[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO48823.1

[Show Plain Result]


## Summary of Sequence Search
    1::396
    6::384     e-123  56%  393 aa  ARGD_THETN RecName: Full=Acetylornithine aminotransferase;       
    1::389     e-121  54%  398 aa  ARGD_METJA RecName: Full=Acetylornithine aminotransferase;       
    1::383     e-113  52%  390 aa  ARGD_METTH RecName: Full=Acetylornithine aminotransferase;       
   16::407     e-111  56%  412 aa  ARGD_THEEB RecName: Full=Acetylornithine aminotransferase;       
   34::425     e-109  53%  429 aa  ARGD_SYNY3 RecName: Full=Acetylornithine aminotransferase;       
    8::388     e-107  51%  400 aa  ARGD_GLOVI RecName: Full=Acetylornithine aminotransferase;       
   33::412     e-104  51%  427 aa  ARGD_ANASP RecName: Full=Acetylornithine aminotransferase;       
    2::382     e-104  47%  385 aa  ARGD_THEMA RecName: Full=Acetylornithine aminotransferase;       
    1::386     e-100  46%  387 aa  ARGD_CLOAB RecName: Full=Acetylornithine aminotransferase;       
   22::401     e-100  46%  401 aa  ARGD_MYXXA RecName: Full=Acetylornithine aminotransferase;       
   15::400     7e-99  46%  406 aa  ARUC_PSEAE RecName: Full=Succinylornithine
    2::388     7e-99  45%  398 aa  ARGD_NEIMB RecName: Full=Acetylornithine aminotransferase;       
    2::388     9e-99  46%  397 aa  ARGD_NEIMA RecName: Full=Acetylornithine aminotransferase;       
    3::377     6e-96  48%  393 aa  ARGD_NITEU RecName: Full=Acetylornithine aminotransferase;       
   15::400     1e-95  47%  406 aa  ARGD_PSEPK RecName: Full=Acetylornithine aminotransferase;       
   24::404     9e-94  47%  419 aa  ARGD_PROMA RecName: Full=Acetylornithine aminotransferase;       
   15::400     1e-93  45%  405 aa  ARGD1_PSESM RecName: Full=Acetylornithine aminotransferase 1;      
    7::372     4e-93  48%  385 aa  ARGD_BACST RecName: Full=Acetylornithine aminotransferase;       
   20::399     4e-92  44%  403 aa  ARGD_VIBCH RecName: Full=Acetylornithine aminotransferase;       
    4::377     6e-92  48%  385 aa  ARGD_BACSU RecName: Full=Acetylornithine aminotransferase;       
   12::386     2e-91  43%  406 aa  ASTC_ECOHS RecName: Full=Succinylornithine transaminase;       
   12::386     2e-91  43%  406 aa  ASTC_ECOSE RecName: Full=Succinylornithine transaminase;       
   12::386     2e-91  43%  406 aa  ASTC_ECOLI RecName: Full=Succinylornithine transaminase;       
   12::386     2e-91  43%  406 aa  ASTC_ECOLC RecName: Full=Succinylornithine transaminase;       
   12::386     2e-91  43%  406 aa  ASTC_ECODH RecName: Full=Succinylornithine transaminase;       
   12::386     2e-91  43%  406 aa  ASTC_ECOBW RecName: Full=Succinylornithine transaminase;       
   12::386     2e-91  43%  406 aa  ASTC_ECO8A RecName: Full=Succinylornithine transaminase;       
   12::386     2e-91  43%  406 aa  ASTC_ECO24 RecName: Full=Succinylornithine transaminase;       
    3::376     2e-91  49%  376 aa  ARGD_AQUAE RecName: Full=Acetylornithine aminotransferase;       
   12::386     4e-91  43%  406 aa  ASTC_ESCF3 RecName: Full=Succinylornithine transaminase;       
   12::386     5e-91  43%  406 aa  ASTC_ECOSM RecName: Full=Succinylornithine transaminase;       
   12::386     7e-91  43%  406 aa  ASTC_SHISS RecName: Full=Succinylornithine transaminase;       
   12::386     7e-91  43%  406 aa  ASTC_ECO55 RecName: Full=Succinylornithine transaminase;       
   12::386     9e-91  43%  406 aa  ASTC_ECOLU RecName: Full=Succinylornithine transaminase;       
   12::386     9e-91  43%  406 aa  ASTC_ECO27 RecName: Full=Succinylornithine transaminase;       
   14::402     9e-91  44%  405 aa  ARGD_YERPE RecName: Full=Acetylornithine/succinyldiaminopimelate
   12::386     2e-90  44%  406 aa  ASTC_CITK8 RecName: Full=Succinylornithine transaminase;       
   15::403     2e-90  42%  406 aa  ARGD_ECOL6 RecName: Full=Acetylornithine/succinyldiaminopimelate
   15::403     2e-90  43%  406 aa  ARGD_ECO57 RecName: Full=Acetylornithine/succinyldiaminopimelate
   12::386     2e-90  43%  406 aa  ASTC_ECOUT RecName: Full=Succinylornithine transaminase;       
   12::386     2e-90  43%  406 aa  ASTC_ECOL6 RecName: Full=Succinylornithine transaminase;       
   12::386     2e-90  43%  406 aa  ASTC_ECOL5 RecName: Full=Succinylornithine transaminase;       
   12::386     2e-90  43%  406 aa  ASTC_ECOK1 RecName: Full=Succinylornithine transaminase;       
   12::386     2e-90  43%  406 aa  ASTC_ECO81 RecName: Full=Succinylornithine transaminase;       
   12::386     2e-90  43%  406 aa  ASTC_ECO7I RecName: Full=Succinylornithine transaminase;       
   12::386     2e-90  43%  406 aa  ASTC_ECO45 RecName: Full=Succinylornithine transaminase;       
   15::403     2e-90  43%  406 aa  ARGD_ECOLI RecName: Full=Acetylornithine/succinyldiaminopimelate
    3::377     2e-90  45%  384 aa  ARGD_BACHD RecName: Full=Acetylornithine aminotransferase;       
   12::386     3e-90  43%  406 aa  ASTC_ECO5E RecName: Full=Succinylornithine transaminase;       
   12::386     3e-90  43%  406 aa  ASTC_ECO57 RecName: Full=Succinylornithine transaminase;       
   12::386     6e-90  44%  408 aa  ASTC_SALPK RecName: Full=Succinylornithine transaminase;       
   12::386     6e-90  44%  408 aa  ASTC_SALPA RecName: Full=Succinylornithine transaminase;       
   12::386     8e-90  43%  406 aa  ASTC_SHIBS RecName: Full=Succinylornithine transaminase;       
   12::386     8e-90  43%  406 aa  ASTC_SHIB3 RecName: Full=Succinylornithine transaminase;       
    2::376     8e-90  48%  386 aa  ARGD_LISMF RecName: Full=Acetylornithine aminotransferase;       
   12::386     2e-89  44%  408 aa  ASTC_SALG2 RecName: Full=Succinylornithine transaminase;       
   12::386     2e-89  44%  408 aa  ASTC_SALEP RecName: Full=Succinylornithine transaminase;       
   14::399     2e-89  45%  403 aa  ARGD_PHOLL RecName: Full=Acetylornithine/succinyldiaminopimelate
   11::391     2e-89  43%  399 aa  ARGD_OCEIH RecName: Full=Acetylornithine aminotransferase;       
   12::386     3e-89  44%  408 aa  ASTC_SALTY RecName: Full=Succinylornithine transaminase;       
   12::386     3e-89  43%  408 aa  ASTC_SALPB RecName: Full=Succinylornithine transaminase;       
   12::386     4e-89  44%  408 aa  ASTC_SALNS RecName: Full=Succinylornithine transaminase;       
   12::386     4e-89  44%  408 aa  ASTC_SALA4 RecName: Full=Succinylornithine transaminase;       
   12::386     5e-89  43%  408 aa  ASTC_SALPC RecName: Full=Succinylornithine transaminase;       
   12::386     5e-89  43%  408 aa  ASTC_SALHS RecName: Full=Succinylornithine transaminase;       
   12::386     5e-89  43%  408 aa  ASTC_SALDC RecName: Full=Succinylornithine transaminase;       
   15::403     5e-89  42%  406 aa  ARGD_SHIFL RecName: Full=Acetylornithine/succinyldiaminopimelate
   14::398     7e-89  44%  414 aa  ASTC_YERPG RecName: Full=Succinylornithine transaminase;       
   14::398     7e-89  44%  414 aa  ASTC_YERPE RecName: Full=Succinylornithine transaminase;       
   14::398     7e-89  44%  414 aa  ASTC_YERPA RecName: Full=Succinylornithine transaminase;       
   12::386     7e-89  43%  408 aa  ASTC_SALTI RecName: Full=Succinylornithine transaminase;       
   14::398     9e-89  44%  414 aa  ASTC_YERP3 RecName: Full=Succinylornithine transaminase;       
   14::398     1e-88  44%  414 aa  ASTC_YERPS RecName: Full=Succinylornithine transaminase;       
   15::400     1e-88  42%  405 aa  ARGD_SALTY RecName: Full=Acetylornithine/succinyldiaminopimelate
   12::386     1e-88  43%  408 aa  ASTC_SALCH RecName: Full=Succinylornithine transaminase;       
   20::399     6e-88  43%  403 aa  ARGD_VIBVU RecName: Full=Acetylornithine aminotransferase;       
   15::400     6e-88  42%  405 aa  ARGD_SALTI RecName: Full=Acetylornithine/succinyldiaminopimelate
    5::396     6e-88  43%  398 aa  ARGD_PASMU RecName: Full=Acetylornithine aminotransferase;       
    1::390     6e-88  45%  393 aa  ARGD_HAEDU RecName: Full=Acetylornithine aminotransferase;       
    9::369     1e-87  47%  389 aa  ARGD_METKA RecName: Full=Acetylornithine aminotransferase;       
   11::395     1e-87  43%  405 aa  ARGD1_BRAJA RecName: Full=Acetylornithine aminotransferase 1;      
   20::399     1e-87  43%  403 aa  ARGD_VIBVY RecName: Full=Acetylornithine aminotransferase;       
    4::372     2e-87  46%  379 aa  ARGD_STRMU RecName: Full=Acetylornithine aminotransferase;       
    1::383     3e-87  43%  399 aa  ARGD_RHILO RecName: Full=Acetylornithine aminotransferase;       
    8::373     3e-87  43%  375 aa  ARGD_ARCFU RecName: Full=Acetylornithine aminotransferase;       
   49::444     5e-87  42%  451 aa  ARGD_ALNGL RecName: Full=Acetylornithine aminotransferase,
   25::414     8e-87  44%  418 aa  ARGD_PROMM RecName: Full=Acetylornithine aminotransferase;       
   12::390     2e-86  42%  403 aa  ARGD_BRUSU RecName: Full=Acetylornithine aminotransferase;       
   12::390     2e-86  42%  403 aa  ARGD_BRUME RecName: Full=Acetylornithine aminotransferase;       
   20::399     2e-86  43%  403 aa  ARGD_VIBPA RecName: Full=Acetylornithine aminotransferase;       
   11::398     3e-86  43%  402 aa  ASTC_PHOLL RecName: Full=Succinylornithine transaminase;       
   18::395     9e-86  43%  395 aa  ARGD_METMA RecName: Full=Acetylornithine aminotransferase;       
    2::376     1e-85  46%  386 aa  ARGD_LISMO RecName: Full=Acetylornithine aminotransferase;       
   18::395     2e-85  42%  395 aa  ARGD_METAC RecName: Full=Acetylornithine aminotransferase;       
   14::398     1e-84  42%  414 aa  ASTC_YERE8 RecName: Full=Succinylornithine transaminase;       
    4::369     1e-84  43%  392 aa  ASTC_CAUCR RecName: Full=Succinylornithine transaminase;       
    8::376     2e-84  43%  399 aa  ARGD_AGRT5 RecName: Full=Acetylornithine aminotransferase;       
   28::399     2e-83  42%  405 aa  ARGD_SHEON RecName: Full=Acetylornithine aminotransferase;       
   27::412     2e-83  43%  420 aa  ARGD_SYNPX RecName: Full=Acetylornithine aminotransferase;       
    9::372     4e-83  43%  399 aa  ARGD_RHIME RecName: Full=Acetylornithine aminotransferase;       
   11::384     5e-83  45%  398 aa  ARGD2_BRAJA RecName: Full=Acetylornithine aminotransferase 2;      
    9::392     2e-82  46%  399 aa  ARGD_RALSO RecName: Full=Acetylornithine aminotransferase;       
   24::402     5e-82  42%  415 aa  ARGD_PROMP RecName: Full=Acetylornithine aminotransferase;       
    4::390     2e-81  42%  393 aa  ARGD_WOLSU RecName: Full=Acetylornithine aminotransferase;       
    8::386     2e-81  44%  402 aa  ARGD_COREF RecName: Full=Acetylornithine aminotransferase;       
    1::390     3e-81  37%  400 aa  ARGD_CHLTE RecName: Full=Acetylornithine aminotransferase;       
    2::376     4e-81  45%  384 aa  ARGD_LISIN RecName: Full=Acetylornithine aminotransferase;       
   14::337     9e-81  49%  408 aa  ARGD_XANCP RecName: Full=Acetylornithine aminotransferase;       
    6::388     9e-81  43%  400 aa  ARGD2_PSESM RecName: Full=Acetylornithine aminotransferase 2;      
   17::400     4e-80  40%  408 aa  ARGD_BUCAI RecName: Full=Acetylornithine/succinyldiaminopimelate
    5::402     1e-79  42%  411 aa  ARGD_XYLFA RecName: Full=Acetylornithine aminotransferase;       
    4::378     2e-79  40%  386 aa  ARGD_BACAN RecName: Full=Acetylornithine aminotransferase;       
    5::402     3e-79  42%  411 aa  ARGD_XYLFT RecName: Full=Acetylornithine aminotransferase;       
   51::452     3e-79  44%  466 aa  ARGD_DEBHA RecName: Full=Acetylornithine aminotransferase,
    9::386     3e-79  46%  391 aa  ARGD_CORGL RecName: Full=Acetylornithine aminotransferase;       
   63::439     5e-79  43%  461 aa  ARGD_NEUCR RecName: Full=Acetylornithine aminotransferase,
    4::378     1e-78  39%  386 aa  ARGD_BACCR RecName: Full=Acetylornithine aminotransferase;       
   13::404     2e-78  40%  411 aa  ARGD_YARLI RecName: Full=Acetylornithine aminotransferase,
   29::394     7e-78  40%  404 aa  ARGD_BUCAP RecName: Full=Acetylornithine/succinyldiaminopimelate
    4::392     4e-77  41%  396 aa  OAT2_STAAW RecName: Full=Ornithine aminotransferase 2;       
    4::392     4e-77  41%  396 aa  OAT2_STAAS RecName: Full=Ornithine aminotransferase 2;       
    4::392     4e-77  41%  396 aa  OAT2_STAAR RecName: Full=Ornithine aminotransferase 2;       
    4::392     4e-77  41%  396 aa  OAT2_STAAN RecName: Full=Ornithine aminotransferase 2;       
    4::392     4e-77  41%  396 aa  OAT2_STAAM RecName: Full=Ornithine aminotransferase 2;       
    4::392     4e-77  41%  396 aa  OAT2_STAAC RecName: Full=Ornithine aminotransferase 2;       
    7::381     4e-77  41%  393 aa  ARGD1_BORPA RecName: Full=Acetylornithine aminotransferase 1;      
    7::381     4e-77  41%  393 aa  ARGD1_BORBR RecName: Full=Acetylornithine aminotransferase 1;      
    4::393     6e-77  39%  396 aa  OAT_STACT RecName: Full=Ornithine aminotransferase;       
    4::388     8e-77  39%  396 aa  OAT2_STAS1 RecName: Full=Ornithine aminotransferase 2;       
   49::448     1e-76  39%  453 aa  ARGD_DICDI RecName: Full=Probable acetylornithine aminotransferase,
    6::390     1e-76  39%  393 aa  ARGD_CAMJE RecName: Full=Acetylornithine aminotransferase;       
    4::385     1e-75  39%  394 aa  OAT1_STAAW RecName: Full=Ornithine aminotransferase 1;       
    4::385     1e-75  39%  394 aa  OAT1_STAAS RecName: Full=Ornithine aminotransferase 1;       
    4::385     1e-75  39%  394 aa  OAT1_STAAN RecName: Full=Ornithine aminotransferase 1;       
    4::385     1e-75  39%  394 aa  OAT1_STAAM RecName: Full=Ornithine aminotransferase 1;       
    4::385     1e-75  39%  394 aa  OAT1_STAAC RecName: Full=Ornithine aminotransferase 1;       
   12::403     2e-75  39%  406 aa  ARGD_LEPIN RecName: Full=Acetylornithine aminotransferase;       
   12::403     2e-75  39%  406 aa  ARGD_LEPIC RecName: Full=Acetylornithine aminotransferase;       
    7::381     2e-75  40%  393 aa  ARGD1_BORPE RecName: Full=Acetylornithine aminotransferase 1;      
    4::385     3e-75  39%  394 aa  OAT1_STAAR RecName: Full=Ornithine aminotransferase 1;       
   14::337     2e-74  47%  408 aa  ARGD_XANAC RecName: Full=Acetylornithine aminotransferase;       
   11::389     2e-74  41%  405 aa  ARGD_CAUCR RecName: Full=Acetylornithine aminotransferase;       
    6::393     2e-74  39%  398 aa  OAT_GEOSW RecName: Full=Ornithine aminotransferase;       
    7::398     8e-74  36%  401 aa  OAT_BACSU RecName: Full=Ornithine aminotransferase;       
    4::392     2e-73  40%  396 aa  OAT_STAES RecName: Full=Ornithine aminotransferase;       
    4::392     2e-73  40%  396 aa  OAT_STAEQ RecName: Full=Ornithine aminotransferase;       
    4::393     1e-72  39%  397 aa  OAT_MACCJ RecName: Full=Ornithine aminotransferase;       
    7::387     3e-72  40%  403 aa  ARGD_STRAW RecName: Full=Acetylornithine aminotransferase;       
   17::414     3e-72  38%  423 aa  ARGD_ASHGO RecName: Full=Acetylornithine aminotransferase,
   35::430     3e-72  35%  432 aa  OAT_DROAN RecName: Full=Ornithine aminotransferase, mitochondrial; 
    9::407     4e-72  37%  414 aa  OAT_PLAFD RecName: Full=Ornithine aminotransferase;       
    9::407     4e-72  37%  414 aa  OAT_PLAF7 RecName: Full=Ornithine aminotransferase;       
   37::429     7e-72  35%  431 aa  OAT_DROME RecName: Full=Ornithine aminotransferase, mitochondrial; 
   19::389     1e-71  43%  404 aa  ARGD_MYCLE RecName: Full=Acetylornithine aminotransferase;       
   11::394     2e-71  42%  396 aa  ARGD2_BORPE RecName: Full=Acetylornithine aminotransferase 2;      
    1::377     3e-71  40%  402 aa  ARGD_STRCO RecName: Full=Acetylornithine aminotransferase;       
    4::377     5e-71  40%  377 aa  ARGD_LACLA RecName: Full=Acetylornithine aminotransferase;       
   11::394     5e-71  42%  396 aa  ARGD2_BORBR RecName: Full=Acetylornithine aminotransferase 2;      
    3::371     1e-70  40%  375 aa  ARGD_STAEQ RecName: Full=Acetylornithine aminotransferase;       
    3::371     1e-70  40%  375 aa  ARGD_STAES RecName: Full=Acetylornithine aminotransferase;       
   20::394     1e-70  42%  396 aa  ARGD2_BORPA RecName: Full=Acetylornithine aminotransferase 2;      
   19::407     7e-70  36%  414 aa  OAT_PLACH RecName: Full=Ornithine aminotransferase;       
   16::389     9e-70  40%  400 aa  ARGD_MYCTU RecName: Full=Acetylornithine aminotransferase;       
   16::389     9e-70  40%  400 aa  ARGD_MYCBO RecName: Full=Acetylornithine aminotransferase;       
    1::382     1e-69  37%  400 aa  ARGD_STRCL RecName: Full=Acetylornithine aminotransferase;       
   47::369     3e-69  41%  441 aa  ARGD_SCHPO RecName: Full=Probable acetylornithine aminotransferase,
   15::396     3e-69  36%  398 aa  OAT_OCEIH RecName: Full=Ornithine aminotransferase;       
   19::411     4e-69  35%  422 aa  OAT_CAEEL RecName: Full=Probable ornithine aminotransferase,
   21::418     4e-69  38%  423 aa  ARGD_KLULA RecName: Full=Acetylornithine aminotransferase,
    7::393     6e-69  37%  404 aa  OAT_BRAJA RecName: Full=Ornithine aminotransferase;       
   10::392     8e-69  36%  394 aa  OAT1_STAS1 RecName: Full=Ornithine aminotransferase 1;       
    2::395     2e-68  36%  396 aa  OAT_BACCQ RecName: Full=Ornithine aminotransferase;       
    2::395     1e-67  36%  396 aa  OAT_BACC3 RecName: Full=Ornithine aminotransferase;       
    2::395     2e-67  36%  396 aa  OAT_BACAN RecName: Full=Ornithine aminotransferase;       
    2::395     2e-67  36%  396 aa  OAT_BACAC RecName: Full=Ornithine aminotransferase;       
    2::395     2e-67  36%  396 aa  OAT_BACAA RecName: Full=Ornithine aminotransferase;       
   19::391     4e-67  38%  411 aa  OAT_BORPE RecName: Full=Ornithine aminotransferase;       
   19::391     4e-67  38%  411 aa  OAT_BORPA RecName: Full=Ornithine aminotransferase;       
   19::391     4e-67  38%  411 aa  OAT_BORBR RecName: Full=Ornithine aminotransferase;       
    2::395     4e-67  35%  396 aa  OAT_BACCR RecName: Full=Ornithine aminotransferase;       
   22::422     7e-67  40%  431 aa  ARGD_BIFLO RecName: Full=Acetylornithine aminotransferase;       
   23::421     2e-66  36%  423 aa  ARGD_YEAST RecName: Full=Acetylornithine aminotransferase,
    7::378     2e-66  35%  387 aa  ARGD_SULTO RecName: Full=Acetylornithine/acetyl-lysine
   19::407     3e-66  35%  414 aa  OAT_PLAYO RecName: Full=Ornithine aminotransferase;       
    5::350     3e-66  40%  362 aa  ARGD_PYRKO RecName: Full=Acetylornithine aminotransferase;       
    2::374     4e-66  38%  387 aa  ARGD_LACPL RecName: Full=Acetylornithine aminotransferase;       
    8::390     8e-66  34%  398 aa  OAT_BACHD RecName: Full=Ornithine aminotransferase;       
   49::437     3e-65  37%  439 aa  OAT_BOVIN RecName: Full=Ornithine aminotransferase, mitochondrial; 
    5::345     3e-65  40%  366 aa  ARGD_PYRHO RecName: Full=Acetylornithine/acetyl-lysine
    5::350     3e-65  40%  366 aa  ARGD_PYRFU RecName: Full=Acetylornithine/acetyl-lysine
   24::382     4e-65  38%  395 aa  ARGD_THET8 RecName: Full=Acetylornithine/acetyl-lysine
   39::437     5e-65  36%  439 aa  OAT_RAT RecName: Full=Ornithine aminotransferase, mitochondrial;   
    7::397     5e-65  32%  399 aa  OAT_BREBN RecName: Full=Ornithine aminotransferase;       
    5::347     5e-65  40%  364 aa  ARGD_PYRAB RecName: Full=Acetylornithine/acetyl-lysine
   24::382     7e-65  38%  395 aa  ARGD_THET2 RecName: Full=Acetylornithine/acetyl-lysine
   12::421     1e-64  34%  438 aa  OAT_SCHPO RecName: Full=Probable ornithine aminotransferase;       
   39::437     2e-64  35%  439 aa  OAT_MOUSE RecName: Full=Ornithine aminotransferase, mitochondrial; 
    6::394     6e-64  33%  400 aa  OAT_EXISA RecName: Full=Ornithine aminotransferase;       
    7::395     1e-63  37%  429 aa  ARGD_DEIRA RecName: Full=Acetylornithine/acetyl-lysine
   40::437     1e-62  35%  439 aa  OAT_HUMAN RecName: Full=Ornithine aminotransferase, mitochondrial; 
   13::409     9e-62  33%  416 aa  OAT_DICDI RecName: Full=Probable ornithine aminotransferase;       
   78::449     1e-61  41%  465 aa  PAT_ENTS8 RecName: Full=Putrescine aminotransferase;       
   78::449     2e-60  39%  459 aa  PAT_ECOL5 RecName: Full=Putrescine aminotransferase;       
   26::421     2e-60  35%  427 aa  ARGD_CANGA RecName: Full=Acetylornithine aminotransferase,
   78::440     4e-60  41%  459 aa  PAT_KLEP3 RecName: Full=Putrescine aminotransferase;       
   17::411     6e-60  34%  454 aa  OAT_EMENI RecName: Full=Ornithine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECOUT RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECOSE RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECOLU RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECOLI RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECOK1 RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECOHS RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECODH RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECOBW RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECO81 RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECO5E RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECO57 RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECO55 RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECO45 RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECO27 RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECO24 RecName: Full=Putrescine aminotransferase;       
   78::440     1e-59  41%  459 aa  PAT_KLEP7 RecName: Full=Putrescine aminotransferase;       
   78::449     1e-59  39%  459 aa  PAT_ECOLC RecName: Full=Putrescine aminotransferase;       
   78::449     2e-59  39%  459 aa  PAT_ESCF3 RecName: Full=Putrescine aminotransferase;       
    6::421     2e-59  35%  424 aa  OAT_YEAST RecName: Full=Ornithine aminotransferase;       
   78::449     2e-59  39%  459 aa  PAT_SHIFL RecName: Full=Putrescine aminotransferase;       
   78::449     2e-59  39%  459 aa  PAT_SHIF8 RecName: Full=Putrescine aminotransferase;       
   78::449     3e-59  39%  459 aa  PAT_ECOL6 RecName: Full=Putrescine aminotransferase;       
   78::449     3e-59  39%  459 aa  PAT_ECO7I RecName: Full=Putrescine aminotransferase;       
