLDFKIEEKTLAAIAEFHPLLEKISVERI--------------------------
CCA_AERS4       AEDPLRILRVARFAARFHFVVAPETLALMREMTGELAHLTPERVWKELE---------------------
CCA_VARPS       REDPVRILRVARFAARFDFSVAPETMALMREMVQEADALVPERVWQELS---------------------
CCA_LEGPL       AEDPVRVLRVARFASRFHFRIANETRLLMKQG--ELAHLIPERVWQE------------WQKSL-EEKNP
CCA_AERHH       AEDPLRILRVARFAARFHFVVAPETLALMREMTEELAHLTPERVWKELE---------------------
CCA_ACIAC       REDPVRILRVARFAARFDFSVAPETMALMREDAGEAADLVPERVWQEIA---------------------
CCA_XYLFA       AEDPLRVLRAARFLAPLGFSIAPETLTMMREASGELNSLIPERIWKEL----------------------
CCA_PHOPR       VEDPLRVLRVARFSARFGFTIAPETIALMQEVAGELEALTPERVWKE-----------------------
CCA_STRSY       NEDALRIMRGFRFAATLDFEIEPTTFEAMVQTAPLLEKISVERSFIEFD---KLLMADFW----------
CCA_STRS2       NEDALRIMRGFRFAATLDFEIEPTTFEAMVQTAPLLEKISVERSFIEFD---KLLMADFW----------
CCA_LEGPA       AEDPVRVLRVARFASRFHFKIANETRLLMKQG--ELAHLIPERVWQE------------WQKSL-QEKNP
CCA_MANSM       AEDPXXXXXXXXXXXXYDFSIAPETIALMAEITEKLQQLTIERVWQE---------TEKALKEKNPEIYF
CCA_ACISJ       REDPVRILRVARFAARFDFTVAPETMQLMREMVHEADHLVPERVWQELA---------------------
CCA_DIAST       REDPVRILRVARFAARFDFTVAPETMQLMREMVHEADHLVPERVWQELA---------------------
CCA_AERHY       AEDPLRILRVARFAARFHFVVAPETLALMREMTGELAHLTPERVWKEL----------------------
CCA_RALEH       AEDPVRILRVARFAARFHFGVAAETMRLMREAAGEVDALVPERVWQELA---------------------
CCA_VIBPA       -EDPLRVLRVARFSASLGFTVAKETMQLMRDDSGELNTLTPERVWQE-----------------------
CCA_STRGC       NEDALRIMRGFRFQATLNFDLEQDTLSAMTDCAPLLEKISVERIFIEFD---KLLLAPFW----------
CCA_LISMO       HEDALRMMRGVRFLSQLDFQLDSETEKALESQIGLLQHTSVERITVEWLKMIKGP---------------
CCA_LACLS       NEDALRIMRAMRFASTLDFKIEEKTFSAMRERSHLLEKISVERIFIELD---KLLLGSEWRNGLTLESEA
CCA_LACLM       NEDALRIMRAMRFASTLDFKIEEKTFSAMRERSHLLEKISVERIFIELD---KLLLGSEWRNGLTLESEA
CCA_BACCN       QEDALRMMRGIRFVSTLGFSLEEKTECAIKRYGHLLEHIAIERITVEFEKLLTGP---------------
CCA_BACSK       SEDPLRMLRAARFISSLGFEADRQLVKETTVQKAALQRCARERVVVELEKLLK-----------------
CCA_XANCP       -EDPVRVLRAARFLAPLGFGIAPETAALMREDSGELDSLVPERVWQEL----------------------
CCA_XANCB       -EDPVRVLRAARFLAPLGFGIAPETAALMREDSGELDSLVPERVWQEL----------------------
CCA_XANC8       -EDPVRVLRAARFLAPLGFGIAPETAALMREDSGELDSLVPERVWQEL----------------------
CCA_LISW6       QEDALRMMRAVRFLSQLDFHLDKETENALQKNIALLQHTSVERITVEWVKLMKGPAVKRAINVL------
CCA_LISMF       HEDALRMMRAVRFLSQLDFELDKETEKALESQIELLQHTSVERITVEWLKMMK-----------------
CCA_LISMC       HEDALRMMRAVRFLSQLDFELDKETEKALESQIELLQHTSVERITVEWLKMMK-----------------
CCA_LISIN       HEDALRMMRAVRFLSQLDFQLDKETETALTNQIALLQHTSVERITVEWIKMIK-----------------
CCA_ALTMD       SEDPLRVFRVARFATRYGFTIANETMALMQSESGELSTLSAERVWQETSLLEKTPHVFFTVLNQAHGLND
CCA_ACTSZ       EEDPLRVLRVARFAAKFGFAIAPETLELMKKLSTQLQHLTAERVWLE-----------------------
CCA_THISH       AEDPVRILRVARFAARFGFRVADETRALMRRAAGEVDALVPERVWQEMALGEGSPATFFEVL---RDCGA
CCA_STRSV       NEDALRIMRGFRFQAALDFDLEQDTFAAMKDCAPLLEKISVERIFIEFD---KLLLAPFW----------
CCA_STRA5       NEDALRIMRGLRFSASLNFDIETTTFEAMKKHASLLEKISVERSFIEFD---KLLLAPYW----------
CCA_STRA3       NEDALRIMRGLRFSASLNFDIETTTFEAMKKHASLLEKISVERSFIEFD---KLLLAPYW----------
CCA_LACBA       HEDALRMMRAVRFASQLNFTIVPETLAAMTSHAELLRKIAVERTQVEL----------------------
CCA_BACCZ       QEDALRMMRGIRFVSTLGFSLETKTKQAIETYGHLLEHIAIERI--------------------------
CCA_BUCAT       E-DPLRVLRVARFAATLGFKIAEETMLLMCIIVKKLSYLTSNRIWNETEKALKTPHVYFQVLYECNALHF
CCA_BUCAI       E-DPLRVLRVARFAATLGFKIAEETMLLMCIIVKKLSYLTSNRIWNETEKALKTPHVYFQVLYECNALHF
CCA_BUCA5       E-DPLRVLRVARFAATLGFKIAEETMLLMCIIVKKLSYLTSNRIWNETEKALKTPHVYFQVLYECNALHF
CCA_BACCR       QEDALRMMRGIRFVSTLGFSLEMKTKQAIETYGHLLEHIAIERI--------------------------
CCA_BACC4       QEDALRMMRGIRFVSTLGFSLEMKTKQAIETYGHLLEHIAIERI--------------------------
CCA_STRPM       EEDALRIMRGFRFAASLDFDIEAATFEAMRSHSPLLEKISVERSFTEFDKLLMAP---------------
CCA_STRPG       EEDALRIMRGFRFAASLDFDIEAATFEAMRSHSPLLEKISVERSFTEFDKLLMAP---------------
CCA_STRPF       EEDALRIMRGFRFAASLDFDIEAATFEAMRSHSPLLEKISVERSFTEFDKLLMAP---------------
CCA_STRPD       EEDALRIMRGFRFAASLDFDIEATTFEAMRSHSPLLEKISVERSFTEFDKLLMAP---------------
CCA_STRPC       EEDALRIMRGFRFAASLDFDIEAATFEAMRSHSPLLEKISVERSFTEFDKLLMAP---------------
CCA_STRPB       EEDALRIMRGFRFAASLDFDIEAATFEAMRSHSPLLEKISVERSFTEFDKLLMAP---------------
CCA_STRP8       EEDALRIMRGFRFAASLDFDIEAATFEAMRSHSPLLEKISVERSFTEFDKLLMAP---------------
CCA_STRP6       EEDALRIMRGFRFAASLDFDIEAATFEAMRSHSPLLEKISVERSFTEFDKLLMAP---------------
CCA_STRP3       EEDALRIMRGFRFAASLDFDIEAATFEAMRSHSPLLEKISVERSFTEFDKLLMAP---------------
CCA_LACJO       HEDALRMMRAVRFMSQLQFTLEPETEQAISDNHELLSKISVERIRDE-----------------------
CCA_VIBCM       -EDPLRVLRVARFAAKLHFTVAEETMQLMAKQSGELQHLTAERVWQE-----------------------
CCA_VIBCH       -EDPLRVLRVARFAAKLHFTVAEETMQLMAKQSGELQHLTAERVWQE-----------------------
CCA_NITMU       TEDPVRVLRTARFAARFGFHIAPETLALMNEMVHEVDALVSERVWQEIA---------------------
CCA_LISMH       HEDALRMMRAVRFLSQLDFELDKETEKALESQIELLQHTSVERMTVEWIKMMK-----------------
CCA_BACSU       QEDALRMLRAVRFMSQLGFTLSPETEEAIAKEKSLLSHVSVER---------------------------
CCA_BACCQ       QEDALRMMRGIRFVSTLGFSLETKTKQAIETYGHLLEHIAIERI--------------------------
CCA_BACC7       QEDALRMMRGIRFVSTLGFSLETKTKQAIETYGHLLEHIAIERI--------------------------
CCA_VIBVY       VEDPLRVLRVARFAAPLGFRVADETMQLMQSASGELSALTAERVWQE-----------------------
CCA_VEREI       REDPVRILRVARFAARLDFTVAPETLQLMREAHGETDHLVAERVWQELALMAEKPSRMFEVLRACGAL--
CCA_STRP1       EEDALRIMRGFRFAASLDFDIEAITFEAMRSHSPLLEKISVERSFTEFDKLLMAP---------------
CCA_STRM5       -EDPLRVLRAARFMAHFDFTVAPETMDLMRNASGELDALVPERVWQEL----------------------
CCA_BUCAP       TEDPLRILRTARFAANLGFHIDKDTMILMCKMVKKNEYLTKNRIWNETEKAFKTPHVYFQILHACKALNF
CCA_BACHK       QEDALRMMRGIRFVSTLGFSLETKTKQAIETYGHLLEHIAIERI--------------------------
CCA_BACC1       QEDALRMMRGIRFVSTLGFSLETKTKQAIETYGHLLEHIAIERI--------------------------
CCA_BACC0       QEDALRMMRGIRFVSTLGFSLETKTKQAIETYGHLLEHIAIERI--------------------------
CCA_BACAN       QEDALRMMRGIRFVSTLGFSLETKTKQAIETYGHLLEHIAIERI--------------------------
CCA_BACAC       QEDALRMMRGIRFVSTLGFSLETKTKQAIETYGHLLEHIAIERI--------------------------
CCA_BACAA       QEDALRMMRGIRFVSTLGFSLETKTKQAIETYGHLLEHIAIERI--------------------------
CCA_LACGA       HEDALRMMRAVRFMSQLQFTLEPETERAISDNHELLSKISVERIRDE-----------------------
CCA_BACC2       QEDALRMMRGIRFVSALGFSLETKTKQAIETYGHLLEHIAIERI--------------------------
CCA_SHESR       EDPXXXXXXXXXXXXXHGLGIAPETMALMQSQTEELTALTPERVWQE----------------VDKSL--
CCA_BACC3       QEDALRMMRGIRFVSTLGFSLETKTKQAIETYGHLLEHIAIERI--------------------------
CCA_VIBHB       -EDPLRVLRVARFAAKLGFSVAEETMQLMRDESGELSTLTPERVWQE-----------------------
CCA_VIBC3       -EDPLRVLRVARFAAKLHFTVAEETMQLMAKQSGELQHLTAERVWQE-----------------------
CCA_STRTD       NEDALRIMRGLRFAASLDFDIEEKTFEAMTSHAFLLEKISIERSFIEFDKLLLAP---------------
CCA_STRT2       NEDALRIMRGLRFAASLDFDIEEKTFEAMTSHAFLLEKISIERSFIEFDKLLLAP---------------
CCA_STRT1       NEDALRIMRGLRFAASLDFDIEEKTFEAMTSHAFLLEKISIERSFIEFDKLLLAP---------------
CCA_STRMK       -EDPLRVLRAARFMARFGFTVAEETMALMREASGELDALVPERVWQEL----------------------
CCA_GEOSW       SEDALRMMRAIRFVGQLGFSLDEETKQAIIENAALLAHISVERMTMEFEKLLEGPFAS------------
CCA_DECAR       AEDPVXXXXXXXXXXXXDFSVAPETLALMRSACGEVDHLVAERVWQELALMEQKPSRMFEVL---RDCGA
CCA_BURP8       LEDPVRILRVARFSARFDFSVAPETLALMRKMVEEVDALVPERVWQEVS---------------------
CCA_XANOM       VEDPVRVLRAARFLAPLGFTIAPETAALMREASGELDSLVPERVWQEL----------------------
CCA_OCEIH       TEDALRILRAVRFSSQLGCTIQEDTLEAMFVIRKQIQHLAVERITIELTKLFQGQHVSKAIQYLDEQLPI
CCA_VIBVU       VEDPLRVLRVARFAAPLGFRVADETMQLMQSASGELSALTAERVWQE-----------------------
CCA_HAEIE       SEDPXXXXXXXXXXXXYHFKIASETLALMTELSGELQHLTAERVWLE---------TEKALNEKNPEIYF
CCA_CHRVO       AEDPVRILXXXXXXXXXXXXXXPETMALMRRDDGEADALVAERVWQELALMEDKPSRMF---LTLRECGA
CCA_BLOFL       YEDPLRVLRVARFAANIGFTIAIETFEIMTHMIHELKSLSPERVWME-----------------------
CCA_HAEIN       SEDPXXXXXXXXXXXXYHFKIASETLALMAEQSGELQHLTAERIWLE---------TEKALNEKNPEIYF
CCA_HAEIG       SEDPXXXXXXXXXXXXYHFKIASETLALMAEQSGELQHLTAERVWLE---------TEKALNEKNPEIYF
CCA_LACLA       NEDALRIMRAMRFAATLDFQIENKTFLAMCESAHLLEKISVERIFIEFD---KLLLGQDWRN--------
CCA_SHEDO       EDPXXXXXXXXXXXXXHSLTVATETMALMSQLSGELEHLTAERVWQECALATDEPQVFFEVLAQCGALEV
CCA_MARAV       AEDPLRILRTARFAAPLGFSICRETMALMRQTSGELGDLVPERVWQEV----------------------
CCA_HERAR       AEDPVRILRVARFAARFQFSVAAETNALMQAAAGEVDALVPERTWQELA---------------------
CCA_BACWK       QEDALRMMRGIRFVSTLGFSLEIKTKQAIETYGHLLEHIAIERI--------------------------
CCA_SHESA       EDPXXXXXXXXXXXXXHDLGIAAETMALMQSQTEELTALTPERVWQEVDKSLGGPHPEVFFEVLRQALNI
CCA_PASMU       AEDPXXXXXXXXXXXXYHFTIASETRELMQQLSQELSNLTAERVWLETEKALLEPHPEVYFQTL-QEVGA
CCA_LACDB       HEDALRMMRAVRFMSQLSFSLEEKTRQAIINNHELLSKISVERIREEFVKL-------------------
CCA_LACDA       HEDALRMMRAVRFMSQLSFSLEEKTRQAIINNHELLSKISVERIREEFVKL-------------------
CCA_GEOKA       REDALRMMRAVRFVSQLGFALSEDTKSAIVQNAPLMAHISVERMTMEMEKLLAGPFVA------------
CCA_COXBU       QEDPVRVLRLARLATKFDFSIHPDTLELMKKCAGEIDALVPERIWQEL----------------------
CCA_COXBR       QEDPVRVLRLARLATKFDFSIHPDTLELMKKCAGEIDALVPERIWQEL----------------------
CCA_BACST       REDALRMMRAVRFVSELGFALAPDTEQAIVQNAPLLAHISVERMTMEMEKLLGGPFAA------------
PCNB_HAEIN      QEDPVRMLRSIRFMAKLDMFLEKPSEQPIRELAPLLKNIPPARLFDE-----------------------
CCA_STAES       SEDALRIIRGLRFQSQLNFQIDSDTLHAMSSQISDIQYLSVERVVVEL----------------------
CCA_STAEQ       SEDALRIIRGLRFQSQLNFQIDSDTLHAMSSQISDIQYLSVERVVVEL----------------------
CCA_FRATN       -EDPLRVVRLARFKANFNFSIAEETLTLIKEKTGELNHLTRERL--------------------------
CCA_COXBN       QEDPVRVLRLARLATKFDFSIHPDTLELMKKCAGEIDALVPERVWQEL----------------------
CCA_SHEB9       E-DPXXXXXXXXXXXXXGFHIAAETLALMRQASDELNALTAERVWQEVDKSLGGPHPEVFFEVLHQ-CGA
CCA_SHEB8       E-DPXXXXXXXXXXXXXGFHIAAETLALMRQASDELNALTAERVWQEVDKSLGGPHPEVFFEVLHQ-CGA
CCA_SHEB5       E-DPXXXXXXXXXXXXXGFHIAAETLALMRQASDELNALTAERVWQEVDKSLGGPHPEVFFEVLHQ-CGA
CCA_LACSS       HEDALRMMRAVRFESQLGFSVTETTQAAIEKHAALLEKIAIERIHVEFMKLMQ-----------------
CCA_LACS1       HEDALRMMRAVRFGSQLDFKVELDTFNAIKKNSHLLEKIAIERIWVKL-LLGKNPKQGLQ-EFLDTELY-
CCA_SODGM       GEDPXXXXXXXXXXXXXNFRIAPETMALMQQMTDELPLLAPERVWKETE---------------------
CCA_ERWT9       NEDPXXXXXXXXXXXXXNFRIADETLLLMQAMTHELHHLTPERVWKETELALQTPSPQ------------
CCA_XANAC       -EDPVRVLRAARFLAPLGFSLAAETAALMRDAGGELDSLVPERVWQEL----------------------
CCA_LACPL       HEDALRMMRAVRFASQLGFTIESQTEQAIADNAALLAKIAVERTWEKL----------------------
CCA_LACAC       HEDALRMMRAVRFMSQLEFKLEEKTERAIKDNHELLKKISIERIREE-----------------------
CCA_BORPA       AEDPVRILRLGRFAARFDFSIAPETMQLCRRMVEEADALVPERVWKEVS---------------------
CCA_BORBR       AEDPVRILRLGRFAARFDFSIAPETMQLCRRMVEEADALVPERVWKEVS---------------------
CCA_LACRJ       HEDALRMMRAVRFASKLDFVIDTATLKGIKENAPLLEKIAVERIRVEL----------------------
CCA_LACRD       HEDALRMMRAVRFASKLDFVIDTATLKGIKENAPLLEKIAVERIRVEL----------------------
CCA_XANC5       -EDPVRVLRAARFLAPLGFTLAADTAALMREASGELDSLVPERVWQEL----------------------