   78::440     4e-59  40%  459 aa  PAT_ECOSM RecName: Full=Putrescine aminotransferase;       
   78::449     5e-59  39%  459 aa  PAT_ECO8A RecName: Full=Putrescine aminotransferase;       
   78::449     7e-59  40%  459 aa  PAT_SALPK RecName: Full=Putrescine aminotransferase;       
   78::449     7e-59  40%  459 aa  PAT_SALPA RecName: Full=Putrescine aminotransferase;       
    8::380     9e-59  38%  383 aa  ARGD_PYRAE RecName: Full=Acetylornithine/acetyl-lysine
   78::449     1e-58  39%  459 aa  PAT_SHISS RecName: Full=Putrescine aminotransferase;       
   78::449     1e-58  40%  459 aa  PAT_SALTI RecName: Full=Putrescine aminotransferase;       
   78::449     1e-58  40%  459 aa  PAT_SALHS RecName: Full=Putrescine aminotransferase;       
   78::449     3e-58  39%  459 aa  PAT_SALTY RecName: Full=Putrescine aminotransferase;       
   78::449     3e-58  39%  459 aa  PAT_SALSV RecName: Full=Putrescine aminotransferase;       
   78::449     3e-58  39%  459 aa  PAT_SALNS RecName: Full=Putrescine aminotransferase;       
   78::449     3e-58  39%  459 aa  PAT_SALG2 RecName: Full=Putrescine aminotransferase;       
   78::449     3e-58  39%  459 aa  PAT_SALEP RecName: Full=Putrescine aminotransferase;       
   78::449     3e-58  39%  459 aa  PAT_SALDC RecName: Full=Putrescine aminotransferase;       
   78::449     3e-58  39%  459 aa  PAT_SALA4 RecName: Full=Putrescine aminotransferase;       
   78::440     3e-58  39%  459 aa  PAT_CITK8 RecName: Full=Putrescine aminotransferase;       
   78::449     5e-58  39%  459 aa  PAT_SALPC RecName: Full=Putrescine aminotransferase;       
   78::449     5e-58  39%  459 aa  PAT_SALCH RecName: Full=Putrescine aminotransferase;       
   78::449     6e-58  39%  459 aa  PAT_SALPB RecName: Full=Putrescine aminotransferase;       
   27::433     8e-58  38%  445 aa  YKAB_BACPF RecName: Full=Uncharacterized aminotransferase in katA
   35::359     2e-57  45%  468 aa  PAT_ERWCT RecName: Full=Putrescine aminotransferase;       
    4::228     9e-57  52%  229 aa  ARGD_BACAM RecName: Full=Acetylornithine aminotransferase;       
   78::449     1e-56  38%  459 aa  PAT_SHIBS RecName: Full=Putrescine aminotransferase;       
   78::443     2e-56  40%  459 aa  PAT_ENT38 RecName: Full=Putrescine aminotransferase;       
   35::449     3e-56  37%  459 aa  PAT_SALAR RecName: Full=Putrescine aminotransferase;       
    3::419     4e-56  36%  426 aa  GABT_ECOLI RecName: Full=4-aminobutyrate aminotransferase;       
   34::434     6e-56  35%  436 aa  GABT_BACSU RecName: Full=Probable 4-aminobutyrate aminotransferase;
   40::450     2e-54  36%  450 aa  YHXA_BACSU RecName: Full=Uncharacterized aminotransferase yhxA;    
   15::378     2e-54  32%  388 aa  ARGD_SULSO RecName: Full=Acetylornithine/acetyl-lysine
   78::474     5e-54  37%  477 aa  AGT22_ARATH RecName: Full=Alanine--glyoxylate aminotransferase 2
   30::419     4e-50  35%  421 aa  PUUE_ECOLI RecName: Full=4-aminobutyrate aminotransferase;       
   63::478     7e-49  34%  481 aa  AGT23_ARATH RecName: Full=Alanine--glyoxylate aminotransferase 2
    8::367     3e-47  36%  454 aa  DAT_HAEIN RecName: Full=Diaminobutyrate--2-oxoglutarate
   32::453     1e-46  33%  467 aa  Y4UB_RHISN RecName: Full=Uncharacterized aminotransferase y4uB;    
   41::407     3e-46  35%  424 aa  Y1815_ARCFU RecName: Full=Uncharacterized aminotransferase AF_1815;
   24::414     1e-45  35%  436 aa  ECTB_NOCFA RecName: Full=Diaminobutyrate--2-oxoglutarate
   40::371     2e-45  32%  426 aa  OAT_VIGAC RecName: Full=Ornithine aminotransferase;       
   33::437     1e-44  32%  448 aa  YFZ7_SCHPO RecName: Full=Uncharacterized aminotransferase
    7::450     1e-44  36%  456 aa  TPA_BILWA RecName: Full=Taurine--pyruvate aminotransferase;        
   65::505     1e-44  34%  513 aa  AGT2_MOUSE RecName: Full=Alanine--glyoxylate aminotransferase 2,
   74::469     3e-44  33%  476 aa  AGT21_ARATH RecName: Full=Alanine--glyoxylate aminotransferase 2
   77::505     2e-43  32%  514 aa  AGT2_PONAB RecName: Full=Alanine--glyoxylate aminotransferase 2,
   77::505     2e-43  32%  514 aa  AGT2_HUMAN RecName: Full=Alanine--glyoxylate aminotransferase 2,
   77::506     7e-43  35%  514 aa  AGT2_BOVIN RecName: Full=Alanine--glyoxylate aminotransferase 2,
   34::435     1e-42  31%  445 aa  DAT_ACIBA RecName: Full=Diaminobutyrate--2-oxoglutarate
   75::503     3e-42  33%  512 aa  AGT2_RAT RecName: Full=Alanine--glyoxylate aminotransferase 2,
   11::292     5e-42  35%  388 aa  ARGD_AERPE RecName: Full=Acetylornithine/acetyl-lysine
   13::416     2e-41  31%  423 aa  ECTB_CHRSD RecName: Full=Diaminobutyrate--2-oxoglutarate
   32::329     5e-41  36%  429 aa  GSA2_BREBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   17::331     7e-41  34%  427 aa  GSA_METMP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::341     1e-40  37%  427 aa  GSA_SHEAM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   48::461     1e-40  35%  470 aa  RHBA_RHIME RecName: Full=Diaminobutyrate--2-oxoglutarate
   33::346     2e-40  38%  431 aa  GSA_CHLCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::341     3e-40  36%  430 aa  GSA_SHEON RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::341     4e-40  36%  428 aa  GSA_SHESH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::341     4e-40  36%  429 aa  GSA_SHEPW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::341     4e-40  34%  430 aa  GSA_NATTJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::318     4e-40  38%  429 aa  GSA2_GEOTN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   27::341     6e-40  35%  428 aa  GSA_SHEWM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::318     6e-40  37%  429 aa  GSA2_GEOKA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   27::341     7e-40  35%  430 aa  GSA_SHESA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::341     7e-40  35%  429 aa  GSA_SHEPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::341     7e-40  36%  428 aa  GSA_SHELP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::332     7e-40  36%  427 aa  GSA_GEOSF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::343     1e-39  34%  427 aa  GSA_GEOUR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::341     1e-39  35%  430 aa  GSA_SHESM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::319     1e-39  38%  431 aa  GSA_CHLPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::341     2e-39  35%  430 aa  GSA_SHESR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::319     3e-39  37%  431 aa  GSA_PROA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    2::410     3e-39  30%  411 aa  ECTB_VIBCH RecName: Full=Diaminobutyrate--2-oxoglutarate
   26::429     3e-39  33%  433 aa  DGDA_BURCE RecName: Full=2,2-dialkylglycine decarboxylase;       
   30::341     4e-39  35%  429 aa  GSA_SHEHH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   17::321     4e-39  34%  427 aa  GSA_METM7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   20::321     4e-39  35%  432 aa  GSA_META3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    2::418     4e-39  32%  430 aa  BIOA_HAEIN RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   32::351     5e-39  34%  430 aa  GSA_THERP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::320     5e-39  37%  433 aa  GSA_SHEDO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::319     6e-39  37%  428 aa  GSA_THISH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   17::321     6e-39  35%  427 aa  GSA_METM6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::440     6e-39  30%  499 aa  AT2L1_MOUSE RecName: Full=Alanine--glyoxylate aminotransferase
   19::409     8e-39  31%  427 aa  ECTB_WOLSU RecName: Full=Diaminobutyrate--2-oxoglutarate
   27::341     1e-38  36%  428 aa  GSA_SHEFN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::345     1e-38  32%  424 aa  GSA_NITMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::443     1e-38  32%  455 aa  BIOA_BACSH RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   17::321     2e-38  35%  427 aa  GSA_METM5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::326     2e-38  37%  432 aa  GSA_DESAP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::420     2e-38  30%  426 aa  ECTB_OCEIH RecName: Full=Diaminobutyrate--2-oxoglutarate
   33::322     3e-38  37%  431 aa  GSA_PELPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     4e-38  37%  427 aa  GSA_PSEA7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   17::318     4e-38  34%  427 aa  GSA_METVS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   19::410     5e-38  32%  416 aa  ECTB_VIRPA RecName: Full=Diaminobutyrate--2-oxoglutarate
   30::319     7e-38  36%  427 aa  GSA_PSEAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     7e-38  36%  427 aa  GSA_PSEAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     7e-38  36%  427 aa  GSA_PSEA8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::325     7e-38  37%  426 aa  GSA_METJA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::326     7e-38  35%  432 aa  GSA_DESRM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   38::442     9e-38  32%  449 aa  GABT_MYCTU RecName: Full=4-aminobutyrate aminotransferase;       
   38::442     9e-38  32%  449 aa  GABT_MYCBO RecName: Full=4-aminobutyrate aminotransferase;       
   44::352     1e-37  34%  436 aa  GSA_SYNJB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::344     1e-37  35%  429 aa  GSA_GRAFK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::318     1e-37  37%  429 aa  GSA1_LISW6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   44::352     2e-37  34%  436 aa  GSA_SYNJA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::341     2e-37  34%  430 aa  GSA_SHESW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::341     2e-37  34%  430 aa  GSA_SHEPC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::341     2e-37  34%  430 aa  GSA_SHEB9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::341     2e-37  34%  430 aa  GSA_SHEB8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::341     2e-37  34%  430 aa  GSA_SHEB5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::341     2e-37  34%  430 aa  GSA_SHEB2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   25::328     2e-37  36%  423 aa  GSA_METST RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
  152::468     2e-37  33%  484 aa  YAV5_SCHPO RecName: Full=Uncharacterized aminotransferase
   37::446     2e-37  33%  453 aa  BIOA_AQUAE RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   33::331     3e-37  36%  426 aa  GSA_THICR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::323     3e-37  38%  436 aa  GSA_HELMI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::318     3e-37  37%  429 aa  GSA1_LISIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::441     3e-37  31%  509 aa  AT2L1_XENLA RecName: Full=Alanine--glyoxylate aminotransferase
   41::438     5e-37  30%  494 aa  AGT2L_DROME RecName: Full=Alanine--glyoxylate aminotransferase
   52::444     6e-37  28%  448 aa  Y4QG_RHISN RecName: Full=Uncharacterized aminotransferase y4qG;    
   45::352     6e-37  35%  439 aa  GSA_RUBXD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::341     6e-37  35%  427 aa  GSA_CLOTH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::325     8e-37  34%  428 aa  GSA_DESAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::346     8e-37  35%  431 aa  GSA_CHLTE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::313     8e-37  35%  427 aa  GSA_CALS8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::318     8e-37  36%  429 aa  GSA2_LISMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::440     8e-37  31%  499 aa  AT2L1_HUMAN RecName: Full=Alanine--glyoxylate aminotransferase
   30::325     1e-36  36%  427 aa  GSA_PSEFS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::322     1e-36  36%  431 aa  GSA_CHLL2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   41::342     1e-36  36%  429 aa  GSA1_STACT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::318     1e-36  37%  429 aa  GSA1_LISMO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   13::461     1e-36  34%  461 aa  BIOA_METJA RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   36::328     1e-36  35%  433 aa  GSA_PROMP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   39::328     1e-36  38%  433 aa  GSA_PROMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::328     1e-36  35%  434 aa  GSA_PROM9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::337     1e-36  33%  431 aa  GSA_PELLD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::332     1e-36  36%  427 aa  GSA_PELCD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::351     2e-36  33%  433 aa  GSA_SYNPW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::318     2e-36  37%  429 aa  GSA1_LISMF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::318     2e-36  37%  429 aa  GSA1_LISMC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     2e-36  35%  428 aa  GSA1_BACC2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   32::324     2e-36  35%  428 aa  GSA_SYNS9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::341     2e-36  34%  428 aa  GSA_PERMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::341     2e-36  33%  427 aa  GSA_GEOSL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::341     2e-36  35%  429 aa  GSA2_BACCR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     2e-36  35%  429 aa  GSA2_BACC4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   26::419     2e-36  33%  423 aa  ECTB_STRAW RecName: Full=Diaminobutyrate--2-oxoglutarate
   16::335     3e-36  37%  437 aa  GSA_THEEB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   42::334     3e-36  35%  438 aa  GSA_SYNS3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     3e-36  34%  427 aa  GSA_PSEF5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   39::328     3e-36  35%  432 aa  GSA_PROMT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::324     3e-36  35%  428 aa  GSA_PROM1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   29::314     3e-36  37%  417 aa  GSA_METS5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::346     3e-36  34%  432 aa  GSA_CHLT3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::341     3e-36  35%  429 aa  GSA2_BACWK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     3e-36  35%  429 aa  GSA2_BACHK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     3e-36  35%  429 aa  GSA2_BACCZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     3e-36  35%  429 aa  GSA2_BACCQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     3e-36  35%  429 aa  GSA2_BACC7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     3e-36  35%  429 aa  GSA2_BACC3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     3e-36  35%  429 aa  GSA2_BACC0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     3e-36  35%  429 aa  GSA2_BACAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     3e-36  35%  429 aa  GSA2_BACAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     3e-36  35%  429 aa  GSA2_BACAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     3e-36  35%  429 aa  GSA2_BACAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   10::328     4e-36  34%  433 aa  GSA_PROMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::348     4e-36  34%  428 aa  GSA_PROMM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   39::328     4e-36  36%  432 aa  GSA_PROM4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::348     4e-36  34%  428 aa  GSA_PROM3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::328     4e-36  34%  433 aa  GSA_PROM2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::328     4e-36  35%  433 aa  GSA_PROM0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::319     4e-36  34%  427 aa  GSA_MARMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::322     4e-36  36%  431 aa  GSA_CHLP8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::343     4e-36  36%  430 aa  GSA2_BACSK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     4e-36  35%  429 aa  GSA2_BACC1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   23::417     4e-36  30%  426 aa  ECTB_BACSK RecName: Full=Diaminobutyrate--2-oxoglutarate
  335::729     4e-36  33%  741 aa  BIOB_BACTN RecName: Full=Biotin synthase;       
   32::343     5e-36  33%  427 aa  GSA_SULAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::317     5e-36  35%  417 aa  GSA_SOLUE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::328     5e-36  36%  433 aa  GSA_PROM5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::341     5e-36  33%  428 aa  GSA_PELPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     5e-36  35%  432 aa  GSA_HAES1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::318     5e-36  35%  431 aa  GSA2_ANOFW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   28::451     7e-36  32%  459 aa  YGD3_SCHPO RecName: Full=Uncharacterized aminotransferase
   30::319     7e-36  34%  429 aa  GSA_PSEMY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::326     7e-36  32%  426 aa  GSA_ALTMD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::429     7e-36  30%  497 aa  AT2L1_BOVIN RecName: Full=Alanine--glyoxylate aminotransferase
   30::347     9e-36  35%  426 aa  GSA_YERPY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     9e-36  35%  426 aa  GSA_YERPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     9e-36  35%  426 aa  GSA_YERPP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     9e-36  35%  426 aa  GSA_YERPN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     9e-36  35%  426 aa  GSA_YERPG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     9e-36  35%  426 aa  GSA_YERPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     9e-36  35%  426 aa  GSA_YERPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     9e-36  35%  426 aa  GSA_YERPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     9e-36  35%  426 aa  GSA_YERP3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::343     9e-36  33%  427 aa  GSA_THEYD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     9e-36  35%  427 aa  GSA_PSEU5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::329     9e-36  35%  437 aa  GSA_MOOTA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     9e-36  35%  426 aa  GSA_KLEP3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::347     1e-35  33%  431 aa  GSA_VIBVY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::347     1e-35  33%  431 aa  GSA_VIBVU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     1e-35  34%  427 aa  GSA_PSEU2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     1e-35  36%  427 aa  GSA_PSE14 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::315     1e-35  36%  427 aa  GSA_NITSB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     1e-35  35%  432 aa  GSA_HAES2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::316     1e-35  34%  434 aa  GSA_FUSNN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     1e-35  33%  425 aa  GSA_DESAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::344     1e-35  35%  430 aa  GSA2_LYSSC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   36::343     1e-35  35%  429 aa  GSA2_BACHD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   24::415     1e-35  29%  427 aa  ECTB_MARHA RecName: Full=Diaminobutyrate--2-oxoglutarate
   32::324     1e-35  35%  428 aa  GSA_SYNSC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::324     1e-35  35%  429 aa  GSA_HERA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::314     1e-35  37%  422 aa  GSA_CLOK5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::314     1e-35  37%  422 aa  GSA_CLOK1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   24::415     1e-35  30%  427 aa  ECTB_BACHD RecName: Full=Diaminobutyrate--2-oxoglutarate
   27::319     2e-35  35%  432 aa  GSA_VIBCM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::319     2e-35  35%  432 aa  GSA_VIBCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::319     2e-35  35%  432 aa  GSA_VIBC3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::349     2e-35  33%  428 aa  GSA_SULSY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::346     2e-35  32%  430 aa  GSA_DESPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::322     2e-35  37%  431 aa  GSA_CHLPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   26::419     2e-35  32%  423 aa  ECTB_STRCO RecName: Full=Diaminobutyrate--2-oxoglutarate
   31::345     2e-35  35%  431 aa  GSA_TOLAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     2e-35  35%  426 aa  GSA_KLEP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     2e-35  37%  427 aa  GSA_BORPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     2e-35  37%  427 aa  GSA_BORBR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::313     2e-35  34%  426 aa  GSA_ANATD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::342     2e-35  34%  429 aa  GSA2_BACA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   32::346     3e-35  33%  428 aa  GSA_SYNPX RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::329     3e-35  34%  427 aa  GSA_MANSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::343     3e-35  31%  427 aa  GSA_GEOBB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   38::349     3e-35  34%  433 aa  GSA_CYAP8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   38::349     3e-35  34%  433 aa  GSA_CYAA5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::341     3e-35  34%  430 aa  GSA_BACSU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::348     3e-35  32%  432 aa  GSA_ANAVT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_SHISS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     4e-35  35%  427 aa  GSA_PSESM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::325     4e-35  35%  427 aa  GSA_PSEPF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::348     4e-35  32%  432 aa  GSA_NOSP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::319     4e-35  35%  426 aa  GSA_ERWT9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECOUT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECOSE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECOLU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECOLC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECOL6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECOL5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECOK1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECOHS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECO8A RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECO81 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECO55 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECO45 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECO27 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     4e-35  36%  426 aa  GSA_ECO24 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::346     4e-35  38%  430 aa  GSA_DESHY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::346     4e-35  38%  430 aa  GSA_DESHD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::336     4e-35  35%  427 aa  GSA_ACTSZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     6e-35  36%  426 aa  GSA_ECO5E RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     6e-35  36%  426 aa  GSA_ECO57 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     7e-35  34%  431 aa  GSA_VIBF1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::344     7e-35  33%  429 aa  GSA_SERP5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::329     7e-35  33%  432 aa  GSA_GLOVI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::322     7e-35  35%  426 aa  GSA_ERWCT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   41::317     7e-35  36%  428 aa  GSA1_STAAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   13::413     7e-35  29%  421 aa  ECTB_HALEL RecName: Full=Diaminobutyrate--2-oxoglutarate
  335::732     7e-35  32%  748 aa  BIOB_BACFR RecName: Full=Biotin synthase;       
   27::347     9e-35  34%  431 aa  GSA_VIBPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::347     9e-35  34%  427 aa  GSA_PHOLL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   38::330     9e-35  34%  433 aa  GSA_CYAP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     9e-35  37%  427 aa  GSA_BORPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::348     9e-35  32%  432 aa  GSA_ANASP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::317     9e-35  36%  429 aa  GSA2_BACCN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::319     1e-34  35%  431 aa  GSA_VIBFM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::321     1e-34  35%  428 aa  GSA_GEOLS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     1e-34  35%  426 aa  GSA_CITK8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::312     1e-34  36%  429 aa  GSA_ALHEH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::348     1e-34  34%  432 aa  GSA_ACAM1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
  335::732     1e-34  32%  748 aa  BIOB_BACFN RecName: Full=Biotin synthase;       
   38::330     2e-34  35%  433 aa  GSA_SYNY3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::325     2e-34  36%  434 aa  GSA_PELTS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::333     2e-34  34%  427 aa  GSA_HAEPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::315     2e-34  35%  422 aa  GSA_DESDG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::315     2e-34  34%  426 aa  GSA_CELJU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    2::409     2e-34  26%  421 aa  ECTB_VIBPA RecName: Full=Diaminobutyrate--2-oxoglutarate
   20::440     2e-34  31%  448 aa  BIOK_BACSU RecName: Full=Lysine-8-amino-7-oxononanoate
   30::347     2e-34  34%  426 aa  GSA_SALTY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     2e-34  34%  426 aa  GSA_SALPC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     2e-34  34%  426 aa  GSA_SALCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::322     2e-34  35%  426 aa  GSA_PECCP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::347     2e-34  34%  435 aa  GSA_COXBU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::347     2e-34  34%  435 aa  GSA_COXBR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::347     2e-34  34%  435 aa  GSA_COXBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::347     2e-34  34%  435 aa  GSA_COXB2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::347     2e-34  34%  435 aa  GSA_COXB1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   29::309     2e-34  34%  450 aa  GSA_CAMHC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::319     2e-34  34%  434 aa  GSA2_EXISA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   41::317     2e-34  36%  428 aa  GSA1_STAAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   46::465     2e-34  30%  467 aa  AGT2L_CAEEL RecName: Full=Alanine--glyoxylate aminotransferase
   38::330     3e-34  33%  434 aa  GSA_SYNR3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     3e-34  35%  426 aa  GSA_SHIDS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     3e-34  35%  426 aa  GSA_SHIBS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     3e-34  35%  426 aa  GSA_SHIB3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     3e-34  34%  426 aa  GSA_SALPK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     3e-34  34%  426 aa  GSA_SALPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     3e-34  34%  426 aa  GSA_SALHS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   26::309     3e-34  33%  420 aa  GSA_NAUPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::347     3e-34  34%  426 aa  GSA_ENT38 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     3e-34  35%  426 aa  GSA_ECOSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     3e-34  35%  426 aa  GSA_ECOLI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     3e-34  35%  426 aa  GSA_ECODH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     3e-34  35%  426 aa  GSA_ECOBW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     3e-34  35%  426 aa  GSA_ECO7I RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::444     3e-34  30%  492 aa  AT2L1_DANRE RecName: Full=Alanine--glyoxylate aminotransferase
   25::311     4e-34  35%  420 aa  GSA_PICTO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::329     4e-34  34%  427 aa  GSA_PASMU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::347     4e-34  35%  427 aa  GSA_CLOBB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   41::317     4e-34  36%  428 aa  GSA1_STAAW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   41::317     4e-34  36%  428 aa  GSA1_STAAS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   41::317     4e-34  36%  428 aa  GSA1_STAAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   41::317     4e-34  36%  428 aa  GSA1_STAAM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   41::317     4e-34  36%  428 aa  GSA1_STAA9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   41::317     4e-34  36%  428 aa  GSA1_STAA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   41::317     4e-34  36%  428 aa  GSA1_STAA1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   31::426     4e-34  30%  467 aa  AT2L2_MOUSE RecName: Full=Alanine--glyoxylate aminotransferase
   32::321     5e-34  35%  429 aa  GSA_XANOR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::321     5e-34  35%  429 aa  GSA_XANOP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::321     5e-34  35%  429 aa  GSA_XANOM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::342     5e-34  33%  435 aa  GSA_NITEU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::346     5e-34  33%  426 aa  GSA_MARAV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   41::317     5e-34  36%  428 aa  GSA1_STAAU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   41::317     5e-34  36%  428 aa  GSA1_STAAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   41::317     5e-34  36%  428 aa  GSA1_STAAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   41::317     5e-34  36%  428 aa  GSA1_STAAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   41::317     5e-34  36%  428 aa  GSA1_STAA8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   41::317     5e-34  36%  428 aa  GSA1_STAA3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::347     6e-34  34%  426 aa  GSA_SALAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   20::322     6e-34  35%  425 aa  GSA_CHRVO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::323     6e-34  35%  427 aa  GSA_BORA1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::336     8e-34  34%  431 aa  GSA_VIBHB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::320     8e-34  34%  426 aa  GSA_PSEHT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::320     8e-34  35%  428 aa  GSA_PROMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   29::309     8e-34  38%  423 aa  GSA_METS3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   41::317     8e-34  36%  427 aa  GSA2_STAS1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::344     8e-34  33%  432 aa  GSA1_BACCZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    9::318     1e-33  34%  426 aa  GSA_SULIM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    9::318     1e-33  34%  426 aa  GSA_SULIA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     1e-33  35%  426 aa  GSA_SALEP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::315     1e-33  36%  429 aa  GSA_LEGPL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::315     1e-33  36%  429 aa  GSA_LEGPC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::315     1e-33  36%  428 aa  GSA_LEGPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::319     1e-33  34%  430 aa  GSA2_BACP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   35::346     1e-33  33%  434 aa  GSA2_BACC2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   35::346     1e-33  33%  434 aa  GSA1_BACHK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::344     1e-33  33%  432 aa  GSA1_BACCR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::344     1e-33  33%  432 aa  GSA1_BACC4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   35::346     1e-33  33%  434 aa  GSA1_BACC3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   35::346     1e-33  33%  434 aa  GSA1_BACC0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   35::346     1e-33  33%  434 aa  GSA1_BACAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   35::346     1e-33  33%  434 aa  GSA1_BACAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   35::346     1e-33  33%  434 aa  GSA1_BACAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   35::346     1e-33  33%  434 aa  GSA1_BACAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    9::318     1e-33  34%  426 aa  GSA_SULIY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    9::318     1e-33  34%  426 aa  GSA_SULIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    9::318     1e-33  34%  426 aa  GSA_SULIL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    9::318     1e-33  34%  426 aa  GSA_SULIK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     1e-33  35%  426 aa  GSA_SALTI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     1e-33  35%  426 aa  GSA_SALSV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     1e-33  35%  426 aa  GSA_SALPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     1e-33  35%  426 aa  GSA_SALNS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     1e-33  35%  426 aa  GSA_SALDC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::319     1e-33  34%  426 aa  GSA_HAHCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::320     1e-33  35%  426 aa  GSA_ENTS8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::344     1e-33  33%  432 aa  GSA1_BACWK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   29::341     2e-33  33%  420 aa  GSA_METTH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::331     2e-33  33%  437 aa  GSA_LEPCP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::347     2e-33  35%  427 aa  GSA_CLOBA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     2e-33  34%  426 aa  GSA_ACTPJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     2e-33  34%  426 aa  GSA_ACTP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     2e-33  34%  426 aa  GSA_ACTP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   38::443     2e-33  28%  446 aa  GABT_MYCLE RecName: Full=4-aminobutyrate aminotransferase;       
   32::320     2e-33  35%  431 aa  GSA_WOLSU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::325     2e-33  33%  433 aa  GSA_SYNFM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::333     2e-33  34%  418 aa  GSA_SULSO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::320     2e-33  34%  430 aa  GSA_SULDN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::317     2e-33  34%  426 aa  GSA_METCA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::315     2e-33  35%  429 aa  GSA_LEGPH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::321     3e-33  35%  429 aa  GSA_STRMK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::329     3e-33  35%  426 aa  GSA_SODGM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     3e-33  35%  426 aa  GSA_SALG2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::319     3e-33  32%  431 aa  GSA_PROVI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::303     3e-33  35%  427 aa  GSA_IDILO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   74::366     3e-33  32%  469 aa  GSA_HORVU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
   33::319     3e-33  34%  428 aa  GSA_HAMD5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     3e-33  35%  426 aa  GSA_ESCF3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   50::361     3e-33  31%  463 aa  GSA_CHLRE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
   31::313     3e-33  37%  424 aa  GSA_AZOSB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   41::317     3e-33  35%  427 aa  GSA1_STAES RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   41::317     3e-33  35%  427 aa  GSA1_STAEQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    8::419     3e-33  28%  426 aa  ECTB_BACPA RecName: Full=Diaminobutyrate--2-oxoglutarate
   35::333     4e-33  34%  434 aa  GSA1_BACCQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   35::333     4e-33  34%  434 aa  GSA1_BACC7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   35::333     4e-33  34%  434 aa  GSA1_BACC1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::322     5e-33  34%  426 aa  GSA_SHIFL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     5e-33  34%  426 aa  GSA_SHIF8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     5e-33  34%  426 aa  GSA_SALA4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::320     5e-33  34%  427 aa  GSA_EDWI9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::321     5e-33  34%  436 aa  GSA2_EXIS2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::319     7e-33  33%  432 aa  GSA_PHOPR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::345     7e-33  35%  431 aa  GSA2_BACLD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::322     9e-33  34%  426 aa  GSA_YERE8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::319     9e-33  33%  425 aa  GSA_NITMU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     9e-33  33%  428 aa  GSA_METFK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::309     9e-33  35%  428 aa  GSA2_OCEIH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::315     9e-33  33%  427 aa  GSA1_CLOPH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   32::321     1e-32  33%  429 aa  GSA_STRM5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::327     1e-32  33%  438 aa  GSA_SALRD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::319     2e-32  32%  431 aa  GSA_VIBSL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     2e-32  33%  431 aa  GSA_ALISL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::331     2e-32  32%  428 aa  GSA1_GEOKA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   32::304     2e-32  35%  428 aa  GSA_FLAPJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::344     2e-32  36%  425 aa  GSA_CLOPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::426     2e-32  33%  450 aa  AT2L2_HUMAN RecName: Full=Alanine--glyoxylate aminotransferase
   32::333     3e-32  35%  445 aa  GSA_HALMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::326     3e-32  32%  431 aa  GSA_FRATW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::343     3e-32  33%  432 aa  GSA_CARHZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::331     3e-32  32%  428 aa  GSA1_GEOTN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   32::317     3e-32  35%  432 aa  GSA_SYNAS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   83::375     3e-32  32%  478 aa  GSA_ORYSJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
   38::349     3e-32  34%  433 aa  GSA_MICAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::326     3e-32  32%  431 aa  GSA_FRATT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::326     3e-32  32%  431 aa  GSA_FRATO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::326     3e-32  32%  433 aa  GSA_FRATN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::326     3e-32  32%  431 aa  GSA_FRATH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::326     3e-32  32%  431 aa  GSA_FRATF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::326     3e-32  32%  431 aa  GSA_FRAT1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::322     3e-32  34%  428 aa  GSA_AERHH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   26::347     3e-32  34%  420 aa  ECTB_STRCH RecName: Full=Diaminobutyrate--2-oxoglutarate
    4::324     4e-32  33%  430 aa  GSA_RALEH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::323     4e-32  34%  434 aa  GSA_PSYWF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::341     4e-32  32%  425 aa  GSA_HYDS0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   14::321     4e-32  33%  427 aa  GSA_GEOMG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::322     4e-32  33%  428 aa  GSA_AERS4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     6e-32  35%  425 aa  GSA_THIDA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::346     6e-32  32%  430 aa  GSA_RALME RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::333     6e-32  32%  431 aa  GSA_PSEA6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::329     6e-32  33%  432 aa  GSA_CYAP4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::344     6e-32  36%  425 aa  GSA_CLOP1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::324     7e-32  32%  430 aa  GSA_CUPTR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::346     7e-32  32%  425 aa  GSA_CAMLR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     7e-32  34%  429 aa  GSA_AZOVD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     7e-32  35%  432 aa  GSA_ACIBY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     7e-32  35%  432 aa  GSA_ACIBT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     7e-32  35%  432 aa  GSA_ACIBS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     7e-32  35%  432 aa  GSA_ACIB5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     7e-32  35%  432 aa  GSA_ACIB3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::317     1e-31  34%  428 aa  GSA_FLAJ1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::351     1e-31  32%  429 aa  GSA_CAMC5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::326     1e-31  34%  418 aa  GSA_ARCFU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::317     1e-31  34%  429 aa  GSA_ANADF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     1e-31  35%  432 aa  GSA_ACIBC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::331     1e-31  34%  431 aa  GSA1_BACP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::326     1e-31  31%  426 aa  GSA_HALHL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::349     1e-31  32%  434 aa  GSA_CLOCE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::342     1e-31  33%  427 aa  GSA1_MACCJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   35::333     1e-31  34%  432 aa  GSA1_BACCN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::319     2e-31  34%  427 aa  GSA_TERTT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::315     2e-31  33%  428 aa  GSA_RUTMC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::326     2e-31  32%  431 aa  GSA_FRATM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::322     2e-31  37%  449 aa  GSA_FRASN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::323     2e-31  35%  427 aa  GSA_DECAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   29::317     2e-31  36%  424 aa  GSA_AQUAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   21::414     2e-31  29%  435 aa  ECTB_BORPA RecName: Full=Diaminobutyrate--2-oxoglutarate
   21::414     2e-31  29%  435 aa  ECTB_BORBR RecName: Full=Diaminobutyrate--2-oxoglutarate