CCA_STAAB       QEDALRMIRCLRFQSQLSFEIATETFEAMRTQMADIKFLSIERIVIELTKLMR-----------------
CCA_PEDPA       HEDALRMMRAVRFASQLDFKIEAKTLKAIEENNMLLGKISVERI--------------------------
CCA_GEOTN       REDALRMMRAVRFVSQLGFSLAIDTKKAIIANAPLLAHISVERMTMEM----------------------
CCA_FRATT       -EDPLRVVRLARFKANFNFSIAQEMLALIKEKTGELNHLTRERL--------------------------
CCA_FRAT1       -EDPLRVVRLARFKANFNFSIAQEMLALIKEKTGELNHLTRERL--------------------------
CCA_METFK       CEDPVRILRVARFAARFEFSVADETMTLMRHMVEEVDALVPERVWQELA---------------------
CCA_BORPE       AEDPVRILRLGRFAARFDFSIAPETMQLCRRMVEEADALVPERVWKEVS---------------------
CCA_LEUMM       TEDALRMMRALRFSAQLGFNIEADTQKALVDLAPNLAKIAVERV--------------------------
CCA_HAEDU       AEDPXXXXXXXXXXXXXGFSIAEQTLELMQKMTAELNHLTAERIWRE-----------------------
CCA_CUPTR       AEDPVRXXXXXXXXXXHDFNVAAETMRLMREAAGEVDALVPERVWQELALMEARPSRMFEVLRECGXXXX
TRNT1_HUMAN     QEDYLRILRYFRF---YGRIVDPETLEAIAENAKGLAGISGERIWVEL----------------------
CCA_BUCBP       SEDPLRVLRIARFCALFHFRIATETMKIMSIVVKNNENLTRDRVWKETEKAFNTDNPHVYFQVL-KNCNA
CCA_ANOFW       NEDALRMMRALRFVSQLGFSLSTETKQAIIRYGHLLQHIAVERIAVEFEKLLLGPFVS------------
CCA_STACT       NEDALRILRGLRFKSQLRFEIDSDTYKAMQE---------------------------------------
CCA_STAAR       QEDALRMIRCLRFQSQLSFDIATETFEAMRTQMADIKFLSIERIVIELTKLMR-----------------
CCA_STAAN       QEDALRMIRCLRFQSQLSFDIAMETFEAMRTQMADIKFLSIERIVIELTKLMR-----------------
CCA_STAAM       QEDALRMIRCLRFQSQLSFDIAMETFEAMRTQMADIKFLSIERIVIELTKLMR-----------------
CCA_STAA1       QEDALRMIRCLRFQSQLSFDIAMETFEAMRTQMADIKFLSIERIVIELTKLMR-----------------
CCA_PSEU2       AEDPXXXXXXXXXXXXYGFTIAPETLGLMRQASGELKALTAERSWKEIS---------------------
CCA_NITOC       AEDPVRILXXXXXXXXXXXKVAPETLALMEATAGEADHLVPERVWRELALGESYPRRFFEILRACGALAR
CCA_BACP2       QEDALRMMRAIRFLSQLGFELAAETAEAMEKDKHLLANISVERKKIEMEKLLK-----------------
CCA_STAS1       DEDALRIIRGLRFQSQFGFHLEEATFTAMLNHIADIKYLAIERIVVEL----------------------
CCA_STAAW       QEDALRMIRCLRFQSQLSFDIATETFEAMRIQMADIKFLSIERIVIELTKLMR-----------------
CCA_STAAT       QEDALRMIRCLRFQSQLSFDIATETFEAMRIQMADIKFLSIERIVIELTKLMR-----------------
CCA_STAAS       QEDALRMIRCLRFQSQLSFDIATETFEAMRIQMADIKFLSIERIVIELTKLMR-----------------
CCA_STAAE       QEDALRMIRCLRFQSQLSFDIATETFEAMRIQMADIKFLSIERIVIELTKLMR-----------------
CCA_STAAC       QEDALRMIRCLRFQSQLSFDIATETFEAMRIQMADIKFLSIERIVIELTKLMR-----------------
CCA_SHEFN       TEDPXXXXXXXXXXXXXGFTIAPETLQLMTDNSGELDHLTPERVWQECALSSQSPQVFFDVLKQCQALIV
CCA_PROMH       SEDPXXXXXXXXXXXPLGFTIAPETMSLMQEMTNELNALTAERVWKE-----------------------
CCA_METCA       AEDPVRILRVARFTAPLGFRVAPETLVEMRRMVEEVDALVPERVWAEFAKALAEPAPS------------
CCA_BUCCC       QEDPLRVLRIARFAALLSFYIAKKTLSLMKLICSRKEYLTPERIWKE-----------------------
CCA_BACLD       HEDALRMLRALRFMSQLEFELSPNTKKAICENRPLLAHISTER---------------------------
CCA_PSESM       AEDPXXXXXXXXXXXXHGFTVAPETLELMRQESGELKALTAERSWKEIS---------------------
PCNB_SALTI      REDPVRMLRAVRFAAKLNMRISPETAEPIPRLATLLNDIPPARLFEESLKLLQAG-NGFETYQQLREYHL
CCA_BLOPB       HEDPXXXXXXXXXXXXXNFAIAPETLILMKQMIHELLSLSPERIWTE-----------------------
CCA_RALEJ       AEDPVRILRVARFAARFDFTVAPETVALMRRDAGEVDALVPERVWQELALMEARPARMFEVL---RQCGA
CCA_VIBF1       TEDPXXXXXXXXXXXXXGFTVAPETMHLMKVDSGELSHLTAERVWQE-----------------------
CCA_AZOVD       AEDPXXXXXXXXXXXPLGFRVAPETRALMRQESGELQALTAERSWKEISRALLEPRPDVFIRTLRDALHE
PCNB_SALTY      REDPVRMLRAVRFAAKLNMHISPETAEPIPRLATLLNDIPPARLFEESLKL--LQAGNGYETYQQREYHL
CCA_LACF3       ----------------------------------------------------------------------
CCA_LACCB       HEDALRMMRAVRFESQLGFGIEPATKAAIADNAKLLVHISVERV--------------------------
CCA_LACC3       HEDALRMMRAVRFESQLGFGIEPATKAAIADNAKLLVHISVERV--------------------------
CCA_EDWI9       EDPXXXXXXXXXXXXXXPLGVAAPTLALMQQMSQQLAHLTPERVWLETEKALSGP---------------
CCA_BACA2       REDALRMMRAVRFMSQLGFLLEKETREAVIKDRELLAHVSVER---------------------------
CCA_PSE14       AEDPXXXXXXXXXXXXXGFTIAPETLGLMRQESGELKALTAERSWKEIS---------------------
CCA_HAMD5       -EDPLRVLRVARFAAQFGFSIDSVTLDLMTKISQSGETLSPERVWKE-----------------------
CCA_BURPP       EDPVXXXXXXXXXXXXVDFTVAPETLALMRKADGEVDALVAERVWQEVS---------------------
TRNT1_MOUSE     QEDYLRILRYFRFYG--RIVDRPETLEAIAENAKGLAGISGERIWVEL----------------------
CCA_BURCJ       EDPVXXXXXXXXXXXXXDFTVADETLALMRRDAGEVDALVPERVWQEIA---------------------
CCA_BURCH       EDPVXXXXXXXXXXXXXDFTVADETLALMRRDAGEVDALVPERVWQEIA---------------------
CCA_BURCA       EDPVXXXXXXXXXXXXXDFTVADETLALMRRDAGEVDALVPERVWQEIA---------------------
CCA_BURCC       EDPVXXXXXXXXXXXXXDFTVADETLALMRRDAGEIDALVPERVWQEIA---------------------
PCNB_ECOLI      REDPVRMLRAVRFAAKLGMRISPETAEPIPRLATLLNDIPPARLFEE-----------------------
PCNB_ECOL6      REDPVRMLRAVRFAAKLGMRISPETAEPIPRLATLLNDIPPARLFEE-----------------------
PCNB_ECO57      REDPVRMLRAVRFAAKLGMRISPETAEPIPRLATLLNDIPPARLFEE-----------------------
CCA_POLNA       EDPVXXXXXXXXXXXXXDFSIAPETLAMMWEMVTEVDGLVPERVWQELALMEDKPSRMFDALRACGAL--
GLND_NOVAD      QQDPVRLVELFAVAASEKVEIHPEAMRLARRDAGLID--AAVRKDQRANALFLDVLTSTVLRWMNEAGVF
CCA_BURVG       EDPVXXXXXXXXXXXXXDFTVADETLALMRRDAGEADALVPERVWQEIA---------------------
CCA2_SCHPO      QEDPLRILRGIRFASRFEFTIDPSVV--------------------------------------------
CCA1_YEAST      LDDPLRVLRLIRFASRFNFTIDPEVM--------------------------------------------
CCA_WIGBR       KEDPLRVLRTARFAAHLNFFIDSKTLKIMSEMIDELFFIPVERIWLETALLCRNPHVYF-----------


                         .         .         .         +         .         .         .:280
query           WQYLLPGQLRMAQTKQNHYHVENVWRHCLRTYECLEVILQELSTIPSEGEPLLIHFNQHLSGGRSRCQVL
CCA_THICR       LSILFPAALKGVQQPEKHHPEGDAWVHTMMVLDASAALSNDVS--------------------------V
CCA_NEIMF       ----------KGLMEKNPRKMIEVLREC----GALKVLLPEVNAL--FGVPQRADYHPEIDSGIHTLMTL
CCA_NEIMB       ----------KGLMEKNPRKMIEVLREC----GALKVLLPEVNAL--FGVPQRADYHPEIDSGIHTLMTL
CCA_NEIMA       ----------KGLMEKNPRKMIEVLREC----GALKVLLPEVNAL--FGVPQRADYHPEIDSGIHTLMTL
CCA_NEIM0       ----------KGLMEKNPRKMIEVLREC----GALKVLLPEVNAL--FGVPQRADYHPEIDSGIHTLMTL
CCA_HAHCH       LQDIFPALFGVPQTPQYHPEVD-TGLHSLMALECL----------------------------LSEREEV
CCA_NEIG2       ----------KGLMEKNPRKMIEMLREC----GALQVLLPEVDAL--FGVPQRADYHPEIDSGIHTLMTL
CCA_NEIG1       ----------KGLMEKNPRKMIEMLREC----GALQVLLPEVDAL--FGVPQRADYHPEIDSGIHTLMTL
CCA_BACHD       ----------------------------------------------------------------------
CCA_STAHJ       FNYVFFRSLDMKQTKVNSPISFELWIAILLTVEQTNTSLSDLKISNNE----------------------
CCA_SHEB2       LEVLFPEIFALFGVPQ-----PEKWHPEIDTGVHTLMVLAQAALLTDD-------------------KSV
CCA_TERTT       LMPELNALFGIPQPEAHHPEVD-TGVHALLALEC------ELSSTPE----------------------V
CCA_RALME       LAHLLPELDRLWGVPQREYHPE---------VDTGVHVMMVIDYAASVGASLPVRF--------------
CCA_LEUCK       ----------------------------------------------------------------------
CCA_XYLFT       -------------SRSLTYTQPAAFLHTLRTVNALEVVLPELNAL--YGVPQHADYHPEIDTGLHQDMLI
CCA_XYLF2       -------------SRSLTYTQPAAFLHTLRTVNALEVVLPELNAL--YGVPQHADYHPEIDTGLHQDMLI
CCA_STRU0       YNY-LPG---------------------------------------------------------------
CCA_BAUCH       --------------------------QVLRDCGALKTLFPEIDALPAKWHPEIIHMTVAMAARLSDSIAV
CCA_XYLFM       -------------SRSLAYTQPAAFLHTLRTVNALEVVLPELNAL--YGVPQHADYHPEIDTGLHQDMLI
CCA_ACTP7       LAVLFPEFDRLPQPEQHHPEIDS-GVHTL----------------------LVIEQAKRLAKNAENPTAL
CCA_ACTP2       LAVLFPEFDRLPQPEQHHPEIDS-GVHTL----------------------LVIEQAKRLAKNAENPTAL
CCA_STRR6       ----------------------------------------------------------------------
CCA_STRPS       ----------------------------------------------------------------------
CCA_STRPN       ----------------------------------------------------------------------
CCA_STRP4       ----------------------------------------------------------------------
CCA_STRMU       ----------------------------------------------------------------------
CCA_LEGPH       EQFIL----------------------SLRSCDALRVILPEINSLFGVPNPHQYHMTLRASSELSEEPLV
CCA_ENTFA       ----------------------------------------------------------------------
CCA_AERS4       -------KVLLGQTPQVFFEV-------LRECGALKALFPELDAL--FGVPAPAKWHPEIDTGIHTLMVL
CCA_VARPS       ----------------------------------------------------------------------
CCA_LEGPL       EQFIL----------------------SLRSCDALRVILPEINSLFGVPNPHQYHMTLRASSELSEEPLV
CCA_AERHH       -------KVLLGPTPQVFFEV-------LRECGALAALFPELDAL--FGVPAPAKWHPEIDTGIHTMMVL
CCA_ACIAC       ----------------------------------------------------------------------
CCA_XYLFA       -------------SRSLAYTQPAAFLHTLRTVNALEVVLPELNAL--YGVPQHADYHPEIDTGLHQDMLI
CCA_PHOPR       WEKSL--------STEN----PEVFLTVLRQCGALKVVMPEIDALPAQWHPEIIHMVAKQAAELSPNKVI
CCA_STRSY       ----------------------------------------------------------------------
CCA_STRS2       ----------------------------------------------------------------------
CCA_LEGPA       EQFIL----------------------SLRSCDALRVVLPEINSL--FGVPNPHQYHQEIDTGLSEEPLV
CCA_MANSM       QVLLQVGALKIGVPNPAQYHPE------IDSFLHTMLVLQQAVRLTENTE-----FNK---------SAV
CCA_ACISJ       ----------------------------------------------------------------------
CCA_DIAST       ----------------------------------------------------------------------
CCA_AERHY       ----------------------------------------------------------------------
CCA_RALEH       ----------------------------------------------------------------------
CCA_VIBPA       ----------------------------------------------------------------------
CCA_STRGC       ----------------------------------------------------------------------
CCA_LISMO       ----------------------------------------------------------------------
CCA_LACLS       WKYL------------------------------------------------------------------
CCA_LACLM       WKYL------------------------------------------------------------------
CCA_BACCN       ----------------------------------------------------------------------
CCA_BACSK       ----------------------------------------------------------------------
CCA_XANCP       ----------------------------------------------------------------------
CCA_XANCB       ----------------------------------------------------------------------
CCA_XANC8       ----------------------------------------------------------------------
CCA_LISW6       ----------------------------------------------------------------------
CCA_LISMF       ----------------------------------------------------------------------
CCA_LISMC       ----------------------------------------------------------------------
CCA_LISIN       ----------------------------------------------------------------------
CCA_ALTMD       W---------------------------------------------------------------------
CCA_ACTSZ       ----------------------------------------------------------------------
CCA_THISH       LAVLFPEIERLFGVPQPKYHPEDTGVHTL-------MVLTQAARLSADA-------------------TI
CCA_STRSV       ----------------------------------------------------------------------
CCA_STRA5       ----------------------------------------------------------------------
CCA_STRA3       ----------------------------------------------------------------------
CCA_LACBA       ----------------------------------------------------------------------
CCA_BACCZ       ----------------------------------------------------------------------
CCA_BUCAT       F---------------------------------------------------------------------
CCA_BUCAI       F---------------------------------------------------------------------
CCA_BUCA5       F---------------------------------------------------------------------
CCA_BACCR       ----------------------------------------------------------------------
CCA_BACC4       ----------------------------------------------------------------------
CCA_STRPM       ----------------------------------------------------------------------
CCA_STRPG       ----------------------------------------------------------------------
CCA_STRPF       ----------------------------------------------------------------------
CCA_STRPD       ----------------------------------------------------------------------
CCA_STRPC       ----------------------------------------------------------------------
CCA_STRPB       ----------------------------------------------------------------------
CCA_STRP8       ----------------------------------------------------------------------
CCA_STRP6       ----------------------------------------------------------------------
CCA_STRP3       ----------------------------------------------------------------------
CCA_LACJO       ----------------------------------------------------------------------
CCA_VIBCM       ----------------------------------------------------------------------
CCA_VIBCH       ----------------------------------------------------------------------
CCA_NITMU       ----------------------------------------------------------------------
CCA_LISMH       ----------------------------------------------------------------------
CCA_BACSU       ----------------------------------------------------------------------
CCA_BACCQ       ----------------------------------------------------------------------
CCA_BACC7       ----------------------------------------------------------------------
CCA_VIBVY       ----------------------------------------------------------------------
CCA_VEREI       -ERLLPEVERLWGVPQSAEHHPEI-----DTGAHLLLVLDMAARLQA---PLAVRF--------------
CCA_STRP1       ----------------------------------------------------------------------
CCA_STRM5       ----------------------------------------------------------------------
CCA_BUCAP       ----------------------------------------------------------------------
CCA_BACHK       ----------------------------------------------------------------------
CCA_BACC1       ----------------------------------------------------------------------
CCA_BACC0       ----------------------------------------------------------------------
CCA_BACAN       ----------------------------------------------------------------------
CCA_BACAC       ----------------------------------------------------------------------
CCA_BACAA       ----------------------------------------------------------------------
CCA_LACGA       ----------------------------------------------------------------------
CCA_BACC2       ----------------------------------------------------------------------
CCA_SHESR       ----------------GGPHPE-VFFEVLRQCGALKVLFPEIDALPEKWHPEILHTMMVLAQSSSMTEAV
CCA_BACC3       ----------------------------------------------------------------------
CCA_VIBHB       ----------------------------------------------------------------------
CCA_VIBC3       ----------------------------------------------------------------------
CCA_STRTD       ----------------------------------------------------------------------
CCA_STRT2       ----------------------------------------------------------------------
CCA_STRT1       ----------------------------------------------------------------------
CCA_STRMK       ----------------------------------------------------------------------
CCA_GEOSW       ----------------------------------------------------------------------
CCA_DECAR       LARLLPEVDKLFGVPQRDYHPE------------IDTGIHTMMVIDQ-------------SARRTFTLPV
CCA_BURP8       ----------------------------------------------------------------------
CCA_XANOM       ----------------------------------------------------------------------
CCA_OCEIH       FQ--------------------------------------------------------------------
CCA_VIBVU       ----------------------------------------------------------------------
CCA_HAEIE       ETLHKTGALSVLFSEIDALHVPNPVKHHPEVDSFIHTMLVLKQAVNTENNPIL------------NKSAV
CCA_CHRVO       LARILPEVDALFGVPQRADHHPEI--------DCGDHVMRVLDYAAAAGQPLAVRF--------------
CCA_BLOFL       ----------------------------------------------------------------------
CCA_HAEIN       ETLHKTGALSVLFSEIDAYGVPNPVKHHPEVDSFIHTMLVLKQAVNTENNPIL------------NKSAV
CCA_HAEIG       ETLHKTGALSVLFSEIDALHVPNPVKHHPEVDSFIHTMLVLKQAVNTENNPIL------------NKSAV
CCA_LACLA       ----------------------------------------------------------------------
CCA_SHEDO       LFPEIHALFGVPQPEKWHPEID-TGKHTLLSLKQASLLTDDMA--------------------------I
CCA_MARAV       ----------------------------------------------------------------------
CCA_HERAR       ----------------------------------------------------------------------
CCA_BACWK       ----------------------------------------------------------------------
CCA_SHESA       LFPEIEALFGVPQPEKWHPEIDTGLHTML--------VLAQASSLTEE-------------------KAV
CCA_PASMU       LQVLFP-ELAALQGVPNKYHPE------IDTFVHTMLVLQQAVLLTENTD--------------SDKSAV
CCA_LACDB       ----------------------------------------------------------------------
CCA_LACDA       ----------------------------------------------------------------------
CCA_GEOKA       ----------------------------------------------------------------------
CCA_COXBU       ----------------------------------------------------------------------
CCA_COXBR       ----------------------------------------------------------------------
CCA_BACST       ----------------------------------------------------------------------
PCNB_HAEIN      ----------------------------------------------------------------------
CCA_STAES       ----------------------------------------------------------------------
CCA_STAEQ       ----------------------------------------------------------------------
CCA_FRATN       ----------------------------------------------------------------------
CCA_COXBN       ----------------------------------------------------------------------
CCA_SHEB9       LEVLFPEIFALFGVPQ-----PEKWHPEIDTGVHTLMVLAQAALLTED-------------------KSV
CCA_SHEB8       LEVLFPEIFALFGVPQ-----PEKWHPEIDTGVHTLMVLAQAALLTED-------------------KSV
CCA_SHEB5       LEVLFPEIFALFGVPQ-----PEKWHPEIDTGVHTLMVLAQAALLTED-------------------KSV
CCA_LACSS       ----------------------------------------------------------------------
CCA_LACS1       ----------------------------------------------------------------------
CCA_SODGM       ---------RTLATRN-----PQVYFQVLRDCGALKALFPEVDALPAKWHPEIIHTLMTVSMAARLTDAV
CCA_ERWT9       -----------------------VFFQVLRDCGALAVLFPELDNLPAKWHPEIVHXXXXXXXXXRLSQEI
CCA_XANAC       ----------------------------------------------------------------------
CCA_LACPL       ----------------------------------------------------------------------
CCA_LACAC       ----------------------------------------------------------------------
CCA_BORPA       ----------------------------------------------------------------------
CCA_BORBR       ----------------------------------------------------------------------
CCA_LACRJ       ----------------------------------------------------------------------
CCA_LACRD       ----------------------------------------------------------------------
CCA_XANC5       ----------------------------------------------------------------------
CCA_STAAB       ----------------------------------------------------------------------
CCA_PEDPA       ----------------------------------------------------------------------
CCA_GEOTN       ----------------------------------------------------------------------
CCA_FRATT       ----------------------------------------------------------------------
CCA_FRAT1       ----------------------------------------------------------------------
CCA_METFK       ----------------------------------------------------------------------
CCA_BORPE       ----------------------------------------------------------------------
CCA_LEUMM       ----------------------------------------------------------------------
CCA_HAEDU       ----------------------------------------------------------------------
CCA_CUPTR       XXXXXXXXWGVPQRADFHPEVD-TGVHVMMVIDCAAAL----------GAPLPVRF--------------
TRNT1_HUMAN     ----------------------------------------------------------------------
CCA_BUCBP       LSVIFP-EINLVYQRQ-YYCIDNMYHNFYDTFD-IFMGLAELSKI-------------------------
CCA_ANOFW       ----------------------------------------------------------------------
CCA_STACT       ----------------------------------------------------------------------
CCA_STAAR       ----------------------------------------------------------------------
CCA_STAAN       ----------------------------------------------------------------------
CCA_STAAM       ----------------------------------------------------------------------
CCA_STAA1       ----------------------------------------------------------------------
CCA_PSEU2       ----------------------------------------------------------------------
CCA_NITOC       IFPEIECLFGVPQPRRYHPEIDT----GIHTLKVLEIA-------------------AHLSSDTQ----V
CCA_BACP2       ----------------------------------------------------------------------
CCA_STAS1       ----------------------------------------------------------------------
CCA_STAAW       ----------------------------------------------------------------------
CCA_STAAT       ----------------------------------------------------------------------
CCA_STAAS       ----------------------------------------------------------------------
CCA_STAAE       ----------------------------------------------------------------------
CCA_STAAC       ----------------------------------------------------------------------
CCA_SHEFN       LFPEVDALFGVPQPEKWHPEID-TGIHTL-------MVLEQTSLL-------------------SDNKAV
CCA_PROMH       ------------TEKALHSQAPQVYFEILHQCGALKILFPEINAL--FGVPAPKKWHPEIDTGIHTMMVL
CCA_METCA       ----------------------------------------------------------------------
CCA_BUCCC       ----------------------------------------------------------------------
CCA_BACLD       ----------------------------------------------------------------------
CCA_PSESM       ----------------------------------------------------------------------
PCNB_SALTI      FQPLFP----------------------------------------------------------------