    3::344     2e-31  29%  426 aa  GSA_BURP8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::315     3e-31  34%  425 aa  GSA_PSYIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::320     4e-31  33%  432 aa  GSA_ACIAD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   79::371     4e-31  32%  474 aa  GSA1_ARATH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   40::324     5e-31  35%  443 aa  GSA_MYCUA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   29::349     5e-31  32%  423 aa  GSA_CAMFF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::314     5e-31  34%  427 aa  GSA_CAMC1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::341     5e-31  32%  429 aa  GSA2_STAES RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     5e-31  32%  429 aa  GSA2_STAEQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   38::327     6e-31  34%  431 aa  GSA_LACRJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   38::327     6e-31  34%  431 aa  GSA_LACRD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::312     6e-31  34%  430 aa  GSA_HELAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     6e-31  31%  427 aa  GSA_BURXL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::337     6e-31  35%  437 aa  BIOA_MYCTU RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   11::337     6e-31  35%  437 aa  BIOA_MYCBO RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   32::337     8e-31  33%  426 aa  GSA_UNCMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::350     8e-31  30%  433 aa  GSA_RALPJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::347     8e-31  34%  422 aa  GSA_CLOAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::317     1e-30  33%  431 aa  GSA_SYNWW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::315     1e-30  33%  424 aa  GSA_ALKOO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::430     1e-30  28%  439 aa  BIOA_HELPJ RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   37::327     1e-30  33%  432 aa  GSA_SYNP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::327     1e-30  33%  433 aa  GSA_RALSO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::325     1e-30  33%  427 aa  GSA_PSEP1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   28::317     1e-30  29%  426 aa  GSA_DICNV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::317     1e-30  34%  425 aa  GSA_CLOPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::317     2e-30  33%  444 aa  GSA_XYLFM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::325     2e-30  33%  427 aa  GSA_PSEPK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::323     2e-30  32%  427 aa  GSA_NEIM0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::321     2e-30  36%  429 aa  GSA_AERPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::323     2e-30  32%  427 aa  GSA_NEIMB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::324     2e-30  32%  432 aa  GSA_JANMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::321     2e-30  32%  433 aa  GSA_FRAP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     2e-30  31%  427 aa  GSA_BURPP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::319     2e-30  35%  430 aa  GSA_ANASK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::314     3e-30  34%  422 aa  GSA_CLOTE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::319     3e-30  30%  427 aa  GSA_BURTA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::319     3e-30  35%  430 aa  GSA_ANAD2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::320     5e-30  32%  433 aa  GSA_PSYA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::325     5e-30  34%  427 aa  GSA_PSEPG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     5e-30  33%  427 aa  GSA_PSEE4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::340     5e-30  31%  427 aa  GSA_NITEC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::323     5e-30  32%  427 aa  GSA_NEIMF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::331     5e-30  32%  428 aa  GSA_HERAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   38::324     5e-30  36%  454 aa  GSA_FRAAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::319     5e-30  32%  429 aa  GSA_CHRSD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::341     5e-30  32%  429 aa  GSAB_BACSU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::341     5e-30  34%  429 aa  GSA2_STACT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::342     5e-30  31%  432 aa  GSA2_LISIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   32::330     5e-30  33%  429 aa  GSA1_BACA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   32::317     7e-30  33%  444 aa  GSA_XYLFA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::320     7e-30  32%  433 aa  GSA_PSYCK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::339     7e-30  31%  446 aa  GSA_HALWD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::315     7e-30  36%  429 aa  GSA_ACIC5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::365     9e-30  30%  449 aa  OAPT_PSEPU RecName: Full=Omega-amino acid--pyruvate
   30::319     9e-30  33%  427 aa  GSA_PSEPW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::339     9e-30  29%  445 aa  GSA_HALLT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     9e-30  33%  427 aa  GSA_BORPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::341     9e-30  33%  429 aa  GSA1_STAHJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   32::317     1e-29  33%  444 aa  GSA_XYLFT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::317     1e-29  33%  444 aa  GSA_XYLF2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::324     1e-29  33%  427 aa  GSA_AZOSE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::344     1e-29  31%  432 aa  GSA2_LISW6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   38::349     2e-29  33%  433 aa  GSA_SYNE7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::322     2e-29  35%  423 aa  GSA_IGNH4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::312     2e-29  33%  430 aa  GSA_HELPH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::312     2e-29  34%  430 aa  GSA_HELP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::315     2e-29  32%  426 aa  GSA_ARCB4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::316     2e-29  35%  431 aa  GSA_ACIBL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::341     2e-29  30%  428 aa  GSA2_MACCJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   35::312     2e-29  34%  430 aa  GSA_HELPJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::341     2e-29  31%  429 aa  GSA1_STAS1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   37::348     3e-29  31%  432 aa  GSA_TRIEI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   45::318     3e-29  36%  448 aa  GSA_SALTO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::330     3e-29  31%  436 aa  GSA_METPP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::328     3e-29  32%  434 aa  GSA_DIAST RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::322     3e-29  30%  427 aa  GSA_BURM1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   78::370     3e-29  32%  473 aa  GSA_BRANA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
   33::328     3e-29  34%  426 aa  GSA_AKKM8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::328     3e-29  32%  434 aa  GSA_ACISJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::344     3e-29  31%  432 aa  GSA2_LISMO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   47::329     3e-29  36%  437 aa  GSA_SORC5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::312     3e-29  34%  430 aa  GSA_HELPG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::316     3e-29  34%  423 aa  GSA_DESVV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::316     3e-29  34%  423 aa  GSA_DESVH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::309     3e-29  32%  433 aa  GSA_CLONN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     3e-29  31%  427 aa  GSA_BURA4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   19::323     3e-29  31%  440 aa  GSA_ALKMQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::420     3e-29  30%  423 aa  BIOA_CORGL RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   35::354     5e-29  34%  430 aa  GSA_SULNB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::323     5e-29  33%  427 aa  GSA_NEIMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   42::350     6e-29  30%  429 aa  GSA_METTP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::312     6e-29  33%  430 aa  GSA_HELPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     6e-29  30%  427 aa  GSA_BURVG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::308     6e-29  35%  421 aa  GSA1_CENSY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::331     6e-29  32%  432 aa  GSA1_BACLD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::423     6e-29  28%  436 aa  BIOA_HELPY RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   38::349     8e-29  32%  433 aa  GSA_SYNP6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     8e-29  32%  425 aa  GSA_LARHH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     8e-29  30%  427 aa  GSA_BURS3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::331     8e-29  31%  437 aa  GSA1_BACHD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::336     8e-29  33%  431 aa  GSA1_ANOFW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   36::321     1e-28  34%  435 aa  GSA_STRGG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     1e-28  30%  427 aa  GSA_BURCM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::421     1e-28  30%  429 aa  BIOA_SALTY RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   30::323     2e-28  31%  426 aa  GSA_NEIG1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::331     2e-28  30%  428 aa  GSA1_BREBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   42::336     2e-28  32%  442 aa  GSA_POLNA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::323     2e-28  31%  426 aa  GSA_NEIG2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::329     2e-28  34%  433 aa  GSA_MAGSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::324     2e-28  33%  427 aa  GSA_DESOH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::346     2e-28  30%  432 aa  GSA1_EXISA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   32::328     3e-28  30%  427 aa  GSA_ROSS1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::319     3e-28  32%  435 aa  GSA_GEMAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::344     3e-28  31%  429 aa  GSA1_LYSSC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   44::329     4e-28  31%  439 aa  GSA_RHOBA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::318     4e-28  35%  436 aa  GSA_PROAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::321     4e-28  33%  438 aa  GSA_MYCSS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::321     4e-28  33%  438 aa  GSA_MYCSK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::332     4e-28  31%  438 aa  GSA_DELAS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::325     4e-28  36%  441 aa  GSA_DEIDV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::317     4e-28  32%  427 aa  GSA_COLP3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::325     4e-28  32%  429 aa  GSA2_STAAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   32::309     5e-28  31%  424 aa  GSA_CAMJR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::309     5e-28  31%  424 aa  GSA_CAMJJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::309     5e-28  31%  424 aa  GSA_CAMJE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::309     5e-28  31%  424 aa  GSA_CAMJD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::309     5e-28  31%  424 aa  GSA_CAMJ8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::331     5e-28  31%  437 aa  GSA_ACIAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::325     5e-28  32%  429 aa  GSA2_STAAW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::325     5e-28  32%  429 aa  GSA2_STAAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::325     5e-28  32%  429 aa  GSA2_STAAS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::325     5e-28  32%  429 aa  GSA2_STAAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::325     5e-28  32%  429 aa  GSA2_STAAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::325     5e-28  32%  429 aa  GSA2_STAAM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::325     5e-28  32%  429 aa  GSA2_STAAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::325     5e-28  32%  429 aa  GSA2_STAAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::325     5e-28  32%  429 aa  GSA2_STAA9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::325     5e-28  32%  429 aa  GSA2_STAA8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::325     5e-28  32%  429 aa  GSA2_STAA3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::325     5e-28  32%  429 aa  GSA2_STAA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::325     5e-28  32%  429 aa  GSA2_STAA1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::342     5e-28  31%  432 aa  GSA2_LISMF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   33::342     5e-28  31%  432 aa  GSA1_LISMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    3::421     5e-28  29%  429 aa  BIOA_ESCVU RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   21::437     7e-28  26%  444 aa  YODT_BACSU RecName: Full=Uncharacterized aminotransferase yodT;    
   34::321     7e-28  33%  438 aa  GSA_MYCSJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   40::313     7e-28  34%  443 aa  GSA_MYCMM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   45::323     9e-28  32%  444 aa  GSA_SALAI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::342     9e-28  31%  432 aa  GSA2_LISMC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::332     1e-27  33%  425 aa  GSA_OPITP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     2e-27  30%  427 aa  GSA_BURCJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     2e-27  30%  427 aa  GSA_BURCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::319     2e-27  30%  427 aa  GSA_BURCA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   39::448     2e-27  29%  449 aa  LAT_MYCTU RecName: Full=Probable L-lysine-epsilon aminotransferase;
   39::448     2e-27  29%  449 aa  LAT_MYCBO RecName: Full=Probable L-lysine-epsilon aminotransferase;
   30::319     2e-27  30%  427 aa  GSA_BURCC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   42::339     2e-27  31%  427 aa  GSA2_STAHJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::339     2e-27  31%  426 aa  GSA2_CLOPH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   27::310     3e-27  30%  423 aa  GSA_THEM4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   45::330     3e-27  32%  451 aa  GSA_MYCS2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::314     3e-27  34%  431 aa  GSA_CLOB8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::320     3e-27  34%  439 aa  GSA_ARTAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::340     4e-27  30%  446 aa  GSA_NATPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::344     4e-27  31%  424 aa  GSA_METBF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   38::328     4e-27  36%  446 aa  GSA_DEIGD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::344     4e-27  32%  434 aa  GSA1_BACSK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   39::324     6e-27  35%  438 aa  GSA_STRAW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::315     6e-27  30%  430 aa  GSA_CORDI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::312     7e-27  34%  423 aa  GSA_SACD2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   77::369     1e-26  29%  472 aa  GSA2_ARATH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   40::327     2e-26  31%  423 aa  GSA_THEAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::324     2e-26  30%  429 aa  GSA_RALEJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::344     2e-26  30%  424 aa  GSA_METMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::312     2e-26  32%  430 aa  GSA_HELPY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::321     3e-26  33%  429 aa  GSA_XANCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::321     3e-26  33%  429 aa  GSA_XANAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::327     3e-26  30%  433 aa  GSA_SYMTH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   39::324     3e-26  32%  438 aa  GSA_STRCO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::315     4e-26  31%  428 aa  GSA_VESOH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::317     4e-26  33%  432 aa  GSA_STRSV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   42::356     5e-26  31%  442 aa  GSA_POLSJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   19::351     5e-26  30%  433 aa  GSA_METI4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::314     5e-26  32%  429 aa  BIOA_ECOLI RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   12::311     6e-26  32%  420 aa  GSA_THEVO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::332     6e-26  31%  436 aa  GSA_RHOFD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::321     8e-26  33%  429 aa  GSA_XANC5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   50::326     8e-26  30%  444 aa  GSA_CORA7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::324     8e-26  34%  443 aa  GSA_ARTCA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::330     1e-25  31%  433 aa  GSA_POLNS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::323     1e-25  33%  430 aa  GSA_ACIF5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::323     1e-25  33%  430 aa  GSA_ACIF2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::304     1e-25  31%  434 aa  GSA_ROSCS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::330     1e-25  32%  434 aa  GSA_POLSQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::315     1e-25  31%  426 aa  GSA_HYPBU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   86::389     2e-25  32%  481 aa  GSA_SOLLC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
   66::319     2e-25  37%  430 aa  GSA_ANADE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   47::453     3e-25  30%  457 aa  LAT_STRCL RecName: Full=L-lysine-epsilon aminotransferase;       
   71::363     4e-25  29%  466 aa  GSA_SOYBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
   32::317     4e-25  30%  430 aa  GSA_CYTH3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::321     4e-25  31%  443 aa  GSA_CHLSY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::321     4e-25  31%  443 aa  GSA_CHLAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::324     4e-25  33%  447 aa  GSA_ARTS2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::310     5e-25  31%  413 aa  GSA_METB6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::319     5e-25  29%  427 aa  GSA_BURM9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::336     7e-25  34%  425 aa  BIOA_SERMA RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   37::339     7e-25  33%  436 aa  BIOA_MYCLE RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   83::375     9e-25  31%  478 aa  GSA_TOBAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
   28::296     9e-25  32%  434 aa  GSA2_CENSY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   30::306     1e-24  33%  433 aa  GSA_RENSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::322     1e-24  33%  452 aa  GSA_FRASC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::344     1e-24  31%  432 aa  GSA1_OCEIH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   36::344     2e-24  29%  424 aa  GSA_METAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::318     2e-24  30%  439 aa  GSA_KOCRD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::319     2e-24  28%  427 aa  GSA_BURP0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::334     2e-24  34%  429 aa  BIOA_BUCBP RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   32::313     3e-24  30%  435 aa  GSA_HELHP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   51::331     3e-24  33%  447 aa  GSA_CORU7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::319     3e-24  28%  427 aa  GSA_BURPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::319     3e-24  28%  427 aa  GSA_BURP1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::319     3e-24  28%  427 aa  GSA_BURMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::319     3e-24  28%  427 aa  GSA_BURMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::319     3e-24  28%  427 aa  GSA_BURM7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::335     3e-24  27%  432 aa  GSA1_EXIS2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   35::305     3e-24  30%  431 aa  GSA_MYXXD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::303     6e-24  33%  424 aa  GSA_THET8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::313     6e-24  31%  417 aa  GSA_METHJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::319     6e-24  28%  427 aa  GSA_BURP6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   18::318     7e-24  28%  430 aa  GSA_METKA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::317     7e-24  31%  426 aa  GSA_BDEBA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::316     1e-23  31%  423 aa  GSA_DESDA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   38::328     1e-23  34%  444 aa  GSA_DEIRA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   31::312     1e-23  33%  420 aa  GSA_METPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::316     1e-23  30%  425 aa  GSA_DESVM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::319     1e-23  29%  426 aa  GSA_ALCBS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   41::313     2e-23  33%  445 aa  GSA_NOCFA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::333     2e-23  31%  455 aa  GSA_CLAM3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::317     2e-23  31%  427 aa  GSA_SULTO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::328     3e-23  29%  432 aa  GSA_PARUW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::311     5e-23  32%  424 aa  GSA_PYRIL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   15::341     5e-23  28%  422 aa  GSA_METBU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   28::327     5e-23  31%  432 aa  BIOA_BUCAP RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   32::325     6e-23  28%  430 aa  GSA_NITOC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::329     6e-23  29%  430 aa  GSA_CALMQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::328     1e-22  29%  437 aa  GSA_VEREI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   44::316     1e-22  32%  446 aa  GSA_MYCLE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   44::316     1e-22  32%  446 aa  GSA_MYCLB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::446     2e-22  30%  450 aa  LAT_NOCLA RecName: Full=L-lysine-epsilon aminotransferase;       