CCA_BLOPB       ----------------------------------------------------------------------
CCA_RALEJ       LARLLPELDRLWGVPQRDYHPEDTGVHVMMVIDCAAAM----------GTTLAVRF--------------
CCA_VIBF1       WQKSLSSQ-----------HPE-IFLSTLKECGALAIVLPELNALPEKWHPEIIHTLMVAQQAALLSQDL
CCA_AZOVD       LLPEIDALFGVPQPAAHHPEID--------TGEHLLAVLRQCA---EHGQPL----------------VV
PCNB_SALTY      FQPLFP----------------------------------------------------------------
CCA_LACF3       ----------------------------------------------------------------------
CCA_LACCB       ----------------------------------------------------------------------
CCA_LACC3       ----------------------------------------------------------------------
CCA_EDWI9       --------------------VPQVYFQVLRDCGALAVLFPEIDRLPAQWHPLTLAMASHLSDD----VAV
CCA_BACA2       ----------------------------------------------------------------------
CCA_PSE14       ----------------------------------------------------------------------
CCA_HAMD5       ----------------------------------------------------------------------
CCA_BURPP       ----------------------------------------------------------------------
TRNT1_MOUSE     ----------------------------------------------------------------------
CCA_BURCJ       ----------------------------------------------------------------------
CCA_BURCH       ----------------------------------------------------------------------
CCA_BURCA       ----------------------------------------------------------------------
CCA_BURCC       ----------------------------------------------------------------------
PCNB_ECOLI      ----------------------------------------------------------------------
PCNB_ECOL6      ----------------------------------------------------------------------
PCNB_ECO57      ----------------------------------------------------------------------
CCA_POLNA       -QHLLPEVERLAQSAQYHPEIDTGIH-----------LMMVLDMAAQLGAPLPVRF--------------
GLND_NOVAD      GRFVPDFGRVVAQMQFDMYHHYTVDEHTIRAIGLLASI--------EKGEAKADHLASEVVGKVASRRVL
CCA_BURVG       ----------------------------------------------------------------------
CCA2_SCHPO      ----------------------------------------------------------------------
CCA1_YEAST      ----------------------------------------------------------------------
CCA_WIGBR       ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KLAALIHDVGKPDTAVIREDGRISFHGHAEAGVPYAEALATRLKLSRLERxxxxxxxxxxxxxxxxxxxx
CCA_THICR       RFAALVHDLGKGLTPKALWP---KHHGHEKAGVPLVAALCQQYRVPK-----------------------
CCA_NEIMF       RYAALLHDLGKAKTP---SDILPRHHGHDLAGVEPVREVNQRLR--------------------------
CCA_NEIMB       RYAALLHDLGKAKTP---SDILPRHHGHDLAGVEPVREVNQRLR--------------------------
CCA_NEIMA       RYAALLHDLGKAKTP---SDILPRHHGHDLAGVEPVRKVNQRLR--------------------------
CCA_NEIM0       RYAALLHDLGKAKTP---PDILPRHHGHDLAGVEPVREVNQRLR--------------------------
CCA_HAHCH       RFAALIHDLGK---GVTPQEEWPKHHNHEAVGVDLVKALTERVKAPKL----------------------
CCA_NEIG2       RYAALLHDLGKAKTP---PDILPRHHGHDINGVEPVREVNQRLRAPR-----------------------
CCA_NEIG1       RYAALLHDLGKAKTP---PDILPRHHGHDINGVEPVREVNQRLRAPR-----------------------
CCA_BACHD       ----------------------------------------------------------------------
CCA_STAHJ       ----------------------------------------------------------------------
CCA_SHEB2       RFAALVHDLGK---ALSPKEHLPKHHGHGQKGLPLIKALCTRLRV-------------------------
CCA_TERTT       RFAALIHDLGK---GVTPKHLWPSHHGHEQDGVALVEQLCNRL---------------------------
CCA_RALME       --AAMAHDLGKGTTP---EDMLPRHIGHEQRGVKLLEAICQRLRV-------------------------
CCA_LEUCK       ----------------------------------------------------------------------
CCA_XYLFT       GFAALCHDLGK---ALTPRATWPHHPMHEQRGMAPTQQLSERLKVPR-----------------------
CCA_XYLF2       GFAALCHDLGK---ALTPRATWPHHPMHEQRGMAPTQQLSERLKVPR-----------------------
CCA_STRU0       ----------------------------------------------------------------------
CCA_BAUCH       RFASLCHDIGK---GLTPRDHWPSHHGHGPAGIPLVQSLCQRLRV-------------------------
CCA_XYLFM       GFAALCHDLGK---ALTPRATWPHHPMHEQRGMAPTQQLSERLKVPR-----------------------
CCA_ACTP7       LWAALCHDLGK---GLTEKDILPHHYGHEVKGVKPARELSNRLKVS------------------------
CCA_ACTP2       LWAALCHDLGK---GLTEKDILPHHYGHEVKGVKPARELSNRLKVS------------------------
CCA_STRR6       ----------------------------------------------------------------------
CCA_STRPS       ----------------------------------------------------------------------
CCA_STRPN       ----------------------------------------------------------------------
CCA_STRP4       ----------------------------------------------------------------------
CCA_STRMU       ----------------------------------------------------------------------
CCA_LEGPH       RFAALVHDLGKASTPI---QAWPKHHGHEEEGTKLIRALCARLRI-------------------------
CCA_ENTFA       ----------------------------------------------------------------------
CCA_AERS4       RFAALCHDFGKGLTPPAFWP---SHHGHGQKGLPLIRDFCERFRV-------------------------
CCA_VARPS       ----------------------------------------------------------------------
CCA_LEGPL       RFAALVHDLGKASTPI---QAWPKHHGHEEEGTKLIRALCARLRI-------------------------
CCA_AERHH       RFAALCHDFGK---GLTPPEFWPSHHGHGQKGLPLIRDFCERFR--------------------------
CCA_ACIAC       ----------------------------------------------------------------------
CCA_XYLFA       GFAALCHDLGK---ALTPRATWPHHPMHEQRGMAPTQQLSERLKVPR-----------------------
CCA_PHOPR       RFAAQVHDLGK---ALSPKDDLPSHKMHCKDGLKPIKALCQRLRV-------------------------
CCA_STRSY       ----------------------------------------------------------------------
CCA_STRS2       ----------------------------------------------------------------------
CCA_LEGPA       RFAALVHDLGKASTPI---QDWPKHHGHEEEGTKLIRALCARLRI-------------------------
CCA_MANSM       RFAAICHDLGK---ALTPKDILPHHYGHEKAGIQPIRTLSNRLKV-------------------------
CCA_ACISJ       ----------------------------------------------------------------------
CCA_DIAST       ----------------------------------------------------------------------
CCA_AERHY       ----------------------------------------------------------------------
CCA_RALEH       ----------------------------------------------------------------------
CCA_VIBPA       ----------------------------------------------------------------------
CCA_STRGC       ----------------------------------------------------------------------
CCA_LISMO       ----------------------------------------------------------------------
CCA_LACLS       ----------------------------------------------------------------------
CCA_LACLM       ----------------------------------------------------------------------
CCA_BACCN       ----------------------------------------------------------------------
CCA_BACSK       ----------------------------------------------------------------------
CCA_XANCP       ----------------------------------------------------------------------
CCA_XANCB       ----------------------------------------------------------------------
CCA_XANC8       ----------------------------------------------------------------------
CCA_LISW6       ----------------------------------------------------------------------
CCA_LISMF       ----------------------------------------------------------------------
CCA_LISMC       ----------------------------------------------------------------------
CCA_LISIN       ----------------------------------------------------------------------
CCA_ALTMD       ----------------------------------------------------------------------
CCA_ACTSZ       ----------------------------------------------------------------------
CCA_THISH       RFAALTHDLGKGTTPA---DILPSHHGHEQRSVDLVHALCDRFRIPNAYR--------------------
CCA_STRSV       ----------------------------------------------------------------------
CCA_STRA5       ----------------------------------------------------------------------
CCA_STRA3       ----------------------------------------------------------------------
CCA_LACBA       ----------------------------------------------------------------------
CCA_BACCZ       ----------------------------------------------------------------------
CCA_BUCAT       ----------------------------------------------------------------------
CCA_BUCAI       ----------------------------------------------------------------------
CCA_BUCA5       ----------------------------------------------------------------------
CCA_BACCR       ----------------------------------------------------------------------
CCA_BACC4       ----------------------------------------------------------------------
CCA_STRPM       ----------------------------------------------------------------------
CCA_STRPG       ----------------------------------------------------------------------
CCA_STRPF       ----------------------------------------------------------------------
CCA_STRPD       ----------------------------------------------------------------------
CCA_STRPC       ----------------------------------------------------------------------
CCA_STRPB       ----------------------------------------------------------------------
CCA_STRP8       ----------------------------------------------------------------------
CCA_STRP6       ----------------------------------------------------------------------
CCA_STRP3       ----------------------------------------------------------------------
CCA_LACJO       ----------------------------------------------------------------------
CCA_VIBCM       ----------------------------------------------------------------------
CCA_VIBCH       ----------------------------------------------------------------------
CCA_NITMU       ----------------------------------------------------------------------
CCA_LISMH       ----------------------------------------------------------------------
CCA_BACSU       ----------------------------------------------------------------------
CCA_BACCQ       ----------------------------------------------------------------------
CCA_BACC7       ----------------------------------------------------------------------
CCA_VIBVY       ----------------------------------------------------------------------
CCA_VEREI       --ACLAHDLGKGSTPADMLPRHI---GHETRGAELLKHLAERLRV-------------------------
CCA_STRP1       ----------------------------------------------------------------------
CCA_STRM5       ----------------------------------------------------------------------
CCA_BUCAP       ----------------------------------------------------------------------
CCA_BACHK       ----------------------------------------------------------------------
CCA_BACC1       ----------------------------------------------------------------------
CCA_BACC0       ----------------------------------------------------------------------
CCA_BACAN       ----------------------------------------------------------------------
CCA_BACAC       ----------------------------------------------------------------------