   38::313     2e-22  30%  441 aa  GSA_RHOSR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   44::352     2e-22  29%  441 aa  GSA_LEPBL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   44::352     2e-22  29%  441 aa  GSA_LEPBJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::340     2e-22  28%  445 aa  GSA_HALSA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::340     2e-22  28%  445 aa  GSA_HALS3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::333     2e-22  31%  455 aa  GSA_CLAMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::308     2e-22  30%  424 aa  GSA_THENV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   33::314     2e-22  30%  430 aa  GSA_THEFY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::306     2e-22  30%  432 aa  GSA_MYCVP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::321     3e-22  30%  429 aa  GSA_XANCP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::321     3e-22  30%  429 aa  GSA_XANCB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::321     3e-22  30%  429 aa  GSA_XANC8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   24::308     3e-22  33%  423 aa  GSA_PYRAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   13::311     4e-22  30%  421 aa  GSA_THEAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   46::319     5e-22  30%  446 aa  GSA_MYCA9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   29::310     5e-22  32%  415 aa  GSA_METMJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   44::325     5e-22  31%  443 aa  GSA_CORJK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   46::320     5e-22  30%  437 aa  GSA_CORGL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   46::320     5e-22  30%  437 aa  GSA_CORGB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   29::306     2e-21  31%  412 aa  GSA_METLZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   37::321     2e-21  29%  438 aa  GSA_CHLAD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::379     3e-21  29%  447 aa  GSA_LEIXX RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::306     5e-21  32%  432 aa  GSA_MYCGI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::311     5e-21  28%  422 aa  GSA_CHLMU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   29::318     6e-21  31%  420 aa  GSA_SULAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::331     6e-21  30%  425 aa  GSA_LEPBP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::331     6e-21  30%  425 aa  GSA_LEPBA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   79::427     8e-21  31%  498 aa  GATA_EMENI RecName: Full=4-aminobutyrate aminotransferase;       
   63::408     8e-21  31%  483 aa  GABT_CAEEL RecName: Full=Probable 4-aminobutyrate aminotransferase,
   35::319     2e-20  29%  445 aa  GSA_NOCSJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   52::315     2e-20  29%  442 aa  GSA_COREF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   27::308     3e-20  31%  423 aa  GSA_PYRAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   49::321     4e-20  31%  437 aa  GSA_CHLCV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   42::323     5e-20  32%  441 aa  GSA_PYRCJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   43::317     5e-20  30%  445 aa  GSA_MYCA1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::352     7e-20  26%  435 aa  GSA_WIGBR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   77::489     7e-20  28%  495 aa  GABT_DICDI RecName: Full=4-aminobutyrate aminotransferase;       
   29::327     7e-20  30%  428 aa  BIOA_BUCAI RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   43::312     9e-20  30%  422 aa  GSA_CHLTB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   43::312     9e-20  30%  422 aa  GSA_CHLT2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   43::317     1e-19  29%  445 aa  GSA_MYCPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   43::312     1e-19  30%  422 aa  GSA_CHLTR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   43::312     1e-19  30%  422 aa  GSA_CHLTA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   46::354     2e-19  28%  443 aa  GSA_LEPIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::307     2e-19  30%  441 aa  GSA_PROFF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   42::328     2e-19  30%  448 aa  GSA_KINRD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::304     7e-19  31%  432 aa  GSA_RHOE4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   46::354     7e-19  27%  443 aa  GSA_LEPIC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::306     9e-19  31%  427 aa  GSA_THET2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   49::346     9e-19  29%  437 aa  GSA_CHLFF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   52::342     2e-18  26%  435 aa  YC7B_SCHPO RecName: Full=Uncharacterized aminotransferase C417.11c;
   41::316     3e-18  26%  448 aa  GSA_SACEN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::317     5e-18  28%  430 aa  GSA_LAWIP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   38::313     1e-17  27%  441 aa  GSA_RHOOB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   71::467     1e-17  30%  480 aa  BIOA_YEAST RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
 1528::1827    2e-17  28% 3971 aa  MYCA_BACSU RecName: Full=Mycosubtilin synthetase subunit A;       
    5::71      2e-16  51%   71 aa  ARGD_RHOCA RecName: Full=Acetylornithine aminotransferase;       
   35::337     4e-16  25%  440 aa  GSA_CHLPN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   36::318     4e-16  26%  437 aa  GSA_ACIC1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::273     2e-15  33%  466 aa  GSA_TROWT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::273     2e-15  33%  466 aa  GSA_TROW8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   81::428     2e-15  29%  509 aa  GATA_USTMA RecName: Full=4-aminobutyrate aminotransferase;       
   79::479     5e-15  25%  500 aa  GABT_PIG RecName: Full=4-aminobutyrate aminotransferase,
   79::427     6e-15  27%  500 aa  GABT_MOUSE RecName: Full=4-aminobutyrate aminotransferase,
   49::321     1e-14  28%  437 aa  GSA_CHLAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   79::434     1e-14  27%  500 aa  GABT_RAT RecName: Full=4-aminobutyrate aminotransferase,
   44::334     2e-14  29%  462 aa  GSA_MYCTU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   44::334     2e-14  29%  462 aa  GSA_MYCTA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   44::334     2e-14  29%  462 aa  GSA_MYCBT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   44::334     2e-14  29%  462 aa  GSA_MYCBP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   44::334     2e-14  29%  462 aa  GSA_MYCBO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   79::427     1e-13  26%  500 aa  GABT_HUMAN RecName: Full=4-aminobutyrate aminotransferase,
   76::403     3e-13  27%  474 aa  GATA_SCHPO RecName: Full=4-aminobutyrate aminotransferase;       
   51::397     1e-12  26%  471 aa  GATA_YEAST RecName: Full=4-aminobutyrate aminotransferase;       
   79::427     3e-09  28%  500 aa  GABT_BOVIN RecName: Full=4-aminobutyrate aminotransferase,
  131::239     9e-06  31%  474 aa  GCSPB_THET8 RecName: Full=Probable glycine dehydrogenase
  131::239     9e-06  31%  473 aa  GCSPB_THET2 RecName: Full=Probable glycine dehydrogenase
   58::192     1e-04  34%  410 aa  ISCS_RICBR RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;
   27::274     1e-04  28%  404 aa  ISCS_PASMU RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;
  119::339     2e-04  29%  471 aa  TNAA_SALRD RecName: Full=Tryptophanase;       
   58::192     2e-04  35%  410 aa  ISCS_RICCK RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;
   53::192     2e-04  34%  410 aa  ISCS_RICAE RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;
   58::192     3e-04  34%  410 aa  ISCS_RICB8 RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;
  131::238     3e-04  28%  496 aa  GCSPB_THISH RecName: Full=Probable glycine dehydrogenase
   53::192     5e-04  33%  410 aa  ISCS_RICRS RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;
   53::192     5e-04  33%  410 aa  ISCS_RICRO RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;
   53::192     5e-04  33%  410 aa  ISCS_RICPU RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;
   53::192     5e-04  33%  410 aa  ISCS_RICM5 RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;
   53::192     5e-04  33%  410 aa  ISCS_RICCN RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;
  151::384     5e-04  25%  392 aa  BIKB_BACSU RecName: Full=Putative 8-amino-7-oxononanoate
  709::768     9e-04  40% 1305 aa  CTP5A_RAT RecName: Full=Contactin-associated protein like
    1::396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT
ARGD_THETN      ----------KKYLMDTYNRYPIMLVKGEGTRVWDSEGNAYLDFVAGIAVNSLGHCHPALVEAIKKQAET
ARGD_METJA      MSQENWIDLEKKYHLQIYGRLPVVLVEGKGMEVYDIDGKKYLDFLAGIGVNNVGHCHPKVVEAIKKQAET
ARGD_METTH      MDSEEIIELERKFIMQTYTRQPIVLSHGKGATVWDIEGNSYIDCFAGVAVNSIGHAHPKVALAICHQAQR
ARGD_THEEB      -----------QVVMSTYGRFPITLVRGEGCRVWDDQGRSYLDFVAGIATCTLGHAHPALVETVSRQMQT
ARGD_SYNY3      ------------YVMNTYGRFPIAIARGQGSTLWDTEGKSYLDFVAGIATCTLGHAHPALVRAVSDQIQK
ARGD_GLOVI      ----------EQHVMHTYARFSVVFERGEGCYLEDSEGRRYLDFVAGIATCVLGHAHPVLSAAVAEQART
ARGD_ANASP      -------------VMSTYGRFPLALERGAGCRVWDTQGKEYLDFVAGIATCTLGHAHPAMVEAVTRQIQK
ARGD_THEMA      ------------YLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEK
ARGD_CLOAB      --------MSKSYLMNTYGRFNVTFDKGEGTKLYDKDGNEYIDFVSGVAVNCLGHCNPSIVKAIEEQSSK
ARGD_MYXXA      -----LVQKAKRHLLQNYKQPPFVLARGQGARVWDMDGREYLDLIGGIATCALGHCHPEVVAAAKAQLDS
ARUC_PSEAE      -----------RYMVPNYAPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQR
ARGD_NEIMB      ----------QNYLTPNFAFAPMIPERASGSRVWDTKGREYIDFSGGIAVNALGHCHPALVDALNAQMHK
ARGD_NEIMA      ----------QNYLTPNFAFAPMIPERASGSRVWDTEGREYIDFSGGIAVNALGHCHPALVDALNAQMHK
ARGD_NITEU      ------------HVMNTYARLPVTFVKGEGVWLWDDQGNRYLDALSGIAVCGVGHCHPVLVKALCEQVST
ARGD_PSEPK      -----------QVMVPNYSPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVNALGHCHPALVKALTEQANT
ARGD_PROMA      ------------FLLDTYKRLPLKIVKGNGCWLWDETGKKYLDAVAGIATCSLGHSDKKLSKVLSQQLRK
ARGD1_PSESM     -----------QVMVPNYAPAGFIPVRGAGSRVWDQAGRELVDFSGGIAVNVLGHCHPALVGALTEQANN
ARGD_BACST      ----------------TYNRWNIAVQSAEGTVVTDVNGKQYLDFVSGIAVCNLGHRHPHVQKSIEQQLNQ
ARGD_VIBCH      -----------------YNPMEFIPVKGFGSRIWDQQGHEYIDFAGGIAVSCLGHCHPVMVQALTTQANK
ARGD_BACSU      -------------LFQTYGRWDIDIKKAKGTYVEDQNGKTYLDFIQGIAVSNLGHCHEAVTEAVKKQLDS
ASTC_ECOHS      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECOSE      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECOLI      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECOLC      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECODH      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECOBW      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECO8A      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECO24      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ARGD_AQUAE      ------------YLMNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEK
ASTC_ESCF3      -----------EWMLPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECOSM      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_SHISS      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECO55      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECOLU      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECO27      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFSGGIAVNALGHAHPELREALNEQASK
ARGD_YERPE      -----------QVILPVYAPAQFIPVKGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVSALHQQGET
ASTC_CITK8      -----------EWMMPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQASK
ARGD_ECOL6      -----------EVILPIYAPAEFIPVKGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGET
ARGD_ECO57      -----------EVILPIYAPAEFIPVKGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGET
ASTC_ECOUT      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECOL6      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECOL5      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECOK1      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECO81      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECO7I      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECO45      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ARGD_ECOLI      -----------EVILPIYAPAEFIPVKGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGET
ARGD_BACHD      ------------HLFPTYAKWDVTITSGKGTKLYDNQGNEYLDFVSGIAVCNLGHCHPKVVAAVEEQLHS
ASTC_ECO5E      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_ECO57      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_SALPK      -----------EWMVPVYVPAPLIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR
ASTC_SALPA      -----------EWMVPVYVPAPLIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR
ASTC_SHIBS      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ASTC_SHIB3      -----------EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK
ARGD_LISMF      -----------KHVFPTYKRFPIDLVNGTGTVVTDKNGKTYLDFTSGIAVCNLGHCPANVAEAVQQQLTN
ASTC_SALG2      -----------EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR
ASTC_SALEP      -----------EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR
ARGD_PHOLL      -----------QVMLPIYSPAQFIPVRGQGSRVWDQHGKEYIDFAGGIAVVALGHCHPTLVDVLKQQGEK
ARGD_OCEIH      -------------VMQTYNRFPITATKGKGSFLWDDNGEKYLDYTSGIATCNLGHVPDNVQHAISNQLKD
ASTC_SALTY      -----------EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR
ASTC_SALPB      -----------EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR
ASTC_SALNS      -----------EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR
ASTC_SALA4      -----------EWMVPVYIPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR
ASTC_SALPC      -----------EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR
ASTC_SALHS      -----------EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR
ASTC_SALDC      -----------EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR
ARGD_SHIFL      -----------EVILPIYAPAEFIPVKGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGET
ASTC_YERPG      -----------EWIVPTYAPADFIVVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVRAALIEQADK
ASTC_YERPE      -----------EWIVPTYAPADFIVVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVRAALIEQADK
ASTC_YERPA      -----------EWIVPTYAPADFIVVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVRAALIEQADK
ASTC_SALTI      -----------EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR
ASTC_YERP3      -----------EWIVPTYAPADFIVVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVRAALIEQADK
ASTC_YERPS      -----------EWLVPTYAPADFIVVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVRAALIEQADK
ARGD_SALTY      -----------EVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGET
ASTC_SALCH      -----------EWMVPVYVPAPFIPVRGEGSRLWEQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR
ARGD_VIBVU      -----------------YNPMEMIPVKGQGSRIWDQNGNEYIDFAGGIAVSCLGHCHPVMVNALTEQAGK
ARGD_SALTI      -----------EVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGET
ARGD_PASMU      --NREIF---DQVMIQNYVPAQFIPVRGKGSHVWDQQGKDYIDFTSGIAVNSLGHCADEIVDVLKQQSEK
ARGD_HAEDU      MTSDQIKQLDANYIAQTYAKFDLALSHGQGCEVWDFDGNKYLDFTSGIGVNSLGWADPDWLEAVIAQLHK
ARGD_METKA      -----------KYHMNTYSRFPVTLVPGEGARVWDDEGNEYIDLVAGIAVNVLGHCHPAVVEAVKEQVER
ARGD1_BRAJA     ------------HLLPVFARSDLGFERGEGCWLIATNGDRYLDFTSGVAVNALGHAHPALVKALQEQATK
ARGD_VIBVY      -----------------YNPMEMIPVKGQGSRIWDQNGNEYIDFAGGIAVSCLGHCHPVMVNALTEQAGK
ARGD_STRMU      -------------LFQNYTRADLEFIKAEGNYLFDTQGKKYLDFSTGIGVTNLGF-HPQVQVALQKQAEQ
ARGD_RHILO      --------MSGSALYETFARAPLAFDHGEGTWLVTDKGERYLDFAGGIAVNSLGHSHPHLVAALTEQAAK
ARGD_ARCFU      ----------KKHILQTYTRQKVVIERGEGCYVYDVNGKRYLDLVAGIATVSIGHCNSHLVERLKEQLEK
ARGD_ALNGL      --SKEVMEAAGRVLVGTYARVPVVLSRGKGCKLYDPEGREYLDLSAGIAVNVLGHADSDWLRAVTEQAAT
ARGD_PROMM      -------------VMGTYKRFPVTLLRGKGCWVWDDHGHQYLDAVAGIATCALGHSDRALRRSLGQQLKQ
ARGD_BRUSU      ---------------DTYNRAALRFERGEGIWLITEDGERYIDFAAGIAVNSLGHSHPHLVETLKTQAEK
ARGD_BRUME      ---------------DTYNRAALRFERGEGIWLITEDGERYIDFAAGIAVNSLGHSHPHLVETLKTQAEK
ARGD_VIBPA      -----------------YNPMEMIPVRGKGSRIWDQDDNEYIDFAGGIAVSCLGHCHPVMVDALTEQGNK
ASTC_PHOLL      ----------EHYMVPCFSPAKFIPVRAKGSKVWDQDGKEYIDFAGGIAVNSLGHAHPELKDELIYQIDK
ARGD_METMA      -----VIDKDSKYVMQTYGRQPLVLSKGKGAVVQDIYGKEYIDCVAGIAVNNVGHCHPTVVKAIQAQAEK
ARGD_LISMO      -----------KHVFPTYKRFPIDLVNGTGTVVTDKNGKTYLDFTSGIAVCNLGHCPTNVAEAVQQQLGN
ARGD_METAC      -----VIEKDSKYVMQTYGRQPLVLSKGKGAVVQDIYGKEYIDCVAGIAVNNVGHCHPTVVKAIQAQAEN
ASTC_YERE8      -----------EWIVPTYAPADFIVVRGEGATLWDQQGKSYIDFAGGIAVNALGHGHPAVKAALIEQADK
ASTC_CAUCR      -------------LMNTYARANIDIVRGEGCWLYDQDGRDYLDLAAGVAVNTLGHGDPRLVQALKTQADI
ARGD_AGRT5      -------------LFDTFARAPLRFERGEGVWLFTESGERYLDFAAGVAVNSLGHAHPHLVEAIKTQAEK
ARGD_SHEON      -------------------------VRGEGSRVWDQEGNEFIDFAGGIAVNCLGHCHPALVNALKTQGEK
ARGD_SYNPX      -------------VMNTYNRFPLTLVRGRGCWVWDDQGRRHLDAVAGIATDTLGHSDXXXXXXXXXXXXX
ARGD_RHIME      ---------------DTYLRAPLRFERGEGVWLIAEDGTRYLDFAAGVAVNSLGHAHPHLVEALKAQADK
ARGD2_BRAJA     -------------LMDITARPKAVFVRGAGSYLWDDSRKRYLDFVQGWAVNCLGHSPSAIADALAAQAKR
ARGD_RALSO      -----------QSLMYITNRPEIVFTEGKGSWLTDHNGKRYLDFVQGWAVNCLGHSNDGMIEALNAQAKK
ARGD_PROMP      -------------LMNTYTRFDISFKKGNGCWLWDEKGKKYLDAVAGIATCSLGHSNRILRKKLSAQLKK
ARGD_WOLSU      -------ALDKEYVLHSYGRNYVQFTQGKNATLWDSEGKDYIDFASGIAVCSVGHGNERLAGAICDQAKK
ARGD_COREF      ---EDTLTSWPQVLLNTYGTPPVELVTGKGSTVTDADGNVYIDLLAGIAVNALGHAHPAIIEAVTTQLSQ
ARGD_CHLTE      MNTPAILETEKQLFFHNYARLPLDIASGKGSFLYTASGERYLDMIAGVGVNAIGYGDKRLEQAITEQASK
ARGD_LISIN      -----------KHVFPTYNRFPVDIVKGNGTVVKDATGKTYLDFTSGIAVCNLGHCPENVTEAIQSQLAN
ARGD_XANCP      ------------YYLPVYRPRQVVLERGQGSRVWDDQGREYLDLSSGIAVSGLGHNDPDLMAALTEQAGK
ARGD2_PSESM     -------------LMSTYQPLALSFTRGLGTRLWDQSGREYLDAVAGVAVTNVGHSHPMLVDAIRDQAGL
ARGD_BUCAI      -------------ILPIYNPIPFIPIKGKGSRIWDQKGKEYIDFSGGIAVTSLGHCHPILNKTLKNQSKM
ARGD_XYLFA      --SESVLSLSRYY-LPVYRPCQVVLVRGQGSRVWDEQGRDYLDLAAGIAVCCLGHCDPDLVAALVEQAGR
ARGD_BACAN      ------------HLFQTYGRRTVEFVKGNGTKVIDNNGKQYLDFTSGIGVCNLGHCHPTVMKAVQEQLND
ARGD_XYLFT      --SESVLSLSRYY-LPVYRPCQVVLVRGQGSRVWDEQGRDYLDLAAGIAVCCLGHCDPDLVAALVEQAGR
ARGD_DEBHA      ---QYINTITKPFTVTTYARPNVVMTHGKGSYLYDLENRQYLDFSAGIAVTCLGHSHSKITEIISDQAAT
ARGD_CORGL      -----------QVIINTYGTPPVELVSGKGATVTDDQGNVYIDLLAGIAVNALGHAHPAIIEAVTNQIGQ
ARGD_NEUCR      ------------YMVTTYSRPPPVFVKGKGSYLWDLEDRKYLDFTSGIAVNSLGHCDEEFSKIIAEQAQE
ARGD_BACCR      ------------HLFQTYGRRTIEFVKGTGTKVIDNKGKEYLDFTSGIGVCNLGHCHPTVLKGVQEQLDD
ARGD_YARLI      -----LLQTAEKYSVPTYAKPSVILTKGKGAYLWDSNDNKYIDFSAGIAVTALGHSNPEITKILAEQSSQ
ARGD_BUCAP      -------------------------VKGKGSRLWDQKGKEYIDFSGGIAVTSLGHCHPVLNKVLRQQSKK
OAT2_STAAW      --SEKIIELTNHYGAHNYLPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQALKDQVSR
OAT2_STAAS      --SEKIIELTNHYGAHNYLPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQALKDQVSR
OAT2_STAAR      --SEKIIELTNHYGAHNYLPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQALKDQVSR
OAT2_STAAN      --SEKIIELTNHYGAHNYLPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQALKDQVSR
OAT2_STAAM      --SEKIIELTNHYGAHNYLPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQALKDQVSR
OAT2_STAAC      --SEKIIELTNHYGAHNYLPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQALKDQVSR
ARGD1_BORPA     ---------------NIYARLPVSFTHGRGVWLWDTGERRYLDALAGIGVSCLGHGHPGLVAAISEQAAR
ARGD1_BORBR     ---------------NIYARLPVSFTHGRGVWLWDTGERRYLDALAGIGVSCLGHGHPGLVAAISEQAAR
OAT_STACT       --SEDIIKKTEHYGAPNYKPLPIVISEAEGIWITDPEGNKYMDMLAAYSAVNQGHRHPKVIEALKEQADK
OAT2_STAS1      --SEEIIEVTNHYGAQNYVPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQALKEQADK
ARGD_DICDI      ----DYIKLHDNVIMNTYGRVSIVFTHGKDSWLYDMKGDKYLDFGAGIAVNALGHSNDGWSEVVANQSKK
ARGD_CAMJE      ----------QSHIIPTYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGYNHAKFNAKIKAQVDK
OAT1_STAAW      -----IIELTDYYSSNNYAPLKLVISKGKGVKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMTEQASK
OAT1_STAAS      -----IIELTDYYSSNNYAPLKLVISKGKGVKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMTEQASK
OAT1_STAAN      -----IIELTDYYSSNNYAPLKLVISKGKGVKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMTEQASK
OAT1_STAAM      -----IIELTDYYSSNNYAPLKLVISKGKGVKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMTEQASK
OAT1_STAAC      -----IIELTDYYSSNNYAPLKLVISKGKGVKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMTEQASK
ARGD_LEPIN      ---QHTKELADHYLLNTYARYDVAFRYGVNELLFDFDNKQYIDFHCGVAVTNLGHADPDIIEVVRSQADK
ARGD_LEPIC      ---QHTKELADHYLLNTYARYDVAFRYGVNELLFDFDNKQYIDFHCGVAVTNLGHADPDIIEVVRSQADK
ARGD1_BORPE     ---------------NIYARLPVSFTHGRGVWLWDTGERRYLDALAGIGVSCLGHGHPGLVAAISEQAAR
OAT1_STAAR      -----IIELTDYYSSNNYAPLKLVITEGKGGKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMTEQASK
ARGD_XANAC      ------------YYLPVYRPRQVVLERGQGSRVWDDAGREYLDLSSGIAVSGLGHNDPDLVAALTEQAGK
ARGD_CAUCR      ----------QHHIMGVYNRAPLAFERGRGARLISTEGEEYLDCVAGIATNGLGHAHPALVEVLKAQAEK
OAT_GEOSW       ----EIIRLTEQYGANNYHPLPVVLTKGEGVWVEDPEGNRYMDMLSAYSAVNQGHRHPKIIQALKEQADR
OAT_BACSU       --SKEIIDQTSHYGANNYHPLPIVISEALGAWVKDPEGNEYMDMLSAYSAVNQGHRHPKIIQALKDQADK
OAT_STAES       --SEKIINLTNHYGAHNYVPLPIVISEAEGVWVKDPEGNTYMDMLSAYSAVNQGHRHPRIIQALKDQVSR
OAT_STAEQ       --SEKIINLTNHYGAHNYVPLPIVISEAEGVWVKDPEGNTYMDMLSAYSAVNQGHRHPRIIQALKDQVSR
OAT_MACCJ       --SQDIIEITNHYGAPNYHPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQALKEQADR
ARGD_STRAW      --NAELTERWQGALMNNYGTPRLPLVRGAGTRLWDADGKEYLDFVGGIAVNALGHAHPAIVEAVSTQIAS
ARGD_ASHGO      -----LTASMQKYFVDVYAKPDLVLTRGRGSRLFDVNKREYIDFVAGIAVTSLGHSDPAIAEVIAAQSAT
OAT_DROAN       --SETVFARENKYGAHNYHPLPVALSKGEGVFVWDVEGKRYFDYLSAYSAVNQGHCHPKIVKALTEQASK
OAT_PLAFD       -SSQDYMNNELTYGAHNYDPIPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKK
OAT_PLAF7       -SSQDYMNNELTYGAHNYDPIPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKK
OAT_DROME       -----VYARENKYGAHNYHPLPVALTKGEGVFVWDVEGKRYFDYLSAYSAVNQGHCHPKIVAALTAQASK
ARGD_MYCLE      -------------MMNNYGTPPIVLASGNGAVVTDVDSNTYLDLLGGIAVNVLGHRHPAVIEAVTHQITT