CCA_BACAA       ----------------------------------------------------------------------
CCA_LACGA       ----------------------------------------------------------------------
CCA_BACC2       ----------------------------------------------------------------------
CCA_SHESR       RFAALVHDLGK---ALSPKEHWPKHHGHGQKGLPVIKSLCERLRV-------------------------
CCA_BACC3       ----------------------------------------------------------------------
CCA_VIBHB       ----------------------------------------------------------------------
CCA_VIBC3       ----------------------------------------------------------------------
CCA_STRTD       ----------------------------------------------------------------------
CCA_STRT2       ----------------------------------------------------------------------
CCA_STRT1       ----------------------------------------------------------------------
CCA_STRMK       ----------------------------------------------------------------------
CCA_GEOSW       ----------------------------------------------------------------------
CCA_DECAR       RFAALTHDLGKAETPA---DILPRHIGHEERSVRLTEQLCARLRV-------------------------
CCA_BURP8       ----------------------------------------------------------------------
CCA_XANOM       ----------------------------------------------------------------------
CCA_OCEIH       ----------------------------------------------------------------------
CCA_VIBVU       ----------------------------------------------------------------------
CCA_HAEIE       RFAAICHDLGK---ALTPQNILPHHYGHEQAGIKPTRSLCKRLKV-------------------------
CCA_CHRVO       --AALGHDLGKALTPAKVLPRHI---GHEEGGIAPLAELCRRLRV-------------------------
CCA_BLOFL       ----------------------------------------------------------------------
CCA_HAEIN       RFAAICHDLGK---ALTPQNILPHHYGHEQAGIKPTRSLCKRLKV-------------------------
CCA_HAEIG       RFAAICHDLGK---ALTPQNILPHHYGHEQAGIKPTRSLCKRLKV-------------------------
CCA_LACLA       ----------------------------------------------------------------------
CCA_SHEDO       RFATLVHDLGK---ALSPKESLPKHHGHGQKGLPLIKQFCQRLRV-------------------------
CCA_MARAV       ----------------------------------------------------------------------
CCA_HERAR       ----------------------------------------------------------------------
CCA_BACWK       ----------------------------------------------------------------------
CCA_SHESA       RFAALVHDLGK---ALSPKEHWPKHHGHGQKGLPVIKSLCERLRI-------------------------
CCA_PASMU       RFAAICHDLGK---ALTPKEILPHHYGHEKAGVMPTRRLCQRFKL-------------------------
CCA_LACDB       ----------------------------------------------------------------------
CCA_LACDA       ----------------------------------------------------------------------
CCA_GEOKA       ----------------------------------------------------------------------
CCA_COXBU       ----------------------------------------------------------------------
CCA_COXBR       ----------------------------------------------------------------------
CCA_BACST       ----------------------------------------------------------------------
PCNB_HAEIN      ----------------------------------------------------------------------
CCA_STAES       ----------------------------------------------------------------------
CCA_STAEQ       ----------------------------------------------------------------------
CCA_FRATN       ----------------------------------------------------------------------
CCA_COXBN       ----------------------------------------------------------------------
CCA_SHEB9       RFAALVHDLGK---ALSPKEHLPKHHGHGQKGLPLIKALCTRLRV-------------------------
CCA_SHEB8       RFAALVHDLGK---ALSPKEHLPKHHGHGQKGLPLIKALCTRLRV-------------------------
CCA_SHEB5       RFAALVHDLGK---ALSPKEHLPKHHGHGQKGLPLIKALCTRLRV-------------------------
CCA_LACSS       ----------------------------------------------------------------------
CCA_LACS1       ----------------------------------------------------------------------
CCA_SODGM       RFATLCHDVGK---ALTPRELWPSHHGHGPAGVKVVEALCQRLKV-------------------------
CCA_ERWT9       RFATLFHDVGKALTPKVKWP---SHHGHGPAGVPLVAALCERLRV-------------------------
CCA_XANAC       ----------------------------------------------------------------------
CCA_LACPL       ----------------------------------------------------------------------
CCA_LACAC       ----------------------------------------------------------------------
CCA_BORPA       ----------------------------------------------------------------------
CCA_BORBR       ----------------------------------------------------------------------
CCA_LACRJ       ----------------------------------------------------------------------
CCA_LACRD       ----------------------------------------------------------------------
CCA_XANC5       ----------------------------------------------------------------------
CCA_STAAB       ----------------------------------------------------------------------
CCA_PEDPA       ----------------------------------------------------------------------
CCA_GEOTN       ----------------------------------------------------------------------
CCA_FRATT       ----------------------------------------------------------------------
CCA_FRAT1       ----------------------------------------------------------------------
CCA_METFK       ----------------------------------------------------------------------
CCA_BORPE       ----------------------------------------------------------------------
CCA_LEUMM       ----------------------------------------------------------------------
CCA_HAEDU       ----------------------------------------------------------------------
CCA_CUPTR       --AALVHDLGKGTTP---EDVLPRHIGHELRSVRLLEEVCARLRV-------------------------
TRNT1_HUMAN     ----------------------------------------------------------------------
CCA_BUCBP       ----------------------------------------------------------------------
CCA_ANOFW       ----------------------------------------------------------------------
CCA_STACT       ----------------------------------------------------------------------
CCA_STAAR       ----------------------------------------------------------------------
CCA_STAAN       ----------------------------------------------------------------------
CCA_STAAM       ----------------------------------------------------------------------
CCA_STAA1       ----------------------------------------------------------------------
CCA_PSEU2       ----------------------------------------------------------------------
CCA_NITOC       RFAALTHDLGKGQTP---SHEWPHHYGHGERGVALVLTLCQRLRVPK-----------------------
CCA_BACP2       ----------------------------------------------------------------------
CCA_STAS1       ----------------------------------------------------------------------
CCA_STAAW       ----------------------------------------------------------------------
CCA_STAAT       ----------------------------------------------------------------------
CCA_STAAS       ----------------------------------------------------------------------
CCA_STAAE       ----------------------------------------------------------------------
CCA_STAAC       ----------------------------------------------------------------------
CCA_SHEFN       RFAALVHDLGK---ALTPKQDWPKHYGHGQKGLPVIKKLCARIRV-------------------------
CCA_PROMH       RFSALCHDLGKGVTPV---ENWXXXXXXXXTGVPLVEALCQRYRI-------------------------
CCA_METCA       ----------------------------------------------------------------------
CCA_BUCCC       ----------------------------------------------------------------------
CCA_BACLD       ----------------------------------------------------------------------
CCA_PSESM       ----------------------------------------------------------------------
PCNB_SALTI      ----------------------------------------------------------------------
CCA_BLOPB       ----------------------------------------------------------------------
CCA_RALEJ       --AALVHDLGKGTTP---EHVLPRHLGHETRSVELLEDVCKRLRV-------------------------
CCA_VIBF1       RFAAQVHDLGK---GVTPESEWPSHKLHCHTGIKLIKRLCDRVRV-------------------------
CCA_AZOVD       RWACLLHDLGKGTTPAEEWPRHIA---HERKGLKLIRAVNTRCKAPR-----------------------
PCNB_SALTY      ----------------------------------------------------------------------
CCA_LACF3       ----------------------------------------------------------------------
CCA_LACCB       ----------------------------------------------------------------------
CCA_LACC3       ----------------------------------------------------------------------
CCA_EDWI9       RFAALTHDVGK---GLTNPNFWPHHHGHGPAGVRLVREMCQRLR--------------------------
CCA_BACA2       ----------------------------------------------------------------------
CCA_PSE14       ----------------------------------------------------------------------
CCA_HAMD5       ----------------------------------------------------------------------
CCA_BURPP       ----------------------------------------------------------------------
TRNT1_MOUSE     ----------------------------------------------------------------------
CCA_BURCJ       ----------------------------------------------------------------------
CCA_BURCH       ----------------------------------------------------------------------
CCA_BURCA       ----------------------------------------------------------------------
CCA_BURCC       ----------------------------------------------------------------------
PCNB_ECOLI      ----------------------------------------------------------------------
PCNB_ECOL6      ----------------------------------------------------------------------
PCNB_ECO57      ----------------------------------------------------------------------
CCA_POLNA       --ACLCHDLGKGTTPA---DVLPRHIGHEERSAKLLKDVCQRLRV-------------------------
GLND_NOVAD      YVATLLHDIAK---------GRRG--DHSVLGAEVAMKLCPRLGLSAAE---------------------
CCA_BURVG       ----------------------------------------------------------------------
CCA2_SCHPO      ----------------------------------------------------------------------
CCA1_YEAST      ----------------------------------------------------------------------
CCA_WIGBR       ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CCA_THICR       ----------------------------------------------------------------------
CCA_NEIMF       ----------------------------------------------------------------------
CCA_NEIMB       ----------------------------------------------------------------------
CCA_NEIMA       ----------------------------------------------------------------------
CCA_NEIM0       ----------------------------------------------------------------------
CCA_HAHCH       ----------------------------------------------------------------------
CCA_NEIG2       ----------------------------------------------------------------------
CCA_NEIG1       ----------------------------------------------------------------------