ARGD2_BORPE     -------------LMEITARPDLVFVRGQGSWLEDHAGKRYLDFVQGWAVNTLGHCAPEMKRAMAEQADK
ARGD_STRCO      MSNEELTERWQGTLMNNYGTPRLPLVRGEGARLWDADGKEYLDFVGGIAVNALGHAHPAVVDAVSRQIAS
ARGD_LACLA      -------------LFENYGRLPFSLIKGEDQYLFDDRGNKYLDFTSGIGVMNLGYSFEKGKVAVKAQLDS
ARGD2_BORBR     -------------LMEITARPDLVFVRGQGSWLEDHAGKRYLDFVQGWAVNTLGHCAPEMKRALAEQADK
ARGD_STAEQ      ------------YLFNNYKRDNIEFVDANQNELIDKDNNVYLDFSSGIGVTNLGF-NMEIYQAVYNQLNL
ARGD_STAES      ------------YLFNNYKRDNIEFVDANQNELIDKDNNVYLDFSSGIGVTNLGF-NMEIYQAVYNQLNL
ARGD2_BORPA     ----------------------LVFVRGQGSWLEDHAGKRYLDFVQGWAVNTLGHCAPEMKRALAEQADK
OAT_PLACH       -----------KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPDILNAMINQAKN
ARGD_MYCTU      ----------QAVMMNNYGTPPIALASGDGAVVTDVDGRTYIDLLGGIAVNVLGHRHPAVIEAVTRQMST
ARGD_MYCBO      ----------QAVMMNNYGTPPIALASGDGAVVTDVDGRTYIDLLGGIAVNVLGHRHPAVIEAVTRQMST
ARGD_STRCL      MSNQEFAQRWQGVMIDSYGTPGLSFVRGEGSTLWDADGTAYTDFVSGLAVNALGHAHPAVVGAVSRQIAS
ARGD_SCHPO      -------------IISVYARYPVVAAKGEGSYLFDKEGRKYIDFTSGVAVTSLGHAHPEVARLAADQCSK
OAT_OCEIH       ------------YGAHNYHPLPIVVSEANGVWVKDPEGNSYMDMLSAYSAVNQGHRHPKIIEALKNQADK
OAT_CAEEL       LTSQQIFDREKKFGCHNYKPLPVALSKGEGCFVWDVEGKKYFDFLAAYSAVNQGHCHPKLLKVVQEQAST
ARGD_KLULA      ----------QKYQATTYARPNLVLTRGKNAILYDVNNKEYIDFTAGIAVTALGHANPEVAEIMYKQSKK
OAT_BRAJA       ----DYLATETRLGAHNYEPIGVVLSRGEGVWVWDTDGNRYLDCLSAYSAVSQGHCHPKILAAMVEQAHR
OAT1_STAS1      -----------KYSSKNYSPLKLALAKGRGAKVWDIEDNCYIDCISGFSVVNQGHCHPKIIKALQEQSQR
OAT_BACCQ       IQTKDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANR
OAT_BACC3       IQTKDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANR
OAT_BACAN       IQTKDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANR
OAT_BACAC       IQTKDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANR
OAT_BACAA       IQTKDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANR
OAT_BORPE       ---------------HNYQPLDVVLARGSGVWLYDTAGRRYLDCLSAYSAVNQGHCHPRILAAMVEQAQR
OAT_BORPA       ---------------HNYQPLDVVLARGSGVWLYDTAGRRYLDCLSAYSAVNQGHCHPRILAAMVEQAQR
OAT_BORBR       ---------------HNYQPLDVVLARGSGVWLYDTAGRRYLDCLSAYSAVNQGHCHPRILAAMVEQAQR
OAT_BACCR       IQTKDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANR
ARGD_BIFLO      -----------QVHMNVFGTPLRVMDHGQGAHIWDVDGNEYLDFLAGIAVNSLGYAHPXXXXXXXXXXXX
ARGD_YEAST      ------------FQVTTYSRPELCITRGKNAKLYDVNGKEYIDFTAGIAVTALGHANPKVAEILHHQANK
ARGD_SULTO      -----------------YGDRGLTIVKGEGQYVWDISGTKYLDLHTGIGVAFLGHRNRRVIEYLSRQMEN
OAT_PLAYO       -----------KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKN
ARGD_PYRKO      -------------------RKRLRLVRGEGVYVWDEKGRRYLDLIAGIGVNVLGHAHPEWVLDMSRQLEK
ARGD_LACPL      -----------QHVFPTYQRFPFAITDGQGVHLTDNHGKTYLDFTAGIGVCNFGYHQPQIQAAVTQQLTH
OAT_BACHD       -----VIEKTEKYGAKNYHPLPIVISEAKGVWVKDPEGRKYLDMLSAYSAVNQGHCHPKIIQALKDQADK
OAT_BOVIN       -----------KYGAHNYHPLPVALERGKGIYVWDVEGRKYFDFLSAYSAVNQGHCHPKIVDALKSQVDK
ARGD_PYRHO      -------------------RKRLKIIKGEGIYVWDDQGRRYVDLIAGIGVAILGHNHPEWVEGIREQLNK
ARGD_PYRFU      -------------------RKRLRLVKGEGIYVWDSQGKKYIDLIAGIGVNVLGHNHPEWVSELQEQLEK
ARGD_THET8      -----------------YNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAET
OAT_RAT         -SSEYIFERESKYGAHNYHPLPVALERGKGIYMWDVEGRQYFDFLSAYGAVSQGHCHPKIIEAMKSQVDK
OAT_BREBN       -----VIEQTEKFGAHNYHPLPIVISKAEGVWVHDPEGNKYLDMLSAYSALNQGHRHPRIIQALKDQADK
ARGD_PYRAB      -------------------RKRLKIVRGEGIYVWDSEGKRYLDLIAGIGVAILGHNHPKWVEEVGNQLNK
ARGD_THET2      -----------------YNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAET
OAT_SCHPO       -STEQIEVLENEYAAHNYHPLPVCFSKAKGAKVWDPEGREYLDFLSAYSAVNQGHCHPKIIEALVEQAQR
OAT_MOUSE       -SSEYIFERESKYGAHNYHPLPVALERGKGIYMWDVEGRQYFDFLSAYGAVSQGHCHPKIIDAMKSQVDK
OAT_EXISA       ----DVIELTEKFGAHNYHPLPIVISEAKGIWVTDPEGNRYMDMLSAYSAVNQGHCHPKIIQALKDQADK
ARGD_DEIRA      -NPSKWLAAEKKYDSGVYNKHDVVMVRGQGATVWDENGRSYIDCVVGYGVATLGHSHPDVVKAVQEQAGK
OAT_HUMAN       --SDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDK
OAT_DICDI       --SKELIEMESEFAAHTYHPIPVVFKKASGVHVWDVEEKQYFDFLSAYSAVNQGHSHPKIVSALITQAQK
PAT_ENTS8       ----------------------------------DTQGQEFLDCLGGFGIFNVGHRNPVVVSAVENQLKQ
PAT_ECOL5       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
ARGD_CANGA      ------------YQVTTYARSDLCITRGLNAKLFDDNNKEYIDFTAGIAVTALGHANPKVAEILQTQATK
PAT_KLEP3       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVENQLKQ
OAT_EMENI       -STQEAIQAENDFAAHNYHPLPVVFARAQGTSVWDPEGRHYLDFLSAYSAVNQGHCHPKLVAALVDQASR
PAT_ECOUT       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECOSE       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECOLU       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECOLI       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECOK1       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECOHS       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECODH       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECOBW       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECO81       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECO5E       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECO57       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECO55       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECO45       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECO27       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECO24       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_KLEP7       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVENQLKQ
PAT_ECOLC       ----------------------------------DTQGEEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ESCF3       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
OAT_YEAST       LSSKQTIEWENKYSAHNYHPLPVVFHKAKGAHVWDPEGKLYLDFLSAYSAVNQGHCHPHIIKALTEQAQT
PAT_SHIFL       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SHIF8       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECOL6       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECO7I       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECOSM       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ECO8A       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALPK       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALPA       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
ARGD_PYRAE      -----------------YREYGIRIVKGFMQYVWDDKGQRYIDCNTNHGVVFLGHANPKIVEAVKKQVEE
PAT_SHISS       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALTI       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALHS       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALTY       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALSV       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALNS       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALG2       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALEP       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALDC       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALA4       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_CITK8       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALPC       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALCH       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALPB       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
YKAB_BACPF      ----------------------LPVVKEEGCYYYGVDGVKYLDFTSGIAVTNVGHRHPKIVQAIKEAADH
PAT_ERWCT       --NQEVLSCFREYVNPGFLEYRKSVTTGYGAVEWDTQGNEYLDCLGGYGIFNVGHRNPNVIAAVESQLRQ
ARGD_BACAM      -------------LFQTYGRWDIDIKKAKGTYVEDQNGKTYLDFIQGIAVSNLGHCHEAVTEAVKKQLDS
PAT_SHIBS       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_ENT38       ----------------------------------DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
PAT_SALAR       --NREVIDYFKEHVNPGFLEYRKSVTAGYGAVEWQAQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLKQ
GABT_ECOLI      -SNKELMQRRSQAIPRGVGQIPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKK
GABT_BACSU      -------------------------VKGEGAELYDLDGRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEE
YHXA_BACSU      --------------------------KAEGAWVTDTDGRRYLDAMSGLWCVNIGYGRKELAEAAYEQLKE
ARGD_SULSO      ------------------------IIKGEGQYVWDEKNNKYLDMHAGHGVAFLGHRNKVIIDHLKKQMEE
AGT22_ARATH     -------------------RKPLNIVDGKMQYLFDESGRRYLDAFAGIAVVNCGHCHPDVVEPVINQIKR
PUUE_ECOLI      ----------------------------ENATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQ
AGT23_ARATH     ----EIIAKRREFLSPAFYNTPLNIVEAKMQYVFDENGRRYLDAFGGIATVSCGHCHPEVVNSVVKQLKL
DAT_HAEIN       ---QAILASNQHFLVRSYPRLPFAYAKAQGCWVTDVEGNEYLDFLAGAGTLALGHNHPILMQAIKDVLDS
Y4UB_RHISN      -------------------REPTIVETGKGIRIQDARGNQLIDGFAGLYCVNVGYGRTEVAEAISRQAYR
Y1815_ARCFU     ----------------------------EGVWYWDLDGRKLMDCHCNGGVFNLGHRHPEIVKTLVEALDE
ECTB_NOCFA      ---------------------PTVFTTAKGAWLQDEDGKDYLDFFAGAGALNYGHNNPVLKQPLIDYIAS
OAT_VIGAC       VTSEQVFEREQKYGAHNYHHCSAYRAKGVSL---DMEGKRYFDFLSAYSAVNQGHCHPKIVNTMVEQAQR
YFZ7_SCHPO      ---------------------PKIIVRAKGCCVYDEQDNAILDFTSGQMSAILGHSHPDITACIEKNLPK
TPA_BILWA       ----ELVALDKKYVWHHLTQHPAIYVKGEGMRITDIDGKTYLDAVSGWTVN-VGYGRKEIVDAVAKQMME
AGT2_MOUSE      -----VLAIHKQHVDTAYFRKPLLLHQGHMEWLFDSEGNRYLDFFSGIVTVSVGHCHPKVSAVAKKQIDR
AGT21_ARATH     -----------------YYQKPLNIVEGKMQYLYDESGRRYLDAFAGIVTVSCGHCHPDILNAITEQSKL
AGT2_PONAB      -------------VVTAYFQKPLLLHQGHMEWLFDAEGNRYLDFFSGIVTVSVGHCHPKVNAVAQKQLGR
AGT2_HUMAN      -------------VVTAYFQKPLLLHQGHMEWLFDAEGSRYLDFFSGIVTVSVGHCHPKVNAVAQKQLGR
AGT2_BOVIN      -------------VHTAYFPEPLLLHQGHVEWLFDHEGNRYLDFFSGIVTVSVGHCHPKVNAAAQRQLGR
DAT_ACIBA       -------------------KLPLAIAKAQGCWVTDVEGTQYLDCLAGAGTLALGHNHPAVIQSIQDTLAS
AGT2_RAT        -------------VNTAYFQKPLLLHQGHMEWLFDSEGNRYLDFFSGIVTVGVGHCHPKVTAVAKKQMDR
ARGD_AERPE      -----------------YGYRGLRIVKGSMQYVWDDSGRKYLDCHAGHGAAFLGHSNPAIVEAVVRQARE
ECTB_CHRSD      --------------VRTYSRFPTVFTEAKGARLHAEDGNQYIDFLAGAGTLNYGHNHPKLKQALADYIAS
GSA2_BREBN      ------------------GGNPVYIEKGEGSRIFDVDGNSYIDYIGSWGPLILGHAHPRVLAAITEVAA-
GSA_METMP       --SKKYLVGGVNSPVRLFKPFPFFVKSAKDCFLYDEDGNEFIDYCLAYGPMVLGHANENILNAV----KS
GSA_SHEAM       ---------------NGVGGTPRFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPSIREAVLKAVHN
RHBA_RHIME      -------------------RFPVALKSASGCIVTDVDGRSYLDCLAGAGTLALGHNHPEVIETLQQVLGS
GSA_CHLCH       ------------------GGTPIYMAKGSGAYMTDVDGNTYLDYVGSWGPFILGSMHPRITAALEYTLKN
GSA_SHEON       ---------------NGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIREAVLAAVHN
GSA_SHESH       ---------------NGVGGSPRFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIREAVLAAVEN
GSA_SHEPW       ---------------NGVGGSPRFIEKADGAYIFDADGKKYIDYVGSWGPMILGHNHPKIRAAVLEAVEN
GSA_NATTJ       ---------------------PLFIKDGSGSKVYDVDDNEYIDYVASYGPLILGHCHPQIRDALKEQIDY
GSA2_GEOTN      ------------------GMTPIFMARGQGAKIYDIDGNEYIDYVLSWGPLILGHADPQVVEALKRVAEQ
GSA_SHEWM       ---------------NGVGGSPRFIDKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRQAVLEAVEN
GSA2_GEOKA      ------------------GMTPIFMARGQGAKIYDIDGNEYIDYVLSWGPLILGHANPQVVEALKRVAEQ
GSA_SHESA       ---------------NGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIREAVLAAVHN
GSA_SHEPA       ------------------GGSPRFIEKADGAYIFDADGKKYIDYVGSWGPMILGHNHPKIREAVLKAVEN
GSA_SHELP       ---------------NGVGGSPRFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRQAVLDAVEN
GSA_GEOSF       ------------------GRDPLFIKKASGCKIEDVDGNQFIDFVGSWGPMILGHCHPQVASAVKAAVDS
GSA_GEOUR       ------------------GTDPLFIEKASGSRIYDVDGNEFIDYVGSWGPMILGHCHPQVVAAVKSAVDN
GSA_SHESM       ---------------NGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIREAVLAAVHN
GSA_CHLPB       ------------------GGTPIFMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRITAAI-ENTLT
GSA_SHESR       ---------------NGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIREAVLAAVHN
GSA_PROA2       ------------------GGTPIYMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRITAAL-EHTLT
ECTB_VIBCH      ----DIFKHHESQVQSYANHFPVLFGTAKGSWLYSQQGDAYLDFLSGAGALNYGHNNAVLKQALLEYIER
DGDA_BURCE      ---------------------PMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGK
GSA_SHEHH       ------------------GGSPRFIEKADGAYIFDADGKKYIDYVGSWGPMILGHNHPKIREAVLAAVEN
GSA_METM7       --SRKYLVGGVNSPVRSFKPFPFFVKSAKDCFLYDEDGNEFIDYCLAYGPMVLGHANENILNAV----KS
GSA_META3       --SQKYLVKGVNSPVRYFKPFPFFVNNAKDYYLVDVDGNKYIDYCLAYGPAVLGHANENIANAVIEQLKT
BIOA_HAEIN      VDEQSLLAFDTQHIWHPYSSMPLAVERADGVMITLKDGRRLIDGMSSWWAALHGYNHPRLNAAAQNQLAK
GSA_THERP       ------------------GEEPVVAVRGEGAYLIDADGRRFLDYICSWGALLAGHAHPHVVDRLSEAIQ-
GSA_SHEDO       ---------------NGVGGSPLFIEKADGAYIFDADGNKYIDYVGSWGPMILGHNHPKIRQAVLDAVEN
GSA_THISH       ---------------------PVFIQRAEGAYMYDADGKRYIDYVGSWGPMIAGHAHPEVVEAVREAARG
GSA_METM6       --SKKYLVGGVNSPVRSFKPFPFFVKSAKDCFLYDEDGNEFIDYCLAYGPMVLGHANENILNAV----KS
AT2L1_MOUSE     -SKQDTLALRERHIGPSFAADPIKIMRAQGQYMFDEKGERYLDCINNVAH--VGHCHPEVVKAAAKQME-
ECTB_WOLSU      ---------------------PVIFERSKGAYLYDEQGKAYIDFFAGAGTLNYGHNHPKIIEAMIAYLQN
GSA_SHEFN       ---------------NGVGGSPLFIEKADGAYIFDADGKKYIDYVGSWGPMILGHNHPKIRQAVLDAVDN
GSA_NITMS       ---KKVIPSGVNSPVRYFEPYPFFTKKANGAYIWDVDNRKLIDFCNGYGALLLGHRRKEIINSVSKQLKG
BIOA_BACSH      ---------------------PIVIKKGEGVWLYDEQNQRYLDAVSSWWVNLFGHANPRISQALSEQAFT
GSA_METM5       --SKKYLVGGVNSPVRSFKPFPFFVKSAKDCFLYDEDGNEFIDYCLAYGPMVLGHANENILNAV----KS
GSA_DESAP       ---------------------PIFFLRGEGALLFDVDGNRYIDYVASWGPLILGHAHPLVVRAVCAEFGT
ECTB_OCEIH      ---------------------PVVFEKAKGYKLWDKNGNEYIDFFAGAGALNYGHNPSEMQKVMIDYIQN
GSA_PELPB       ------------------GGTPVYMAKGSGAYMTDVDGNTYLDYVGSWGPFILGSMHPRITAALEYTLKN
GSA_PSEA7       ------------------GGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDH
GSA_METVS       --SKKYLVGGVNSPVRSFKPFPFFVKSAKSCFLYDEDGNEFIDYCLAYGPMVLGHANEKILNAVKEQ---
ECTB_VIRPA      ---------------------PTIFEKAKGYKLWDIDGNMYIDFFAGAGALNYGHNHDTMQEKLIAYIQD
GSA_PSEAE       ------------------GGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDH
GSA_PSEAB       ------------------GGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDH
GSA_PSEA8       ------------------GGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDH
GSA_METJA       ---------------------PFFVEKAKDCYLFDVDGNCYIDYCLAYGPMVLGHAN----DAVIKAVKE
GSA_DESRM       ------------------GMNPPFIARANGSRMWDVDGNEYIDYICSWGPQILGHRHPAVIHALCLEKGT
GABT_MYCTU      --------------------LPVFVARAGGGIVEDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRTQVAE
GABT_MYCBO      --------------------LPVFVARAGGGIVEDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRTQVAE
GSA_SYNJB       ---------------------PVVFDRVSGAYAWDVDGNQYIDYIGSWGPAIVGHAHPEVIEALRRALEK
GSA_GRAFK       ------------------GGEPIFIEKAEGAYIYDEDGNKLIDYINSWGPLILGHAHKPVIDAVIEKAKK
GSA1_LISW6      ---------------NSVDATPVFMDHGKGAYITDIDGNEYIDYVLSWGPLILGHANPSVVDAITKAAMK
GSA_SYNJA       ---------------------PVVFDRVAGAYAWDVDGNQYIDYIGSWGPAIVGHAHPEVIEALRRALEK
GSA_SHESW       ---------------NGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRAAVLAAVEN
GSA_SHEPC       ---------------NGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRAAVLAAVEN
GSA_SHEB9       ---------------NGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRAAVLAAVEN
GSA_SHEB8       ---------------NGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRAAVLAAVEN
GSA_SHEB5       ---------------NGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRAAVLAAVEN
GSA_SHEB2       ---------------NGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRAAVLAAVEN
GSA_METST       --------------VRAYKPYPFFAKSAKGSKIYDVDGNEYIDYCLGYGPLLFGHANEHIIEKSIEQLKL
YAV5_SCHPO      ----------------------------------------------------------------------
BIOA_AQUAE      --------------------------RGEGVYLWDIYGRKYIDAISSLWCNVHGHNHPKLNNAVMKQLTT
GSA_THICR       ---------------------PVFFESAKGAYLTDADGKQYIDYVASWGPAILGHTHPDVIKAVQTQAEK
GSA_HELMI       ------------------GRNPVFIERAEGAYLYDVDGNKYVDYVGSWGPMIVGHAHPEVSEA----LKA
GSA1_LISIN      ---------------NSVDASPVFMDHGKGAYITDVDGNEYIDYVLSWGPLILGHADPSVVNAITNSAMK
AT2L1_XENLA     ---------------------PIKIVHAKGQYMFDEKGERYLDCINNVAH--VGHSHPEVTKAALKQME-
AGT2L_DROME     ---------------------PLKIVRGQGQYMFDEEGTRYLDCINNVA--HVGHCHPEVVRAGALQMAT
Y4QG_RHISN      ---------------------PVVFEKAAGAILHDESGREFIDFLSGSGVLNYGHNDPYFLDEATQYLRS
GSA_RUBXD       ---------------------PLFMERGEGPRIFDADGNAYIDYVMSYGPLLLGHAPPEVVGAVERAARR
GSA_CLOTH       ------------------GGYPPFIKKAKGARIYDADGNEYIDYVGSWGPMILGHSHPRVLEAVSKTMVD
GSA_DESAH       ------------------GGSPLFIQKAEGSKIIDADGNVYIDYVGSWGPMILGHRHPDVVKALIEALAS
GSA_CHLTE       ------------------GGTPIYMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRVTAAILRNIGT
GSA_CALS8       ---------------------PPVISKGKGCRIFDIDGNEYIDFVLSWGAMILGHCDPDVVNSIKEVVED
GSA2_LISMH      ---------------NSVDASPVFMDHGKGAYITDIDGNEYIDYVLSWGPLILGHANPSVVQAITNAAMK
AT2L1_HUMAN     ---------------------PIKIVRAQRQYMFDENGEQYLDCINNVAH--VGHCHPGVVKAALKQME-
GSA_PSEFS       ------------------GGTPLFFKHAEGAYVTDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRKQLEH
GSA_CHLL2       ------------------GGTPIYMAKGEGAYMTDVDGNTYLDYVGSWGPFILGSMQPRVTAAI---EYT
GSA1_STACT      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHENPQVIENLHKAVDT
GSA1_LISMO      ---------------NSVDASPVFMDHGKGAYITDVDGNEYIDYVLSWGPLILGHTDPAVVNAITKAA--
BIOA_METJA      ----------KEYIWHPYTQMKLIIERGEGNYLIDIYGNKYLDAVSSIWCNLFGHSRKEIIEAIKNQAST
GSA_PROMP       ------------------GGQPIVFDRVKGPYAWDIDGNRYIDYIGSWGPAICGHAHPEVITALQEAIEK
GSA_PROMA       ---------------------PIVFDRVKGAYAWDLDGNRFIDYVGSWGPAICGHSHPEVIEALEKGTSF
GSA_PROM9       ------------------GGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAICGHAHPEVTTALQEAIEK
GSA_PELLD       ------------------GGNPIFMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRITAAL-EHTLT
GSA_PELCD       ------------------GRQPLFIERAEGCTLVDADGNRYIDYVGSWGPMIVGHSHPKVVEAICDAAAT
GSA_SYNPW       ------------------GGQPLVFDRVKGPYAWDVDGNKYIDYIGSWGPAICGHAHPEVISALQEAIEK
GSA1_LISMF      ---------------NSVDASPVFMDHGKGAYITDVDGNEYIDYVLSWGPLILGHADPAVVNAITKAA--
GSA1_LISMC      ---------------NSVDASPVFMDHGKGAYITDVDGNEYIDYVLSWGPLILGHADPAVVNAITKAA--
GSA1_BACC2      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KS
GSA_SYNS9       ------------------GGQPIVFDRVKGPYAWDVDGNKYIDYIGSWGPAICGHAHPEVISALQEAIEK
GSA_PERMH       ------------------GMEPLFIQKGKGSRVWDVDGNEYIDYVLSWGPLILGHANDQIVNAI-KQVAN
GSA_GEOSL       ------------------GADPLFIKKAFGCTITDADNNSYIDYVGSWGPMILGHCHPQVVEAVKRAVES
GSA2_BACCR      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KS
GSA2_BACC4      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KS
ECTB_STRAW      ---------------------PTVFDRAQGSRMYDEDGHAYLDFFAGAGSLNYGHNNPVLKRALIDYLER
GSA_THEEB       --SQEIFAAAQKLMFKSVGGQPIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVGHAHPEVIDA-------
GSA_SYNS3       ------------------GGQPIVFDRVKGPYAWDVDGNKYVDYIGSWGPAICGHAHPEVISALQEAIEK
GSA_PSEF5       ------------------GGTPLFFKHAEGAYVTDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRKQLEH
GSA_PROMT       ---------------------PIVFDRVKGPYAWDVDGNRYIDYVGSWGPAICGHAHPEVIAALQETLEK
GSA_PROM1       ---------------------PIVFDRVKGPYAWDVDGNRYIDYVGSWGPAICGHAHPEVIAALQETLEK
GSA_METS5       ---------------------PFYTRSAKGAYLVTEDSRRLIDFVLGYGPLILGHAHPKVIEAVKDQLER
GSA_CHLT3       ---------------NSVGGTPVFVTKGEGARMIDVDGNSYIDYVGSWGPFILGHSHPRVIEAIERTMKT
GSA2_BACWK      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KA
GSA2_BACHK      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KA
GSA2_BACCZ      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KA
GSA2_BACCQ      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KA
GSA2_BACC7      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KA
GSA2_BACC3      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KA
GSA2_BACC0      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KA
GSA2_BACAN      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KA
GSA2_BACAH      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KA
GSA2_BACAC      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KA
GSA2_BACAA      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KA
GSA_PROMS       --SEEIFSAAQQLMFKSVGGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAICGHAHPEVTTALQEAIEK
GSA_PROMM       ------------------GGQPIVFDRVKGAYAWDVDGNRFIDYIGSWGPAICGHAHPEVIVALQDALEK
GSA_PROM4       ---------------------PIVFDRVKGPYAWDLDGNRFIDYVGSWGPAICGHSHPEVIEALEKGTSF
GSA_PROM3       ------------------GGQPIVFDRVKGAYAWDVDGNRFIDYIGSWGPAICGHAHPEVIAALQDALEK
GSA_PROM2       --SEEIFSAAQQLMFKSVGGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAICGHAHPEVTTALQEAIEK
GSA_PROM0       ------------------GGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAICGHAHPEVITALHEAIEK
GSA_MARMS       ---------------NGVGGTPIFFQRGEGAYVYDEDKKRYIDYVGSWGPMILGHSHPDVLDAVRQQLDF
GSA_CHLP8       ------------------GGTPIYMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRLTAAILRNIGT
GSA2_BACSK      ------------------GMNPVYMKEGKGAKIKDIDGNEYIDYVLSWGPLILGHANDVVVEELKKA--T
GSA2_BACC1      ------------------GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANNRVVEAL----KA
ECTB_BACSK      ---------------------PAVFTKAKGWKMWDEDGTEYIDFFAGAGALNYGHNDEKMKRALIDYIAD
BIOB_BACTN      ---------------STTDPLPVYKVKADGATITLEDGRTLIEGMSSWWCAVHGYNHPVLNQAAKDQLDK
GSA_SULAA       ------------------GTDPIFIQRGKGSRIWDVDGNEYIDYVLSWGPLILGHAHDQVVNAI-KQVAN
GSA_SOLUE       ------------------GGQPVFIARGQGSHLFDVDGNEYIDYVGSWGPLILGHRHPEILAALERALE-
GSA_PROM5       ------------------GGQPIVFDRVKGPFAWDVDGNRYIDYIGSWGPAICGHAHPEVITALQEAIE-
GSA_PELPD       ------------------GSDPLFIQSASGCTITDVDGNTFIDYVGSWGPMIVGHCHPQVVEAVRQAAGS
GSA_HAES1       ------------------GGTPVFIEKANGAYIFDTEGKQYIDYVGSWGPMILGHNHPSILSAVLKTAEN
GSA2_ANOFW      ---------------------PIFMARGKGSKIYDIDGNEYIDYVLSWGPLILGHANDQVVEALKRVAET
YGD3_SCHPO      ---------------------PPTVVRAEGVYLYLEDGTRIMDATGGAAVACLGHGNKEVIDAMHKQSEK
GSA_PSEMY       ------------------GGTPLFFKHAEGAYVVDEDDKRYVDYVGSWGPMILGHSHPDVLDSVRRQLQH
GSA_ALTMD       ------------------GGTPRFITKADGAYMWDADGKQYIDYIQSWGPMILGHNNAPIREAVIEA---
AT2L1_BOVIN     -SKQETLALRRKHIGPSFAADPIKIVRAQRQYMFDEKGDQYLDCINNVAH--VGHCHPEVVKAAQKQME-
GSA_YERPY       ------------------GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVER
GSA_YERPS       ------------------GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVER
GSA_YERPP       ------------------GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVER
GSA_YERPN       ------------------GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVER
GSA_YERPG       ------------------GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVER
GSA_YERPE       ------------------GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVER
GSA_YERPB       ------------------GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVER
GSA_YERPA       ------------------GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVER
GSA_YERP3       ------------------GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVER
GSA_THEYD       ------------------GGNPLFIAKAKGSKIYDVDGNEYIDYVLSWGPLILGHAYPSVVKALKKAIEK
GSA_PSEU5       ------------------GGTPLFLKHAEGAYVIDEDDKRYVDYVGSWGPMILGHSHPQVLDAVRRQLEH
GSA_MOOTA       ------------------GLTPPFIQRGEGAYLYDIDGHKYIDYVSSWGPLILGHRHPEVVDAL---EKT
GSA_KLEP3       ------------------GGTPLFIERADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAASR
GSA_VIBVY       ---------------NGVGGSPIFVERADGAFIFDADGKAYIDYVGSWGPMILGHNHAVIREAVIEAAQR
GSA_VIBVU       ---------------NGVGGSPIFVERADGAFIFDADGKAYIDYVGSWGPMILGHNHAVIREAVIEAAQR
GSA_PSEU2       ------------------GGTPLFFKHAAGAYVTDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRSQLEH
GSA_PSE14       ------------------GGTPLFFKHAAGAYVTDEDDKRYVDYVGSWGPMILGHSHPEVLDAVRSQLEH
GSA_NITSB       ------------------GGVPPFIDRGEGAFLYDIDGNRYIDYVQSWGPLIFGHADKETLEAVCEQAQK
GSA_HAES2       ------------------GGTPVFIEKANGAYIFDIEGKQYIDYVGSWGPMILGHNHPSILSAVLKIAEN
GSA_FUSNN       ---------------------PIFIKKGQGAKIWDEDDNEYIDYICSWGPLILGHNHPKVIE----EVKK
GSA_DESAA       ------------------GTDPCFIARGQGSAIFDADGKQYIDYIGSWGPLILGHRHPAVIKAI--EAAL
GSA2_LYSSC      ---------------------PIFMESGHGAIIKDIDGNEYIDYVLSWGPLILGHTHPEVVKAIAETAAK
GSA2_BACHD      ---------------------PVFMERGKGANIYDIDGNEYIDYVLSWGPLILGHADDQVVEKLKETTET
ECTB_MARHA      ---------------------PTVFHQAKGYKLWDLDGKEYVDFFSGAGALNYGHND----ENMKQKLLT
GSA_SYNSC       ------------------GGQPIVFDRVKGPYAWDVDGNKYIDYIGSWGPAICGHAHPEVIAALQEAIEK
GSA_HERA2       ------------------GGVPRFIDHGAGAYLYDIDGNQYIDYVLSWGPLILGHAYPAVVEAICAQAQR
GSA_CLOK5       ---------------------PPVIKKGRGAYIYDEDGNEYIDFVCSWGPMILGHCDEDVVNAIKYTSEN
GSA_CLOK1       ---------------------PPVIKKGRGAYIYDEDGNEYIDFVCSWGPMILGHCDEDVVNAIKYTSEN
ECTB_BACHD      ---------------------PTVFTKAKGYKMWDEAGKEYIDFFSGAGALNYGHNDEKMKKALVDYIMD
GSA_VIBCM       ---------------NGVGGSPIFIDRADGALIFDADGKAYIDYVGSWGPMILGHNHAVIREAVIQAAQR
GSA_VIBCH       ---------------NGVGGSPIFIDRADGALIFDADGKAYIDYVGSWGPMILGHNHAVIREAVIQAAQR
GSA_VIBC3       ---------------NGVGGSPIFIDRADGALIFDADGKAYIDYVGSWGPMILGHNHAVIREAVIQAAQR
GSA_SULSY       ---------------------PIFIKKGKGCRIWDVDDNEYIDYVLSWGPLILGHAHDQVINAI-KQISN
GSA_DESPS       ---------------------PLFIERAEGSYIYDADGQKYLDFVNSWGPMIMGHAHPDIIKAI--QDAA
GSA_CHLPD       ------------------GGTPIYMAKGRGAYLTDVDGNSYLDYVGSWGPFILGSMHPRITAALEYTLKN
ECTB_STRCO      ---------------------PTVFDRAVGSRMYDEDGHEYLDFFAGAGSLNYGHNNAVLKRALIDYLER
GSA_TOLAT       ---------------NGVGGTPRFIAKADGAYLFDVDGNRYIDYVGSWGPMLLGHNHPAIKAAVLAAVEN
GSA_KLEP7       ------------------GGTPLFIERADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAASR
GSA_BORPA       ------------------GGTPRFIQRAQGPYVWDAEGKQYIDYVGSWGPAILGHAHPEVVRAV--QEAA
GSA_BORBR       ------------------GGTPRFIQRAQGPYVWDAEGKQYIDYVGSWGPAILGHAHPEVVRAV--QEAA
GSA_ANATD       ---------------------PPVISKGKGCRIFDIDGNEYIDFVLSWGAMILGHCDPDVVNRMKEVVED
GSA2_BACA2      ---------------------PIFMQRGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAET
GSA_SYNPX       ------------------GGQPIVFDRVKGPYAWDVDGNKYIDYIGSWGPAICGHAHPEVISALQEAIEK
GSA_MANSM       ------------------GGTPVFIQKAKGAYIWDTDDKQYVDYVGSWGPMILGHNHPAILSAVIKTAEN
GSA_GEOBB       ------------------GSDPLFIKKAAGPRIYDEDGNAFIDYVGSWGPMILGHCHPQVVSAIKAAVDN
GSA_CYAP8       ------------------GGQPIVFDRVKGAYIWDVDGNQYIDYVGTWGPAICGHAHPDVIAALHEALE-
GSA_CYAA5       ------------------GGQPIVFDHVKGAYIWDVDGNQYIDYVGTWGPAICGHAHPEVIAALHDALDR
GSA_BACSU       ---------------------PIFMERGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAE-
GSA_ANAVT       --SQEIFAAAQNLMFKSVGGQPIVFDHVKGAYIWDVDGNQYIDYVGTWGPAICGHAHPDVIGALHEALEK
GSA_SHISS       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_PSESM       ------------------GGTPLFFKHAAGAYVTDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRNQLEH
GSA_PSEPF       ------------------GGTPLFFKHAEGAYVTDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRNQLQH
GSA_NOSP7       --SQEVFAAAQNLMFKSVGGQPIVFDRVKGAYIWDVDGNQYIDYVGTWGPAICGHAHPEVIAALHEALEK
GSA_ERWT9       ---------------NGVGGVPLFIERANGAYLYDADGKAYIDYVGSWGPMVLGHNHPAIRNAVIDAAER
GSA_ECOUT       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECOSE       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECOLU       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECOLC       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECOL6       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECOL5       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECOK1       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECOHS       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECO8A       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECO81       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECO55       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECO45       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECO27       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECO24       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_DESHY       ------------------GREPIFIAKGQGARLWDIDGNSYLDYVLSWGPLILGHAHPVVVGA----IKA
GSA_DESHD       ------------------GREPIFIAKGQGARLWDIDGNSYLDYVLSWGPLILGHAHPVVVGA----IKA
GSA_ACTSZ       ------------------GGTPVFIQKAAGAYITDTDGKQYIDYVGSWGPMVLGHNHPAIIDAVLKAVPN
GSA_ECO5E       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECO57       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_VIBF1       ------------------GGSPIFVERADGPLIFDADGKAYIDYVGSWGPMILGHNHAAIREAVISAAQR
GSA_SERP5       ---------------NGVGGVPLFIERADGAYLFDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAQR
GSA_GLOVI       ------------------GSEPVFIERAEGAYLWDVDGNRYIEYINTWGPSIVGHSHPEVISALREALPK
GSA_ERWCT       ---------------NGVGGTPLFIERADGAYLYDVDEQAYIDYVGSWGPMVLGHNHPSIRDAVIAAAER
GSA1_STAAR      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
ECTB_HALEL      --------------VRTYSRFPVVFTKARNARLTDEEGREYIDFLAGAGTLNYGHNNPHLKQALLDYIDS
BIOB_BACFR      ---------------STSNPLPVYKVKADGATITLESGQTLIEGMSSWWCAVHGYNHPILNQAVQDQLSR
GSA_VIBPA       ---------------NGVGGSPLFIERADGALIFDADGRAYIDYVGSWGPMILGHNHAVIREAVIDAAQR
GSA_PHOLL       ---------------NGVGGTPLFIKHADGAYLYDVDGKAYIDYVGSWGPMVLGHNHSAIRNAVIKAAEQ
GSA_CYAP7       ------------------GGQPIVFDHVEGAYIWDVDNNQYIDYVGTWGPAICGHAHPDVISALHKALD-
GSA_BORPE       ------------------GGTPRFIQRAQGPYVWDAEGKQYIDYVGSWGPAILGHAHPEVVRAV--QEAA
GSA_ANASP       --SQEIFAAAQNLMFKSVGGQPIVFDHVKGAYIWDVDGNQYIDYVGTWGPAICGHAHPDVIGALHDALEK
GSA2_BACCN      ------------------GMNPLFMEQGKGSKVYDIDGNEYIDYVLSWGPLIHGHANERVVESL----KA
GSA_VIBFM       ------------------GGSPIFVERADGPLIFDADGKAYIDYVGSWGPMILGHNHAAIREAVISAAQR
GSA_GEOLS       ------------------GADPLFIKRASGSKIFDEDNNTYIDYVGSWGPMILGHCFPEVVNAV----KQ
GSA_CITK8       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAAR
GSA_ALHEH       ------------------GGEPPFIARAEGPYLYDEDGNRYVDYVCSWGPMVAGHAHPKVVRAV--QAAA
GSA_ACAM1       ------------------GGQPIVFDRVKGAHVWDVDGNQYIDYVGTWGPAICGHAHPEVLTAL----KE
BIOB_BACFN      ---------------STSNPLPVYKVKADGATITLESGQTLIEGMSSWWCAVHGYNHPILNQAVQDQLSR
GSA_SYNY3       ------------------GGQPIVFDRVEGAQIWDVDGNQYIDYVGTWGPAICGHAHPDVISAL-KQALD
GSA_PELTS       ------------------GLNPVFVKKGEGARIYDFDDNEYIDYVCSWGPLILGHRHPRVVGAL---ERC
GSA_HAEPS       ------------------GGTPVFIDSAKGAYITDSEGKRYIDYVGSWGPMVLGHNHPAIIDAVLKAVPN
GSA_DESDG       ---------------------PVFVERGQGSKLYSVDGREYIDFVESWGPLLLGHAHPAVNKAIHEAVDK
GSA_CELJU       ------------------GGTPVFFEKALGAYIWDADGKRYIDYVQSWGPMVLGHAHPEVINTVIDAAKH
ECTB_VIBPA      ----DIFKKQESNVRSYSNNFPVVFRKAKGCWLETEQGERYLDFLAGAGSLNYGHNNPVLKQALLEYIEM
BIOK_BACSU      --------------MKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLST
GSA_SALTY       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_SALPC       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_SALCH       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_PECCP       ---------------NGVGGTPLFIERADGAYLYDADEQAYIDYVGSWGPMVLGHNHPAIRDAVIAAAER
GSA_COXBU       ------------------GGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILGHAHPAVIQAAQEAVQN
GSA_COXBR       ------------------GGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILGHAHPAVIQAAQEAVQN
GSA_COXBN       ------------------GGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILGHAHPAVIQAAQEAVQN
GSA_COXB2       ------------------GGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILGHAHPAVIQAAQEAVQN
GSA_COXB1       ------------------GGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILGHAHPAVIQAAQEAVQN
GSA_CAMHC       ------------------GSEPFMVQKGKGAYIYDIEGNKYLDFVQSWGPLIFGHADKDIQDAVIKTAKS
GSA2_EXISA      ------------------GMTPIFAERGEGSRVYDIDGNEYIDYVLSWGPLILGHRDPVVTKAIQEQAEK
GSA1_STAAB      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
AGT2L_CAEEL     -----------------YSDDPFMVSRASMQYLYDEKSNKFLDCISN--VQHVGHCHPKVVEAISKQLAT
GSA_SYNR3       ------------------GGQPIVFDRVEGAYAWDVDGNRYIDYIGSWGPAICGHANPEVIEALQQALTK
GSA_SHIDS       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_SHIBS       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_SHIB3       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_SALPK       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_SALPA       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_SALHS       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_NAUPA       ------------------GGEPPFIEKGEGAYIYDINGNKYLDYIQSWGPLIFGHCDKDIEKAICNAVSK
GSA_ENT38       ------------------GGTPLFIERADGAFLYDVDGKAYIDYVGSWGPMVLGHNHPTIRNAVIEAAQR
GSA_ECOSM       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECOLI       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECODH       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECOBW       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_ECO7I       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
AT2L1_DANRE     ---------------------PIKIVRAKGQYMYNEKDEKYLDCINNVAH--VGHCHPDVVSAGAKQMEL
GSA_PICTO       -----------------YRPVPVMFERGRGSRIYDVNGKEYIDYSLGFGPMILGHADPDVASAIKRQADN
GSA_PASMU       ------------------GGTPIFIEKAQGAYLYDTEGNQYIDYVGSWGPMILGHNHPTILDAVISTAQN
GSA_CLOBB       MNNLEIFEESKKYMFKEMGMNPPVIKSGKGVIIKDEDGKEYIDFVLAWGPLLLGHCDEDVVKAIKETSEN
GSA1_STAAW      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
GSA1_STAAS      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
GSA1_STAAN      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
GSA1_STAAM      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
GSA1_STAA9      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
GSA1_STAA2      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
GSA1_STAA1      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
AT2L2_MOUSE     ---------------------PVKIIRGQGQYLYDEQGREYLDCINNVAH--VGHCHPTVVQAAHEQ-NL
GSA_XANOR       ------------------GGEPFFVARADGSYLFDVDGNRYIDYVGSWGPMIAGHNHPAVREAVERAIRD
GSA_XANOP       ------------------GGEPFFVARADGSYLFDVDGNRYIDYVGSWGPMIAGHNHPAVREAVERAIRD
GSA_XANOM       ------------------GGEPFFVARADGSYLFDVDGNRYIDYVGSWGPMIAGHNHPAVREAVERAIRD
GSA_NITEU       ITNQQLFERSRQYIFKSVGGTPVFFQRGQGAYFWDVEGKSYIDYVGSWGPLILGHAHPDVVRAV--QIAA
GSA_MARAV       ------------------GGTPVFFKHAEGAYLYDEDDRRYIDFIGSWGPMILGHSDPRIKAALHAQVDL
GSA1_STAAU      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
GSA1_STAAT      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
GSA1_STAAE      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
GSA1_STAAC      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
GSA1_STAA8      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
GSA1_STAA3      ---------------------------GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDT
GSA_SALAR       ------------------GGTPLFIEKADGAWLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_CHRVO       --NSPVRAFGQ------VGGTPRFVARAEGAYFWDADGKQYLDYVGSWGPAIVGHAHPEVVKAV--QDAA
GSA_BORA1       ------------------GGTPRFIKRALGPHIWDADGKQYIDYLGSWGPAILGHAHPEVVRAV--QDAA
GSA_VIBHB       ---------------NGVGGSPLFIERADGALIFDADGKAYIDYVGSWGPMILGHNHAVIREAVIDAAQR
GSA_PSEHT       ---------------NGVGGTPLFITKAEGAFTFDADGNRYIDYVGSWGPMIMGHNHPAIKQAVHDAVEN
GSA_PROMH       ---------------NGVGGTPLFIERANGAYIYDADGRAYLDYVGSWGPMVLGHNHPAIRHAVTDAVQK
GSA_METS3       ---------------------PFFVKKASGSKIYDVDGNKYIDHCLAYGPLILGHADPKVVREVSNQ---
GSA2_STAS1      ---------------------------GEGSRIYDIDGNEYIDYVLSWGPLILGHKNKQVIEKIHEAVDT
GSA1_BACCZ      ------------------GGAPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA_SULIM       LNSEELWAQARQLVRAAVKPFPFYVERGKGAYIYTVEGNKFIDYVLGYGPLILGHSPESVKRKIIEQLEK
GSA_SULIA       LNSEELWAQARQLVRAAVKPFPFYVERGKGAYIYTVEGNKFIDYVLGYGPLILGHSPESVKRKIIEQLEK
GSA_SALEP       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_LEGPL       ------------------GGEPVFFKSGKGAYLTDVDDKQYIDYVGSWGPLILGHCHPKVIEA----VDN
GSA_LEGPC       ------------------GGEPVFFKSGKGAYLTDVDDKQYIDYVGSWGPLILGHCHPKVIEA----VDN
GSA_LEGPA       ------------------GGEPVFFKSGKGAYLTDVDDKQYIDYVGSWGPLILGHCHPKVIEA----VDN
GSA2_BACP2      ---------------------PIFMERGKGAKIYDIDGNEYIDYVLSWGPLILGHTNDRVVESIQRVAEK
GSA2_BACC2      ------------------GGAPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA1_BACHK      ------------------GGAPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA1_BACCR      ------------------GGAPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA1_BACC4      ------------------GGAPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA1_BACC3      ------------------GGAPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA1_BACC0      ------------------GGAPIAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA1_BACAN      ------------------GGAPIAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA1_BACAH      ------------------GGAPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA1_BACAC      ------------------GGAPIAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA1_BACAA      ------------------GGAPIAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA_SULIY       LNSEELWAQARQLVRAAVKPFPFYVERGKGAYIYTVEGNKFIDYVLGYGPLILGHSPESVKRKIIEQLEK
GSA_SULIN       LNSEELWAQARQLVRAAVKPFPFYVERGKGAYIYTVEGNKFIDYVLGYGPLILGHSPESVKRKIIEQLEK
GSA_SULIL       LNSEELWAQARQLVRAAVKPFPFYVERGKGAYIYTVEGNKFIDYVLGYGPLILGHSPESVKRKIIEQLEK
GSA_SULIK       LNSEELWAQARQLVRAAVKPFPFYVERGKGAYIYTVEGNKFIDYVLGYGPLILGHSPESVKRKIIEQLEK
GSA_SALTI       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_SALSV       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_SALPB       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_SALNS       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_SALDC       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_HAHCH       --SEELFSRAQQHIFRGVGGAPVFFSKGEGAYLYDEDGKRYIDYVGSWGPMILGHAHPDVRQALERQLAN
GSA_ENTS8       ------------------GGTPLFIERADGAYLYDADGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA1_BACWK      ------------------GGSPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA_METTH       ---------------------PFFAAGGSGCLLESVDGESYIDYCLAYGPLILGHAHPRVVEAVNEQIKR
GSA_LEPCP       ------------------GGTPRFIARAQGAYMWDAEGKQYIDYIGSWGPMILGHGHPAVLAAVQKAATE
GSA_CLOBA       MNNLEIFEESKKYMFKEMGMNPPVIKSGKGVIIRDEDGKEYIDFVLAWGPLLLGHCDEDVVKAIKETSEN
GSA_ACTPJ       ------------------GGTPVFIQKAEGAYITDSDGKKYIDYVGSWGPMVLGHNHPAIIDAVLKAVPN
GSA_ACTP7       ------------------GGTPVFIQKAEGAYITDSDGKKYIDYVGSWGPMVLGHNHPAIIDAVLKAVPN
GSA_ACTP2       ------------------GGTPVFIQKAEGAYITDSDGKKYIDYVGSWGPMVLGHNHPAIIDAVLKAVPN
GABT_MYCLE      --------------------LPVFVTRAAGGVIEDVDGNRLIDLGSGIAVTTIGNSSPXXXXXXXXXXXX
GSA_WOLSU       ------------------GGTPPFIKEAKGSYLVDEDGNRYIDFVQSWGPLLFGHADLDIQKAVEEAIKR
GSA_SYNFM       ------------------GTNPIFIREAKGCYLWDEDGNRYVDFVASWGPLIVGHAHPXXXXXXXXXXXK
GSA_SULSO       MNSEELWAQAKQLVRAAVKPFPFYVERGKGAYIYTVDGKKFIDYVLGYGPLILGHSPESVKRRIVEQLER
GSA_SULDN       ------------------GGTPLFIANGSGAYLTDIDGNRYVDFVQSWGPLLFGHRDESIESAVIEAVKH
GSA_METCA       ------------------GGTPVFVDRAEGPYVYGVDGKAYIDYVGSWGPMILGHAHPEVLTAVHAAVD-
GSA_LEGPH       ------------------GGEPVFFKSGKGAYLTDVDDKQYIDYVGSWGPLILGHCHPKVIEA----VDN
GSA_STRMK       ------------------GGEPFFVERADGAYLYDVDGNRYIDYVGSWGPMIVGHNHPAVRQAVKKAIDN
GSA_SODGM       ---------------NGVGGTPLFIASADGARLTDADGNSYIDYVGSWGPMVLGHNHPAIRQAVLDAVQR
GSA_SALG2       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_PROVI       ------------------GGNPIFMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRITAALERTLTT
GSA_IDILO       ---------------NGVGGSPIFFESAEGAYMIDADGKRYIDYVGSWGPMILGHNHPAVLEATLQAAKR
GSA_HORVU       ------------------GGQPIVFDSVKGSHMWDVDGNEYIDYVGSWGPAIIGHADDKVNAALIETLKK
GSA_HAMD5       ---------------------PFFVEKAGGAYLYDVDGRAYIDYVGSWGPMILGHRHPVICDALTKAIEN
GSA_ESCF3       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_CHLRE       ---QELLPGGVNSPVRAFGGGPIVFDRVKGAYCWDVDGNKYIDYVGSWGPAICGHGNDEVNNALKAQIDK
GSA_AZOSB       ------------------GGTPRFIERAEGARVWDADGKAYIDYVGSWGPAIAGHSHPAIVEAV--REAA
GSA1_STAES      ---------------------------GEGSKIYDIDGNEYIDYVLSWGPLILGHKNQQVISKLHEAVDT
GSA1_STAEQ      ---------------------------GEGSKIYDIDGNEYIDYVLSWGPLILGHKNQQVISKLHEAVDT
ECTB_BACPA      -NGMEIIEERESAVRSYSRSFPTVFEKAKDHLVWDVDGKEYIDFFAGAGSLNYGHNNEKMKTKIMDYVMN
GSA1_BACCQ      ------------------GGAPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA1_BACC7      ------------------GGAPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA1_BACC1      ------------------GGAPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAE-
GSA_SHIFL       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_SHIF8       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_SALA4       ------------------GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAER
GSA_EDWI9       ------------------GGTPLFIERADGAHLYDADGKAYIDYVGSWGPMILGHNHPVIRDAVIAAVGR
GSA2_EXIS2      ------------------GMTPIFAERAQGSRLYDIDGKEYIDYVLSWGPMILGHADPIVTAAIQEQATR
GSA_PHOPR       ------------------GGSPLFIERADGAYIFDADGKAYIDYVGSWGPMILGHNHVAVRDAVIKAAQQ
GSA2_BACLD      ---------------------PIFMERGKGSKIYDIDGNEYIDYVLSWGPLILGHSNEKVVKEIQKAAEX
GSA_YERE8       ------------------GGVPLFIERADGAYLFDVDGKAYIDYVGSWGPMVLGHNHPAIRQAVIEAVER
GSA_NITMU       --NQQLFEQSQKFIFKSVGGTPVFFRKGEGAYAWDADDKSYIDYVGSWGPLILGHAHPEVVDAVYAAAKN
GSA_METFK       ------------------GGTPVFFKRGLGARLWDEDGKEYIDYVGSWGPMILGHAQPDVIAAVQATAAN
GSA2_OCEIH      ------------------GMNPIFMKEGKGSKIVDIDNNEYIDYVLSWGPLILGHSD----ERVVKKLQD
GSA1_CLOPH      ------------------GESPRFIKRAEGAHLYDVDGKEYIDYICSWGPMILGHNHPDILESVVQACQN
GSA_STRM5       ------------------GGEPFFVERADGAYLYDVDGNRYIDYVGSWGPMIVGHNHTAVRQAVKKAIDN
GSA_SALRD       ---------------DSVGGTPLFIERAEGAYLEDADANEYLDYVGSWGPMIFGHAHPDVVEAVKDQAEA
GSA_VIBSL       ---------------NGVGGSPIFVERADGPLIFDADGKAYIDYVGSWGPMILGHNHVVIRDAVIAAAQR
GSA_ALISL       ------------------GGSPIFIERADGPLIFDADGKAYIDYVGSWGPMILGHNHAAIREAVISAAQR
GSA1_GEOKA      ------------------GGAPVVMERAQGAYFWDVDGNKYIDYLAAYGPIIAGHAHPHIAEAIRRAAET
GSA_FLAPJ       ------------------GGTPIFAKSAKGAYVYDEDGNRFVDYINSWGPMILGHAYEPVVTAVIEKAKS
GSA_CLOPE       --NKEIFEESKKYMFGSVGINPPVIKSGKGAMIKDENGNEYIDFVLAWGPMILGHCDEDVVEAIKKTSEE
AT2L2_HUMAN     ---------------------PVKIVRAQGQYMYDEQGAEYIDCISNVAH--VGHCHPLVVQAAHEQNQV
GSA_HALMA       ---------------------PFFVEKGDGGHVIDADGNRYIDFVMGYGPLLLGHSLPEQVQSAIQQ---
GSA_FRATW       -NSQILFAEAQQYIFKSVGQFPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILGHCDDDVLEAIQCQVKN
GSA_CARHZ       ------------------GLNPVFIERGEGSKIYDIDGNCYIDYVGSWGPLILGHRHPKVEEALANCLKK
GSA1_GEOTN      ------------------GGAPVVMERAQGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITAAIQRAAET
GSA_SYNAS       ------------------GGVPRFIDRAEGSRIYDIDGREYIDYVGSWGPMILGHSHPQVVEAIRKAVER
GSA_ORYSJ       ------------------GGQPIVFDSVKGSRMWDVDGNEYIDYVGSWGPAIIGHADDTVNAALIETLKK
GSA_MICAN       ------------------GGQPIVFESVKGAYIRDVDGNEYIDYVGTWGPAICGHAHPEVIAALHDALD-
GSA_FRATT       -NSQILFAEAQQYIFKSVGQFPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILGHCDDDVLEAIQCQVKN
GSA_FRATO       -NSQILFAEAQQYIFKSVGQFPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILGHCDDDVLEAIQCQVKN
GSA_FRATN       -NSQILFAEAQQYIFKSVGQFPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILGHCDDDVLEAIQCQVKN
GSA_FRATH       -NSQILFAEAQQYIFKSVGQFPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILGHCDDDVLEAIQCQVKN
GSA_FRATF       -NSQILFAEAQQYIFKSVGQFPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILGHCDDDVLEAIQCQVKN
GSA_FRAT1       -NSQILFAEAQQYIFKSVGQFPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILGHCDDDVLEAIQCQVKN
GSA_AERHH       ---------------NGVGGTPRFIDHADGAYLYDVDGQAYVDYIGSWGPMLLGHNHPXXXXXXXXXXEK
ECTB_STRCH      ---------------------PAVFDRAQGARLTDEDGHSYLDFFAGAGSLNYGHNNPVLKRALIDYIER
GSA_RALEH       --NQQLFDRAQQTIFRSVGGTPRFITRAEGAYMWDADGQRYIDYIGSWGPMIVGHAHPEVVRAV---QET
GSA_PSYWF       ------------------GGTPVFMHKAAGSKIYDTEDNEYIDYVGSWGPMILGHAHPKVIEAVKAAADD
GSA_HYDS0       MTNKEAFELAKKYMFKSVGAEPIVVNRGFGAFVEDIEGKKYIDYMLSFGPLILGHR----SEIVVSKIME
GSA_GEOMG       ---QEIIPGGVNSPVRAFGAEPVFIKKASGSTXXXXXXXXXXXXVGSWGPMILGHCHPRIVASV--QRAT
GSA_AERS4       ---------------NGVGGTPRFIDHADGAYLYDVDGQAYVDYIGSWGPMLLGHNHPXXXXXXXXXXEK
GSA_THIDA       ------------------GGTPVFFSRARGSRVWDADGREYIDYVGSWGPAILGHAHPGTVKAVQDAAAN
GSA_RALME       --NQQLFDRAQQTIFRSVGGTPRFITRAEGAYMWDADGQRYIDYIGSWGPMIVGHAHPDVVRAV--QETA
GSA_PSEA6       ------------------GGTPPFIEKADGPYLYDADGKQYIDYVQSWGPMVLGHNNPIIRQAVIDAAQN
GSA_CYAP4       ------------------GGNPIVFDRVEGAYVWDVDGNQYIDYVGSWGPAICGHAHPEVIKALHAALDK
GSA_CLOP1       --NKEIFEESKKYMFGSVGINPPVIKSGKGAMIKDENGNEYIDFVLAWGPMILGHCDEDVVKAIKKTSEE
GSA_CUPTR       --NQQLFDRAQQTIFRSVGGTPRFITRAEGPYMWDADGQRYIDYIGSWGPMIVGHAHPEVVRAV---QET