CCA_BACHD       ----------------------------------------------------------------------
CCA_STAHJ       ----------------------------------------------------------------------
CCA_SHEB2       ----------------------------------------------------------------------
CCA_TERTT       ----------------------------------------------------------------------
CCA_RALME       ----------------------------------------------------------------------
CCA_LEUCK       ----------------------------------------------------------------------
CCA_XYLFT       ----------------------------------------------------------------------
CCA_XYLF2       ----------------------------------------------------------------------
CCA_STRU0       ----------------------------------------------------------------------
CCA_BAUCH       ----------------------------------------------------------------------
CCA_XYLFM       ----------------------------------------------------------------------
CCA_ACTP7       ----------------------------------------------------------------------
CCA_ACTP2       ----------------------------------------------------------------------
CCA_STRR6       ----------------------------------------------------------------------
CCA_STRPS       ----------------------------------------------------------------------
CCA_STRPN       ----------------------------------------------------------------------
CCA_STRP4       ----------------------------------------------------------------------
CCA_STRMU       ----------------------------------------------------------------------
CCA_LEGPH       ----------------------------------------------------------------------
CCA_ENTFA       ----------------------------------------------------------------------
CCA_AERS4       ----------------------------------------------------------------------
CCA_VARPS       ----------------------------------------------------------------------
CCA_LEGPL       ----------------------------------------------------------------------
CCA_AERHH       ----------------------------------------------------------------------
CCA_ACIAC       ----------------------------------------------------------------------
CCA_XYLFA       ----------------------------------------------------------------------
CCA_PHOPR       ----------------------------------------------------------------------
CCA_STRSY       ----------------------------------------------------------------------
CCA_STRS2       ----------------------------------------------------------------------
CCA_LEGPA       ----------------------------------------------------------------------
CCA_MANSM       ----------------------------------------------------------------------
CCA_ACISJ       ----------------------------------------------------------------------
CCA_DIAST       ----------------------------------------------------------------------
CCA_AERHY       ----------------------------------------------------------------------
CCA_RALEH       ----------------------------------------------------------------------
CCA_VIBPA       ----------------------------------------------------------------------
CCA_STRGC       ----------------------------------------------------------------------
CCA_LISMO       ----------------------------------------------------------------------
CCA_LACLS       ----------------------------------------------------------------------
CCA_LACLM       ----------------------------------------------------------------------
CCA_BACCN       ----------------------------------------------------------------------
CCA_BACSK       ----------------------------------------------------------------------
CCA_XANCP       ----------------------------------------------------------------------
CCA_XANCB       ----------------------------------------------------------------------
CCA_XANC8       ----------------------------------------------------------------------
CCA_LISW6       ----------------------------------------------------------------------
CCA_LISMF       ----------------------------------------------------------------------
CCA_LISMC       ----------------------------------------------------------------------
CCA_LISIN       ----------------------------------------------------------------------
CCA_ALTMD       ----------------------------------------------------------------------
CCA_ACTSZ       ----------------------------------------------------------------------
CCA_THISH       ----------------------------------------------------------------------
CCA_STRSV       ----------------------------------------------------------------------
CCA_STRA5       ----------------------------------------------------------------------
CCA_STRA3       ----------------------------------------------------------------------
CCA_LACBA       ----------------------------------------------------------------------
CCA_BACCZ       ----------------------------------------------------------------------
CCA_BUCAT       ----------------------------------------------------------------------
CCA_BUCAI       ----------------------------------------------------------------------
CCA_BUCA5       ----------------------------------------------------------------------
CCA_BACCR       ----------------------------------------------------------------------
CCA_BACC4       ----------------------------------------------------------------------
CCA_STRPM       ----------------------------------------------------------------------
CCA_STRPG       ----------------------------------------------------------------------
CCA_STRPF       ----------------------------------------------------------------------
CCA_STRPD       ----------------------------------------------------------------------
CCA_STRPC       ----------------------------------------------------------------------
CCA_STRPB       ----------------------------------------------------------------------
CCA_STRP8       ----------------------------------------------------------------------
CCA_STRP6       ----------------------------------------------------------------------
CCA_STRP3       ----------------------------------------------------------------------
CCA_LACJO       ----------------------------------------------------------------------
CCA_VIBCM       ----------------------------------------------------------------------
CCA_VIBCH       ----------------------------------------------------------------------
CCA_NITMU       ----------------------------------------------------------------------
CCA_LISMH       ----------------------------------------------------------------------
CCA_BACSU       ----------------------------------------------------------------------
CCA_BACCQ       ----------------------------------------------------------------------
CCA_BACC7       ----------------------------------------------------------------------
CCA_VIBVY       ----------------------------------------------------------------------
CCA_VEREI       ----------------------------------------------------------------------
CCA_STRP1       ----------------------------------------------------------------------
CCA_STRM5       ----------------------------------------------------------------------
CCA_BUCAP       ----------------------------------------------------------------------
CCA_BACHK       ----------------------------------------------------------------------
CCA_BACC1       ----------------------------------------------------------------------
CCA_BACC0       ----------------------------------------------------------------------
CCA_BACAN       ----------------------------------------------------------------------
CCA_BACAC       ----------------------------------------------------------------------
CCA_BACAA       ----------------------------------------------------------------------
CCA_LACGA       ----------------------------------------------------------------------
CCA_BACC2       ----------------------------------------------------------------------
CCA_SHESR       ----------------------------------------------------------------------
CCA_BACC3       ----------------------------------------------------------------------
CCA_VIBHB       ----------------------------------------------------------------------
CCA_VIBC3       ----------------------------------------------------------------------
CCA_STRTD       ----------------------------------------------------------------------
CCA_STRT2       ----------------------------------------------------------------------
CCA_STRT1       ----------------------------------------------------------------------
CCA_STRMK       ----------------------------------------------------------------------
CCA_GEOSW       ----------------------------------------------------------------------
CCA_DECAR       ----------------------------------------------------------------------
CCA_BURP8       ----------------------------------------------------------------------
CCA_XANOM       ----------------------------------------------------------------------
CCA_OCEIH       ----------------------------------------------------------------------
CCA_VIBVU       ----------------------------------------------------------------------
CCA_HAEIE       ----------------------------------------------------------------------
CCA_CHRVO       ----------------------------------------------------------------------
CCA_BLOFL       ----------------------------------------------------------------------
CCA_HAEIN       ----------------------------------------------------------------------
CCA_HAEIG       ----------------------------------------------------------------------
CCA_LACLA       ----------------------------------------------------------------------
CCA_SHEDO       ----------------------------------------------------------------------
CCA_MARAV       ----------------------------------------------------------------------
CCA_HERAR       ----------------------------------------------------------------------
CCA_BACWK       ----------------------------------------------------------------------
CCA_SHESA       ----------------------------------------------------------------------
CCA_PASMU       ----------------------------------------------------------------------
CCA_LACDB       ----------------------------------------------------------------------
CCA_LACDA       ----------------------------------------------------------------------
CCA_GEOKA       ----------------------------------------------------------------------
CCA_COXBU       ----------------------------------------------------------------------
CCA_COXBR       ----------------------------------------------------------------------
CCA_BACST       ----------------------------------------------------------------------
PCNB_HAEIN      ----------------------------------------------------------------------
CCA_STAES       ----------------------------------------------------------------------
CCA_STAEQ       ----------------------------------------------------------------------
CCA_FRATN       ----------------------------------------------------------------------
CCA_COXBN       ----------------------------------------------------------------------
CCA_SHEB9       ----------------------------------------------------------------------
CCA_SHEB8       ----------------------------------------------------------------------
CCA_SHEB5       ----------------------------------------------------------------------
CCA_LACSS       ----------------------------------------------------------------------
CCA_LACS1       ----------------------------------------------------------------------
CCA_SODGM       ----------------------------------------------------------------------
CCA_ERWT9       ----------------------------------------------------------------------
CCA_XANAC       ----------------------------------------------------------------------
CCA_LACPL       ----------------------------------------------------------------------
CCA_LACAC       ----------------------------------------------------------------------
CCA_BORPA       ----------------------------------------------------------------------
CCA_BORBR       ----------------------------------------------------------------------
CCA_LACRJ       ----------------------------------------------------------------------
CCA_LACRD       ----------------------------------------------------------------------
CCA_XANC5       ----------------------------------------------------------------------
CCA_STAAB       ----------------------------------------------------------------------
CCA_PEDPA       ----------------------------------------------------------------------
CCA_GEOTN       ----------------------------------------------------------------------
CCA_FRATT       ----------------------------------------------------------------------
CCA_FRAT1       ----------------------------------------------------------------------
CCA_METFK       ----------------------------------------------------------------------
CCA_BORPE       ----------------------------------------------------------------------
CCA_LEUMM       ----------------------------------------------------------------------
CCA_HAEDU       ----------------------------------------------------------------------
CCA_CUPTR       ----------------------------------------------------------------------
TRNT1_HUMAN     ----------------------------------------------------------------------
CCA_BUCBP       ----------------------------------------------------------------------
CCA_ANOFW       ----------------------------------------------------------------------
CCA_STACT       ----------------------------------------------------------------------
CCA_STAAR       ----------------------------------------------------------------------
CCA_STAAN       ----------------------------------------------------------------------
CCA_STAAM       ----------------------------------------------------------------------
CCA_STAA1       ----------------------------------------------------------------------
CCA_PSEU2       ----------------------------------------------------------------------
CCA_NITOC       ----------------------------------------------------------------------
CCA_BACP2       ----------------------------------------------------------------------
CCA_STAS1       ----------------------------------------------------------------------
CCA_STAAW       ----------------------------------------------------------------------
CCA_STAAT       ----------------------------------------------------------------------
CCA_STAAS       ----------------------------------------------------------------------
CCA_STAAE       ----------------------------------------------------------------------
CCA_STAAC       ----------------------------------------------------------------------
CCA_SHEFN       ----------------------------------------------------------------------
CCA_PROMH       ----------------------------------------------------------------------
CCA_METCA       ----------------------------------------------------------------------
CCA_BUCCC       ----------------------------------------------------------------------
CCA_BACLD       ----------------------------------------------------------------------
CCA_PSESM       ----------------------------------------------------------------------
PCNB_SALTI      ----------------------------------------------------------------------
CCA_BLOPB       ----------------------------------------------------------------------
CCA_RALEJ       ----------------------------------------------------------------------
CCA_VIBF1       ----------------------------------------------------------------------
CCA_AZOVD       ----------------------------------------------------------------------
PCNB_SALTY      ----------------------------------------------------------------------
CCA_LACF3       ----------------------------------------------------------------------
CCA_LACCB       ----------------------------------------------------------------------
CCA_LACC3       ----------------------------------------------------------------------
CCA_EDWI9       ----------------------------------------------------------------------
CCA_BACA2       ----------------------------------------------------------------------
CCA_PSE14       ----------------------------------------------------------------------
CCA_HAMD5       ----------------------------------------------------------------------
CCA_BURPP       ----------------------------------------------------------------------
TRNT1_MOUSE     ----------------------------------------------------------------------
CCA_BURCJ       ----------------------------------------------------------------------
CCA_BURCH       ----------------------------------------------------------------------
CCA_BURCA       ----------------------------------------------------------------------
CCA_BURCC       ----------------------------------------------------------------------
PCNB_ECOLI      ----------------------------------------------------------------------
PCNB_ECOL6      ----------------------------------------------------------------------
PCNB_ECO57      ----------------------------------------------------------------------
CCA_POLNA       ----------------------------------------------------------------------
GLND_NOVAD      ----------------------------------------------------------------------
CCA_BURVG       ----------------------------------------------------------------------
CCA2_SCHPO      ----------------------------------------------------------------------
CCA1_YEAST      ----------------------------------------------------------------------
CCA_WIGBR       ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CCA_THICR       ----------------------------------------------------
CCA_NEIMF       ----------------------------------------------------
CCA_NEIMB       ----------------------------------------------------
CCA_NEIMA       ----------------------------------------------------
CCA_NEIM0       ----------------------------------------------------
CCA_HAHCH       ----------------------------------------------------
CCA_NEIG2       ----------------------------------------------------
CCA_NEIG1       ----------------------------------------------------
CCA_BACHD       ----------------------------------------------------
CCA_STAHJ       ----------------------------------------------------
CCA_SHEB2       ----------------------------------------------------
CCA_TERTT       ----------------------------------------------------
CCA_RALME       ----------------------------------------------------
CCA_LEUCK       ----------------------------------------------------
CCA_XYLFT       ----------------------------------------------------
CCA_XYLF2       ----------------------------------------------------
CCA_STRU0       ----------------------------------------------------
CCA_BAUCH       ----------------------------------------------------
CCA_XYLFM       ----------------------------------------------------
CCA_ACTP7       ----------------------------------------------------
CCA_ACTP2       ----------------------------------------------------
CCA_STRR6       ----------------------------------------------------
CCA_STRPS       ----------------------------------------------------
CCA_STRPN       ----------------------------------------------------
CCA_STRP4       ----------------------------------------------------
CCA_STRMU       ----------------------------------------------------
CCA_LEGPH       ----------------------------------------------------
CCA_ENTFA       ----------------------------------------------------
CCA_AERS4       ----------------------------------------------------
CCA_VARPS       ----------------------------------------------------
CCA_LEGPL       ----------------------------------------------------
CCA_AERHH       ----------------------------------------------------
CCA_ACIAC       ----------------------------------------------------
CCA_XYLFA       ----------------------------------------------------
CCA_PHOPR       ----------------------------------------------------
CCA_STRSY       ----------------------------------------------------
CCA_STRS2       ----------------------------------------------------
CCA_LEGPA       ----------------------------------------------------
CCA_MANSM       ----------------------------------------------------
CCA_ACISJ       ----------------------------------------------------
CCA_DIAST       ----------------------------------------------------
CCA_AERHY       ----------------------------------------------------
CCA_RALEH       ----------------------------------------------------
CCA_VIBPA       ----------------------------------------------------
CCA_STRGC       ----------------------------------------------------
CCA_LISMO       ----------------------------------------------------
CCA_LACLS       ----------------------------------------------------
CCA_LACLM       ----------------------------------------------------
CCA_BACCN       ----------------------------------------------------
CCA_BACSK       ----------------------------------------------------
CCA_XANCP       ----------------------------------------------------
CCA_XANCB       ----------------------------------------------------
CCA_XANC8       ----------------------------------------------------
CCA_LISW6       ----------------------------------------------------
CCA_LISMF       ----------------------------------------------------
CCA_LISMC       ----------------------------------------------------
CCA_LISIN       ----------------------------------------------------
CCA_ALTMD       ----------------------------------------------------
CCA_ACTSZ       ----------------------------------------------------
CCA_THISH       ----------------------------------------------------
CCA_STRSV       ----------------------------------------------------
CCA_STRA5       ----------------------------------------------------
CCA_STRA3       ----------------------------------------------------
CCA_LACBA       ----------------------------------------------------
CCA_BACCZ       ----------------------------------------------------
CCA_BUCAT       ----------------------------------------------------
CCA_BUCAI       ----------------------------------------------------
CCA_BUCA5       ----------------------------------------------------
CCA_BACCR       ----------------------------------------------------
CCA_BACC4       ----------------------------------------------------
CCA_STRPM       ----------------------------------------------------
CCA_STRPG       ----------------------------------------------------
CCA_STRPF       ----------------------------------------------------
CCA_STRPD       ----------------------------------------------------
CCA_STRPC       ----------------------------------------------------
CCA_STRPB       ----------------------------------------------------
CCA_STRP8       ----------------------------------------------------
CCA_STRP6       ----------------------------------------------------
CCA_STRP3       ----------------------------------------------------
CCA_LACJO       ----------------------------------------------------
CCA_VIBCM       ----------------------------------------------------
CCA_VIBCH       ----------------------------------------------------
CCA_NITMU       ----------------------------------------------------
CCA_LISMH       ----------------------------------------------------
CCA_BACSU       ----------------------------------------------------
CCA_BACCQ       ----------------------------------------------------
CCA_BACC7       ----------------------------------------------------
CCA_VIBVY       ----------------------------------------------------
CCA_VEREI       ----------------------------------------------------
CCA_STRP1       ----------------------------------------------------
CCA_STRM5       ----------------------------------------------------
CCA_BUCAP       ----------------------------------------------------
CCA_BACHK       ----------------------------------------------------
CCA_BACC1       ----------------------------------------------------
CCA_BACC0       ----------------------------------------------------
CCA_BACAN       ----------------------------------------------------
CCA_BACAC       ----------------------------------------------------
CCA_BACAA       ----------------------------------------------------
CCA_LACGA       ----------------------------------------------------
CCA_BACC2       ----------------------------------------------------
CCA_SHESR       ----------------------------------------------------
CCA_BACC3       ----------------------------------------------------
CCA_VIBHB       ----------------------------------------------------
CCA_VIBC3       ----------------------------------------------------
CCA_STRTD       ----------------------------------------------------
CCA_STRT2       ----------------------------------------------------
CCA_STRT1       ----------------------------------------------------
CCA_STRMK       ----------------------------------------------------
CCA_GEOSW       ----------------------------------------------------
CCA_DECAR       ----------------------------------------------------
CCA_BURP8       ----------------------------------------------------
CCA_XANOM       ----------------------------------------------------
CCA_OCEIH       ----------------------------------------------------
CCA_VIBVU       ----------------------------------------------------
CCA_HAEIE       ----------------------------------------------------
CCA_CHRVO       ----------------------------------------------------
CCA_BLOFL       ----------------------------------------------------
CCA_HAEIN       ----------------------------------------------------
CCA_HAEIG       ----------------------------------------------------
CCA_LACLA       ----------------------------------------------------
CCA_SHEDO       ----------------------------------------------------
CCA_MARAV       ----------------------------------------------------
CCA_HERAR       ----------------------------------------------------
CCA_BACWK       ----------------------------------------------------
CCA_SHESA       ----------------------------------------------------
CCA_PASMU       ----------------------------------------------------
CCA_LACDB       ----------------------------------------------------
CCA_LACDA       ----------------------------------------------------
CCA_GEOKA       ----------------------------------------------------
CCA_COXBU       ----------------------------------------------------
CCA_COXBR       ----------------------------------------------------
CCA_BACST       ----------------------------------------------------
PCNB_HAEIN      ----------------------------------------------------
CCA_STAES       ----------------------------------------------------
CCA_STAEQ       ----------------------------------------------------
CCA_FRATN       ----------------------------------------------------
CCA_COXBN       ----------------------------------------------------
CCA_SHEB9       ----------------------------------------------------
CCA_SHEB8       ----------------------------------------------------
CCA_SHEB5       ----------------------------------------------------
CCA_LACSS       ----------------------------------------------------
CCA_LACS1       ----------------------------------------------------
CCA_SODGM       ----------------------------------------------------
CCA_ERWT9       ----------------------------------------------------
CCA_XANAC       ----------------------------------------------------
CCA_LACPL       ----------------------------------------------------
CCA_LACAC       ----------------------------------------------------
CCA_BORPA       ----------------------------------------------------
CCA_BORBR       ----------------------------------------------------
CCA_LACRJ       ----------------------------------------------------
CCA_LACRD       ----------------------------------------------------
CCA_XANC5       ----------------------------------------------------
CCA_STAAB       ----------------------------------------------------
CCA_PEDPA       ----------------------------------------------------
CCA_GEOTN       ----------------------------------------------------
CCA_FRATT       ----------------------------------------------------
CCA_FRAT1       ----------------------------------------------------
CCA_METFK       ----------------------------------------------------
CCA_BORPE       ----------------------------------------------------
CCA_LEUMM       ----------------------------------------------------
CCA_HAEDU       ----------------------------------------------------
CCA_CUPTR       ----------------------------------------------------
TRNT1_HUMAN     ----------------------------------------------------
CCA_BUCBP       ----------------------------------------------------
CCA_ANOFW       ----------------------------------------------------
CCA_STACT       ----------------------------------------------------
CCA_STAAR       ----------------------------------------------------
CCA_STAAN       ----------------------------------------------------
CCA_STAAM       ----------------------------------------------------
CCA_STAA1       ----------------------------------------------------
CCA_PSEU2       ----------------------------------------------------
CCA_NITOC       ----------------------------------------------------
CCA_BACP2       ----------------------------------------------------
CCA_STAS1       ----------------------------------------------------
CCA_STAAW       ----------------------------------------------------
CCA_STAAT       ----------------------------------------------------
CCA_STAAS       ----------------------------------------------------
CCA_STAAE       ----------------------------------------------------
CCA_STAAC       ----------------------------------------------------
CCA_SHEFN       ----------------------------------------------------
CCA_PROMH       ----------------------------------------------------
CCA_METCA       ----------------------------------------------------
CCA_BUCCC       ----------------------------------------------------
CCA_BACLD       ----------------------------------------------------
CCA_PSESM       ----------------------------------------------------
PCNB_SALTI      ----------------------------------------------------
CCA_BLOPB       ----------------------------------------------------
CCA_RALEJ       ----------------------------------------------------
CCA_VIBF1       ----------------------------------------------------
CCA_AZOVD       ----------------------------------------------------
PCNB_SALTY      ----------------------------------------------------
CCA_LACF3       ----------------------------------------------------
CCA_LACCB       ----------------------------------------------------
CCA_LACC3       ----------------------------------------------------
CCA_EDWI9       ----------------------------------------------------
CCA_BACA2       ----------------------------------------------------
CCA_PSE14       ----------------------------------------------------
CCA_HAMD5       ----------------------------------------------------
CCA_BURPP       ----------------------------------------------------
TRNT1_MOUSE     ----------------------------------------------------
CCA_BURCJ       ----------------------------------------------------
CCA_BURCH       ----------------------------------------------------
CCA_BURCA       ----------------------------------------------------
CCA_BURCC       ----------------------------------------------------
PCNB_ECOLI      ----------------------------------------------------
PCNB_ECOL6      ----------------------------------------------------
PCNB_ECO57      ----------------------------------------------------
CCA_POLNA       ----------------------------------------------------
GLND_NOVAD      ----------------------------------------------------
CCA_BURVG       ----------------------------------------------------
CCA2_SCHPO      ----------------------------------------------------
CCA1_YEAST      ----------------------------------------------------
CCA_WIGBR       ----------------------------------------------------