GSA_CAMLR       ------------------GSNPLFIKKGKGAYISDIEDNTYIDYVQSWGPLLFGHCDEDVEKA-CK--KA
GSA_AZOVD       ------------------GGTPLFFKHAEGAYVIDEDDKRYVDYVGSWGPMILGHAHPDVLEAVRRQLEH
GSA_ACIBY       ---------------NGVGGTPVFIEKAKGAYLWDVDGKRYVDYVGSWGPMILGHAHPDIIKAVAPTVHE
GSA_ACIBT       ---------------NGVGGTPVFIEKAKGAYLWDVDGKRYVDYVGSWGPMILGHAHPDIIKAVAPTVHE
GSA_ACIBS       ---------------NGVGGTPVFIEKAKGAYLWDVDGKRYVDYVGSWGPMILGHAHPDIIKAVAPTVHE
GSA_ACIB5       ---------------NGVGGTPVFIEKAKGAYLWDVDGKRYVDYVGSWGPMILGHAHPDIIKAVAPTVHE
GSA_ACIB3       ---------------NGVGGTPVFIEKAKGAYLWDVDGKRYVDYVGSWGPMILGHAHPDIIKAVAPTVHE
GSA_FLAJ1       ------------------GGTPIFVKSAKGAYLYDEDGNKLIDYINSWGPMVLGHAYQPVVDAVIEKAKL
GSA_CAMC5       MTNKEAFSEAKKFIFGSVGGEPIIIDHGKGAYIYDIEGKKYLDFIQSWGPLIFGHCDADIEKAVIEAVKK
GSA_ARCFU       ---------------------PFYTARGKGSKIYDVDGNAYIDYCMAYGPLVLGHANEVVKNALAEQLER
GSA_ANADF       ------------------GGTPRFIARGKGSHLFDVDGNDYVDYVLSWGPMIVGHAHPEVMREVQDAMK-
GSA_ACIBC       ---------------NGVGGTPVFIEKAKGAYLWDVDGKRYVDYVGSWGPMILGHAHPDIIKAVAPTVHE
GSA1_BACP2      ------------------GGSPVAMEKGEGAYFWDVDGNRYIDYLAAYGPIITGHAHPHITKAITKAAE-
GSA_HALHL       ------------------GGEPIFFERGEGPYMWDVDGKRYVDYVCSWGPLVAGHADPEIVRRVQETAAK
GSA_CLOCE       ---------------------PLFISRAKGSKLYDVEEREYIDYVCSWGPMILGHSN----DLILKNVEN
GSA1_MACCJ      ---------------------PIFMERGKGSKIYDIDGNEYIDYVLSWGPLILGHANDTVTGALNKAV--
GSA1_BACCN      ------------------GGSPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHVTKA----IKT
GSA_TERTT       ------------------GGEPVFIDHAKGAYVYDIHGKRYVDYVLSWGPMLLGHGDDDVLDAVRAKLDK
GSA_RUTMC       ---------------NGVGGSPIFFTRGEGAYLFDEDDKKYIDYVASWGSMILGHTN----QAVIIAVKT
GSA_FRATM       -NSQILFAEAQQYIFKSVGQFPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILGHCDDDVLEVIQCQVKN
GSA_FRASN       ------------------GGTPRFMTSGSGPRLVDADGRTYVDLVCSWGPMILGHAHPDVVQAI-----T
GSA_DECAR       --NQQLFERAQRHIFRSVGGTPCFFQKGVGAKVQDADGKWYTDYVGSWGPMILGHAHPDXXXXXXXXXXD
GSA_AQUAE       ------------------GGKPIFLVKGRGPRVWDAEGNEYIDFLASWGAIILGHAPKKVVKAVQEEAEK
ECTB_BORPA      ---------------------PVIFSQARGSLLIDEEGNEYIDFFSGAGTLNYGHNNPVFKERLLEY---
ECTB_BORBR      ---------------------PVIFSQARGSLLIDEEGNEYIDFFSGAGTLNYGHNNPVFKERLLEY---
GSA_BURP8       -SNQELFERAQKTIFRSVGGTPRFIERAQGAYFWDAEGKRYIDYIGSWGPMIVGHVHPEVLEAVQRVLSK
GSA_PSYIN       ---------------NGVGGDPLFIEKAQGAYIYDVDKKSYIDYVGSWGPMILGHNHPEIKAAVIAAVEN
GSA_ACIAD       ---------------NGVGGTPVFIKKAQGAYLWDEDDKRYVDYVGSWGPMILGHAHPDIIQAV--QTAA
GSA1_ARATH      ------------------GGQPVLIDSVKGSKMWDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKK
GSA_MYCUA       ------------------GGTPRFITEAHGCWLTDADGNRYADLVCSWGPMILGHAHPAVVEAVSRAAAN
GSA_CAMFF       ------------------GSDPVFIDHGNGEFLYDIEGNEYIDYVLSWGPLIFGHCDSDIEEAVIKTAKK
GSA_CAMC1       MTNKEAFSEAKKYIFGSVGGEPVMIDHARGAYLYDVEGKKYLDFIQSWGPLIFGHCDKDIEEAIISAVK-
GSA2_STAES      ------------------GGAPVVMKEGHGAYLYDVDGNKYIDYLQAYGPIITGHAHPHITEAIQDQAKG
GSA2_STAEQ      ------------------GGAPVVMKEGHGAYLYDVDGNKYIDYLQAYGPIITGHAHPHITEAIQDQAKG
GSA_LACRJ       ---------------------PLFIDHGKDEYIYDIDGNKYIDYVLSWGPLILGHADDHVVAELDKAVAT
GSA_LACRD       ---------------------PLFIDHGKDEYIYDIDGNKYIDYVLSWGPLILGHADDHVVAELDKAVAT
GSA_HELAH       ---------------------PPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFGHADEEIEENIIKALKK
GSA_BURXL       ------------------GGTPRFIERAQGAYFWDADGQRYIDYIGSWGPMILGHVHPEVLEAVQRVLGN
BIOA_MYCTU      ---EQIIAVDGAHLWHPYSSIPVVAVAAHGAWIRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRV
BIOA_MYCBO      ---EQIIAVDGAHLWHPYSSIPVVAVAAHGAWIRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRV
GSA_UNCMA       ---------------------PFFTKSASGSHITDVDGNEYIDCCLAYGPLILGHGHPAVKEAITKQLEN
GSA_RALPJ       ------------------GGIPRFIAKAAGPYLWDADGTRYIDYVGSWGPMIVGHAHPEVVRAVQEV---
GSA_CLOAB       MTNKEIFEESKEYMVRAYMDLPPIIKSGKDSHLFDEEGKEYIDFIEAWGPMILGHKN----QKVLNEVKE
GSA_SYNWW       ----ELFARAREYIFKAVGNNPLFIKEGHGSKIYDVDGNEYIDYVCSWGPLILGHSHPQVVQAICEAAEK
GSA_ALKOO       ---------------NAVGGCPRFIKSASGAYIQDVEGNSYIDYIGSWGPMILGHSNPKILQAVSKMIKG
BIOA_HELPJ      MNFQENLALDLEYLMQEHQNFPIIPIKAQGIYLYDFNDNAYMDLISSWWVNLFGHNNAYISQQLKNQIDN
GSA_SYNP2       ------------------GGQPIVFDRVKGSRVWDVDGNEYIDYVGTWGPAICGHANDEVNAALRETLE-
GSA_RALSO       ------------------GGTPRFIAKAAGPYLWDADGTRLIDYVGSWGPMIVGHAHPEVVRAV--QQVA
GSA_PSEP1       ------------------GGTPLFFKHAEGAYVVDEDDKRYVDYVGSWGPMILGHGHPDVLDSVRKQLEH
GSA_DICNV       ------------------GGEPIFIARAEGAYLYDVNGRRYIDYVGSYGPMINGHAHPEIVAAVCRASRN
GSA_CLOPS       --NKEIFEESKKYMFGSVGINPPVIKSGKGAMIKDENGNEYIDFVLAWGPMILGHCDEDVVEAIKKTSEE
GSA_XYLFM       ------------------GGEPFFVARADGPYLFDVDGHRYIDYVGSWGPMIVGHNHPGVREAVQVAISN
GSA_PSEPK       ------------------GGTPLFFKHAEGAYVVDEDDKRYVDYVGSWGPMILGHGHPDVLDSVRRQLEH
GSA_NEIM0       ------------------GGVPRFIKKAEGAYVWDENGTRYTDYVGSWGPAIVGHAHPEVVEAV--REAA
GSA_AERPE       ---------------------PFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAV----EE
GSA_NEIMB       ------------------GGVPRFIKKAEGAYVWDENGTRYTDYVGSWGPAIVGHAHPEVVETVCE--AA
GSA_JANMA       ------------------GGTPRFITKAEGPYFWDADDRRYIDYIGSWGPAIVGHAHPDVVKAV--QDAA
GSA_FRAP2       ---------------------PRFIKSAKGAYLYDVDWNKYIDYIGSWGPMILGHGDDDVLEAIQCQLKN
GSA_BURPP       ------------------GGTPRFIERAQGPYFWDADGQRYIDYIGSWGPMILGHVHPEVLEAVQRVLGN
GSA_ANASK       ------------------GGTPRFISRAKGSHIFDVDGNDYVDYVLSWGPMIVGHCHPEVMREVQDAMK-
GSA_CLOTE       MNNLEIFKESEKYMVNSPVRAPPIIKKGLGSRIVDEEGKEYIDFVASWGPMILGHNDPEVVEAIQNTVED
GSA_BURTA       -NNQTLFERAQRTIFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVGHVHPDVLAAVQRVLAD
GSA_ANAD2       ------------------GGTPRFISRAKGSHIFDVDGNDYVDYVLSWGPMIVGHCHPEVMREVQDAMK-
GSA_PSYA2       ------------------GGTPIFMHRANGSKIYDTEDNAYIDYVGSWGPMILGHAHPKVIDAVKKAADD
GSA_PSEPG       ------------------GGTPLFFKHAEGAYVVDEDDKRYVDYVGSWGPMILGHGHPDVLDSVRKQLEH
GSA_PSEE4       ------------------GGTPLFFKHAEGAYVIDEDDKRYVDYVGSWGPMILGHGHPEVLDAVRNQLQH
GSA_NITEC       ITNQQLFERSRQYIFKSVGGTPIFFQRGQGACFWDVEGKSYIDYVGSWGPLILGHAHPDVVRAVQDAASR
GSA_NEIMF       ------------------GGVPRFIKKAEGAYVWDENGTRYTDYVGSWGPAIVGHAHPEVIEAM--REAA
GSA_HERAR       ------------------GGTPRFITRAEGPYFWDADDRRYIDYIGSWGPAIVGHAHPDVVKAV--QDAA
GSA_FRAAA       ------------------GGTPRFMVSGNGPYLTDADGRTYVDLVCSWGPMILGHAHPAVVEAVTRAVSA
GSA_CHRSD       -------------------RAPVFVERAQGAYLYDVEGQRYIDYVGSWGPLITGHADPDVLGAVRSRLDD
GSAB_BACSU      ------------------GGSPVAMEKASGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITEAIKKAAE-
GSA2_STACT      ------------------GGAPVVMKEGKGQYLYDVDGNRYIDYLQAYGPIITGHAHPHITKAIQEQAKG
GSA2_LISIN      ------------------GGIPVTMERANGAYFYDVDGNKYIDYLAAFGPIITGHAHPHITEAITKAAQ-
GSA1_BACA2      ------------------GGSPVAMEKANGAYFWDVDGNQYIDYLAAYGPIITGHAHPHITEA----IKT
GSA_XYLFA       ------------------GGEPFFVARADGPYLFDVDGHRYIDYVGSWGPMIVGHNHPAVREAVQVAISN
GSA_PSYCK       ------------------GGTPIFMHRANGSKIYDTEDNAYIDYVGSWGPMILGHAHPKVIDAVKKAADD
GSA_HALWD       ---------------------PFFIERGDGATVIDADGTRYLDYVMGYGPLLYGHDLPEPVNAA---IQS
GSA_ACIC5       ------------------GGEPPFLVKAEGACLWDADGNQYLDYFGSWGPMILGHAFPPVIEAIQKQAST
OAPT_PSEPU      -------------------RDPRLIVAAEGSWLVDDKGRKVYDSLSGLWTCGAGHTRKEIQEAVAKQLST
GSA_PSEPW       ------------------GGTPLFFKHAEGAYVVDEDDKRYVDYVGSWGPMILGHGHPQVLDAVRNQLQH
GSA_HALLT       ---------------------PFFIERGDGGHVIDADGNRYVDWVMGYGPLLYGHDLPDPVQAA---IQS
GSA_BORPD       ------------------GGTPRFIKRAQGPYVWDEEDTRYIDYVGSWGPAILGHAHPDVVQAV--REAA
GSA1_STAHJ      ------------------GGAPVVMREGHGAYLYDVDGNKFIDYLQAYGPIITGHAHPHITKAIQDQAKG
GSA_XYLFT       ------------------GGEPFFVARADGPYLFDVDGHRYIDYVGSWGPMIVGHNHPAVREAVQVAISN
GSA_XYLF2       ------------------GGEPFFVARADGPYLFDVDGHRYIDYVGSWGPMIVGHNHPAVREAVQVAISN
GSA_AZOSE       ------------------GGTPRFISRAEGARVWDADGKAYVDYVGSWGPAIAGHAHPAIVEAV--REAA
GSA2_LISW6      ------------------GGIPVTMERANGAYFYDVDGNKYIDYLAAFGPIITGHAHPHITEAITKAAQ-
GSA_SYNE7       ------------------GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKV
GSA_IGNH4       ---------------------PFYVKKASGATLVTVDGVELIDYVLGYGPLILGHMHPKVLEAVEEQL--
GSA_HELPH       ---------------------PPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFGHADEEIEENIINTLKK
GSA_HELP2       ---------------------PPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFGHADEEIEENIINTLKK
GSA_ARCB4       ------------------GGTPPFIKKGKGAYLYDVDGNKYVDFVQSWGPLIFGHCDKDIEKVVIKTAKK
GSA_ACIBL       ------------------GGEPPILVRGEGARVFDADGNGYIDYVLSWGPLILGHAFTPVINAIEKAAET
GSA2_MACCJ      ------------------GGAPVVMARGEGAYFYDVDGNKYIDYLAAYGPIITGHAHPHITEAIKRAAEN
GSA_HELPJ       ---------------------PPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFGHADEEIEENIINVLKK
GSA1_STAS1      ------------------GGAPVMMRSGKGAYLYDVDGNKYIDYLQAYGPIITGHAHPHITEAIQEQAAL
GSA_TRIEI       ------------------GGQPIVFDRVQGAYIWDVDGNQYIDYVGTWGPAICGHAHPEVLNG----LKE
GSA_SALTO       ------------------GGTPRFIVRGEGPWLYDADGRRYVDLVCSWGPMILGHAHPAVVEAL--RSAA
GSA_METPP       ------------------GGTPRFIARADGAYLWDADGKRYIDYIGSWGPMILGHGHPAVLEAVQKAATE
GSA_DIAST       ------------------GGTPRFITRAQGAYMWDANGQRFIDYIGSWGPMILGHGHPAVLEAV--QKAA
GSA_BURM1       ------------------GGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVGHVHPEVLDAVQKVLAD
GSA_BRANA       ------------------GGQPVLIDSVKGSKMWDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKK
GSA_AKKM8       ---------------------PFFVQSAKGAYITDADGRQLIDYIGTWGPAILGHAPQPVLDAVHAAVDR
GSA_ACISJ       ------------------GGTPRFITRAQGAYMWDANGQRFIDYIGSWGPMILGHGHPAVLEAV--QKAA
GSA2_LISMO      ------------------GGIPVTMERASGAYFYDVDGNKYIDYLAAFGPIITGHAHPHITEAITKAAQ-
GSA_SORC5       ---------------------PLFIARAQGARLFDADGAEYIDYVGSWGPAILGHAHPAVIEAV--REAA
GSA_HELPG       ---------------------PPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFGHADEEIEKNIINTLKK
GSA_DESVV       ---------------------PLFIARAAGSRLHTVDGETFIDFVESWGPMLLGHTHPEVTAAVHAAVDR
GSA_DESVH       ---------------------PLFIARAAGSRLHTVDGETFIDFVESWGPMLLGHTHPEVTAAVHAAVDR
GSA_CLONN       ------------------GLNPIFIDRAKGSKIYDVDGNEYIDYICSWGPLILGHSNEKLYEGI----EE
GSA_BURA4       ------------------GGTPRFVSRAQGPYFWDADGKQYIDYIGSWGPMIVGHVHPEVLSAVQKVLAD
GSA_ALKMQ       --SQEVIPGGVNSPVRAFGMNPPFIKRGKGAYIYDEDGNKYIDYVGSWGPLILGHCHPEVVE----NLKA
BIOA_CORGL      MENPSLRELDHRNIWHPYGVRNRLVTKTDGVFLTLEDGSTVIDAMSSWWSAIHGHGHPRLKAAAQKQIDT
GSA_SULNB       ---------------------PPFIERGEGAYLFDIDGNRYIDYVQSWGPLIFGHTDADIEASVIDSVKK
GSA_NEIMA       ------------------GGVPRFIKKAEGAYVWDENGTRYTDYVGSWGPAIVGHAHPEVIEAVREAALG
GSA_METTP       ---------------------PFYVKRAEGPYLWDEDGNSFIDYCLAYGPMILGHRNPEVMRKVEEQIER
GSA_HELPS       ---------------------PPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFGHADEEIEENIINVLKK
GSA_BURVG       ------------------GGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVGHVHPEVLAAVQRVLAD
GSA1_CENSY      -----------------------------GGSIRDADGRKYTDLCNGYGALLLGHGRGEVVRAVSAQLRR
GSA1_BACLD      ------------------GGSPVAMERGSGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKA----IQT
BIOA_HELPY      MNFQENLALDLEYLMQEHQNFPIIPIKAQGIYLYDFNDNAYMDLISSWWVNLFGHNNAYISQQLKNQIDD
GSA_SYNP6       ------------------GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKV
GSA_LARHH       ------------------GGSPRFIKRAQGAYMWDADDRRLIDYIGSWGPMILGHAHPXXXXXXXXXXXH
GSA_BURS3       ------------------GGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVGHVHPEVLSAVQNVLAD
GSA1_BACHD      ------------------GGAPVFMEKAKGAYFWDVDGNQYIDYLAAYGPIITGHAHPHITNAIQRAAEN
GSA1_ANOFW      ------------------GGAPVVMERAQGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAIQHAAE-
GSA_STRGG       ------------------GGTPRFMVSGTGPYLTDADGREYVDLVCSWGPMILGHSHPEVIAAVQEAVSR
GSA_BURCM       ------------------GGTPRFVSRAQGPYFWDADGKQYIDYIGSWGPMIVGHVHPEVLSAVQNVLAD
BIOA_SALTY      ------LAFDKRHIWHPYTSMTSPLPRAEGCELVLASGKRLIEGMSSWWAAIHGYNHPQLNAAMKAQIDA
GSA_NEIG1       ------------------GGVPRFIKKAEGAYVWDENGTRYTDYVGSWGPAIVGHAHPEVVEAVREAALG
GSA1_BREBN      ------------------GGAPVTMERAQGAYFWDVDGNRYIDYLAAYGPIITGHAHPHVTNAICEAATN
GSA_POLNA       ------------------GGTPRFIQRAQGAYFWDADGQRYIDYIGSWGPMILGHGHPAVVEAVQKAV--
GSA_NEIG2       ------------------GGVPRFIKKAEGAYVWDENGTRYTDYVGSWGPAIVGHAHPEVVEAVREAALG
GSA_MAGSM       ------------------GGIPPFIREAAGAMMTDEDGKSYIDYVGSWGPMILGHAPKEVVAAI--QQAA
GSA_DESOH       ------------------GTTPLFIDRAQGAEIVDADGNVYIDYIGSWGPMILGHRHSAVMAAIETVLKR
GSA1_EXISA      ------------------GGAPVYMERGEGAYFYDVDGNRYIDYLAAYGPIITGHAHPHIHEALMNASSK
GSA_ROSS1       ------------------GGTPRFIARGEGALIFDVDGNRYIDYVLSWGPLIAGHTHPDVVAAIAEQAAR
GSA_GEMAT       ------------------GGEPFVAARGKGARIWDVDGNEYFDYVLSWGPLVLGHAPDVVLHAVSQAM--
GSA1_LYSSC      ------------------GGSPVAMVRGKGAYFWDVDGNRYIDYLAAYGPIVTGHGHPHIAKAITHAAET
GSA_RHOBA       ------------------GGTPLFIERAEGPYLYDIDGNRYIDYIGSWGPMILGHAHPEVINAITQAAAK
GSA_PROAC       ------------------GGVPRFIEKAQGPWIWDAEGTRYVDLVCTWGPALLGHARPEVVSAV--QVAA
GSA_MYCSS       ---------------NAVGGTPRFITSANGYWLTDADDNRYVDLVCSWGPMILGHAHPAVVEAVQRVAAD
GSA_MYCSK       ---------------NAVGGTPRFITSANGYWLTDADDNRYVDLVCSWGPMILGHAHPAVVEAVQRVAAD
GSA_DELAS       ---------------NAVGGTPRFVRRAQGAHFWDENAQQFTDYIGSWGPMILGHGHPEVMAAV--QAAA
GSA_DEIDV       ------------------GGVPRFIREAHGAYLTDMDDTRYVDYIGSWGPMILGHDHPTIREAIA----T
GSA_COLP3       ---------------NGVGGTPCFIKRAQGXXXXXXXXXXXXXXVGSWGPMILGHNHPAILEAVITTAKN
GSA2_STAAB      ------------------GGAPVVMKEGRGAYLYDVDGNKFIDYLQAYGPIITGHAHPHITKAIQEQAKG
GSA_CAMJR       ---------------------PKFISHGKGAYIFDIDGNSYIDYVQSWGPLLFGHCDKDIQKACQKA---
GSA_CAMJJ       ---------------------PKFISHGKGAYIFDIDGNSYIDYVQSWGPLLFGHCDKDIQKACQKA---
GSA_CAMJE       ---------------------PKFISHGKGAYIFDIDGNSYIDYVQSWGPLLFGHCDKDIQKACQKA---
GSA_CAMJD       ---------------------PKFISHGKGAYIFDIDGNSYIDYVQSWGPLLFGHCDKDIQKACQKA---
GSA_CAMJ8       ---------------------PKFISHGKGAYIFDIDGNSYIDYVQSWGPLLFGHCDKDIQKACQKA---
GSA_ACIAC       ------------------GGTPRFVQRAQGAYFWDANGQRFIDYIGSWGPMILGHGHPAVLEAV--QKAA
GSA2_STAAW      ------------------GGAPVVMKEGHGAYLYDVDGNKFIDYLQAYGPIITGHAHPHITKAIQEQAKG
GSA2_STAAT      ------------------GGAPVVMKEGHGAYLYDVDGNKFIDYLQAYGPIITGHAHPHITKAIQEQAKG
GSA2_STAAS      ------------------GGAPVVMKEGHGAYLYDVDGNKFIDYLQAYGPIITGHAHPHITKAIQEQAKG
GSA2_STAAR      ------------------GGAPVVMKEGHGAYLYDVDGNKFIDYLQAYGPIITGHAHPHITKAIQEQAKG
GSA2_STAAN      ------------------GGAPVVMKEGHGAYLYDVDGNKFIDYLQAYGPIIAGHAHPHITKAIQEQAKG
GSA2_STAAM      ------------------GGAPVVMKEGHGAYLYDVDGNKFIDYLQAYGPIIAGHAHPHITKAIQEQAKG
GSA2_STAAE      ------------------GGAPVVMKEGHGAYLYDVDGNKFIDYLQAYGPIITGHAHPHITKAIQEQAKG
GSA2_STAAC      ------------------GGAPVVMKEGHGAYLYDVDGNKFIDYLQAYGPIITGHAHPHITKAIQEQAKG
GSA2_STAA9      ------------------GGAPVVMKEGHGAYLYDVDGNKFIDYLQAYGPIIAGHAHPHITKAIQEQAKG
GSA2_STAA8      ------------------GGAPVVMKEGHGAYLYDVDGNKFIDYLQAYGPIITGHAHPHITKAIQEQAKG
GSA2_STAA3      ------------------GGAPVVMKEGHGAYLYDVDGNKFIDYLQAYGPIITGHAHPHITKAIQEQAKG
GSA2_STAA2      ------------------GGAPVVMKEGHGAYLYDVDGNKFIDYLQAYGPIIAGHAHPHITKAIQEQAKG
GSA2_STAA1      ------------------GGAPVVMKEGHGAYLYDVDGNKFIDYLQAYGPIIAGHAHPHITKAIQEQAKG
GSA2_LISMF      ------------------GGIPVTMERASGAYFYDVDGNKYIDYLAAFGPIITGHAHPHITEAITKAAQ-
GSA1_LISMH      ------------------GGIPVTMERASGAYFYDVDGNKYIDYLAAFGPIITGHAHPHITEAITKAAQ-
BIOA_ESCVU      ---QDDLAFDRRHIWHPYSPLPVYPVQSQGCELQLASGEQLVDGMSSWWAAIHGYNHPHLNAAMKTQIEA
YODT_BACSU      ----------------------------KGSYVYDQTGKKYLDGSSGAVTCNIGHGVRDVTEKLKEQLDQ
GSA_MYCSJ       ---------------NAVGGTPRFITSANGYWLTDADDNRYVDLVCSWGPMILGHAHPAVVEAVQRVAAD
GSA_MYCMM       ------------------GGTPRFITEAHGCWLTDADGNRYADLVCSWGPMILGHAHPAVVEAVSRAATN
GSA_SALAI       ------------------GGTPRFMVRGEGPWLYDADGRRYVDLVCSWGPMILGHAHPAVVEAL--HSAA
GSA2_LISMC      ------------------GGIPVTMERASGAYFYDVDGNKYIDYLAAFGPIITGHAHPHITEAITKAAQ-
GSA_OPITP       ------------------GGAPFFVKAARGATLVTADDQELIDFVCTWGPAIHGHNHPRIKAAIAEALET
GSA_BURCJ       ------------------GGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVGHVHPEVLSAVQNVLAD
GSA_BURCH       ------------------GGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVGHVHPEVLSAVQNVLAD
GSA_BURCA       ------------------GGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVGHVHPEVLSAVQNVLAD
LAT_MYCTU       ------------------------LTRSGGSYLVDATGRRYLDMFTFVASSALGEFHAELMQAALNKPSN
LAT_MYCBO       ------------------------LTRSGGSYLVDATGRRYLDMFTFVASSALGEFHAELMQAALNKPSN
GSA_BURCC       ------------------GGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVGHVHPEVLSAVQNVLAD
GSA2_STAHJ      ----------------------------KGSRIYDIDGNEYIDYVLSWGPLILGHKNEQVIKKLHEAVNT
GSA2_CLOPH      ------------------GGSPRFIESADGAYIYDVDGNKYIDYINSWGPMILGHNHEVIRTAVIEAAQK
GSA_THEM4       ---------------------PIFVKSAKGSKIKDINNNEYIDYIQSWGALILGHSHEVVINAINEQSQK
GSA_MYCS2       ---------------NSVGGTPRFITSAGGYWLTDADGNRYIDLVCSWGPMLLGHAHPAVVEAVRKVAEH
GSA_CLOB8       ---------------------PPIIKSGKGVIIKDEEDNEYIDFVLAWGPLILGHCDDDVVEAI-KEVSS
GSA_ARTAT       ------------------GGTPKFMVSAKGAYLTDADGKEYVDLVCSWGPALLGHAHPAVLDAVHAAVDR
GSA_NATPD       ---------------------PVFADHGDGGHVIDADGNRYIDWIQGLGPLLLGHDMPEQLQAA---VQS
GSA_METBF       ---------------------PFYTASANGSKIKDLDGNEYIDYCLAYGPALLGHNHPVIKEAIKAQLKG
GSA_DEIGD       ------------------GGTPRFIREAHGAYLTDMDGHRLLDYIGSWGPMILGHDHPAVREAVAAALDT
GSA1_BACSK      ------------------GGTPVFMERGEGAYFYDVDGNRYIDYLAAYGPIITGHAHPVITKAIQDQAAK
GSA_STRAW       ------------------GGTPRFMVSGNGPYLTDADGRTYVDLVCSWGPMILGHSHPEVIAAVQEAVAR
GSA_CORDI       --SQELFARAQQFTFGSVGGHARFIQSAKGSKLYDVDGNEYVDLVCSWGPMLLGNAHPEIVEAVQKAATN
GSA_SACD2       ------------------GGEPVFIKRAKGAYLYDINDKRYVDYVLSWGPMILGHADDDVLAAVTEKLQY
GSA2_ARATH      ------------------GGQPVVMDSAKGSRIRDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKK
GSA_THEAB       ----------------------------------DINNKEYIDYIQSWGALILGHAHEEVVEEIKKQAE-
GSA_RALEJ       --NQQLFDRAQQTIFRSVGGTPRFITCAEGAYMWDADGQRYIDYIGSWGPMIVGHAHPDVVRAV---QET
GSA_METMA       ---------------------PFYTASANGSKIRDLDGNEYIDYCLAYGPAILGHNHPVIKEAIRQQLDR
GSA_HELPY       ---------------------PPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFGHADXXXXXXXXXALKK
GSA_XANCH       ------------------GGEPFFVARADGPYLFDVDDNRYIDYVGSWGPMIAGHNHPAVREAVEQSIRN
GSA_XANAC       ------------------GGEPFFVARADGPYLFDVDDNRYIDYVGSWGPMIAGHNHPAVREAVEQSIRN
GSA_SYMTH       ------------------GGAPVFMARGQGPYLYDVDGNRYIDYIXXXXXXXXXXXXPELVAAVARAAET
GSA_STRCO       ------------------GGTPRFMVSGTGPYLTDADGREYVDLVCSWGPMILGHAHPEVIAAVQEAVAR
GSA_VESOH       ---------------NGVGGNPIFFTRGKGAYLFDVDGNKYIDYVASWGPMILGHANQEVINAIKTNLEN
GSA_STRSV       ------------------GGHPLFIEKASGAYLHDVDGNRYIDYVLSWGPMILGHAPKDVLPAV---EEA
GSA_POLSJ       ------------------GGTPRFVQRAQGAYFWDADDQRYIDYIGSWGPMILGHGHPAVLASVQKALXX
GSA_METI4       ---QEIFPGGVNSPVRSFGGFPFYVSRAKGSKITDVDGNDYTDYVCSWGALIHGHAHPAVVRAVGEALKD
BIOA_ECOLI      ------LAFDQRHIWHPYTSMTSPLVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
GSA_THEVO       ----KLFPMGVNSPVRYFKDYPFYVKEGKGSTILDVDGNKYIDYCLGYGPLILGHSDPDVTRAVIEQAE-
GSA_RHOFD       ------------------GGTPRFVKRAQGAYFWDANNQRYTDFIGSWGPMILGHGHP--XXXXXXXXXX
GSA_XANC5       ------------------GGEPFFVARADGPYLFDVDDNRYIDYVGSWGPMIAGHNHPAVREAVERAIGN
GSA_CORA7       ------------------------IARGEGSRLWDIDGNEYVDLVSSYGPMIHGNAHPAIVEAVQKAAAD
GSA_ARTCA       ------------------GGTPRFMVSAKGPYLMDADGNEYVDLVCSWGPALLGHAHPAVLDAVHAAVDR
GSA_POLNS       ------------------GGIPRFVAKAKGSYFWDANDQRYIDLIMSWGPMIVGHANPEVVAAVQKAAET
GSA_ACIF5       ---------------------PIFIDHAEGPFFWDVEGKRYLDYVGSWGPMIHGHGHPEVLAAVHAQVNK
GSA_ACIF2       ---------------------PIFIDHAEGPFFWDVEGKRYLDYVGSWGPMIHGHGHPEVLAAVHAQVNK
GSA_ROSCS       ------------------GGAPRFIARGEGAFLVDVDGNRYIDYVLSWGPLILGHAHPNVVAAIAEQA--
GSA_POLSQ       ------------------GGTPRFISKAKGPYFWDAENKRYIDLIMSWGPMIAGHANPEVVEAVQKAAET
GSA_HYPBU       ---------------------PFYVERAEGPYIYTVDGEKLIDYVLAYGPLILGHKHPRVEEAVRRQLEK
GSA_SOLLC       ------------------GGQPIIIDSVKGSRMRDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKK
GSA_ANADE       ----------------------------------------------------VGHCHPEVMRAVQDAMK-
LAT_STRCL       -----------------------------GVWLVDATQKRYLDLFSFFASAPLGINPPSIVEDPAFMREL
GSA_SOYBN       ------------------GGQPIVIDSVKGSRMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKK
GSA_CYTH3       ------------------GGNPLFIKRAHGAYLVDEDDNQYIELINSWGPMILGHGNELIEKAVRDALSN
GSA_CHLSY       ------------------GGIPIFFERGQGAYVWDVDGNRYIDYVLSWGPLLLGHAHPAVVEAITLQAQR
GSA_CHLAA       ------------------GGIPIFFERGQGAYVWDVDGNRYIDYVLSWGPLLLGHAHPAVVEAITLQAQR
GSA_ARTS2       ------------------GGTPRFMVSAKGAYLTDADGAEYVDLVCSWGPALLGHAHPAVLEAVHAAVDR
GSA_METB6       ---KELMPGGVSSPVRAIKPYPFYTAHAQGAHITTVDGEDLIDCCMAYGPLLLGHAHPEIKKAIAAQLEK
GSA_BURM9       -NNQTLFERAQRTIFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVGHVHPDVLAAVQRVLAD
BIOA_SERMA      ------LAFDQRHIWHPYTSMSRPLPSASGVELQLADGRSLVDGMSSWWAAIHGYNHPRLNQAASQQLEK
BIOA_MYCLE      ---------------------PVVAVAAHGAWIRDGKPIEALDAMSSWWTAIHGHGHSVLDAALTTQLGA
GSA_TOBAC       ------------------GGQPIIIDSVKGSRMRDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKK
GSA2_CENSY      ---------GVSHNIRFYEPYPFVTRSASGKHLVDVDGNKYVDYWMGHWSLILGHAPAPVRSAVEGQLRR
GSA_RENSM       ------------------GGTPRFITSAQGAYLTDADGRDYVDLVCSWGPALLGHAHPEVIAAVHAAVDR
GSA_FRASC       ------------------GGTPRFMVAGNGPYLTDADGRTYIDLVCSWGPMILGHAHPXXXXXXXXXXXX
GSA1_OCEIH      ------------------GGSPVYMERGQGAYFWDVDDNKYIDYLAAYGPIITGXXXXXXXXXXXXXXTT
GSA_METAC       ---------------------PFYTASADGSKIRDLDGNEYIDYCLAYGPAVLGHNHPVIKAAIKEQLKG
GSA_KOCRD       ---------------NSVGGTPPFIAAAKGPYLTDVDGREYVDLVCSWGPALIGHAHPVVTEAVHEAVER
GSA_BURP0       -NNQTLFERAQRIIFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVGHVHPDVLAAVQRVLAD
BIOA_BUCBP      ------LNFDKQHIWHPYASMPCILVKSKGIILKLHNGKKLIDGMSSWWSTIHGYNHPRLNNALKNQINK
GSA_HELHP       ------------------GGTPRFIAKGKGAXXXXXXXXXXXXFVQSWGPLIFGHANEVIESALSLAIKD
GSA_CORU7       ------------------------ITSASGSQLQDADGLSYVDLVCSWGPMIHGHAHPEIVEAVKSTASR
GSA_BURPS       -NNQTLFERAQRTIFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVGHVHPDVLAAVQRVLAD
GSA_BURP1       -NNQTLFERAQRTIFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVGHVHPDVLAAVQRVLAD
GSA_BURMS       -NNQTLFERAQRTIFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVGHVHPDVLAAVQRVLAD
GSA_BURMA       -NNQTLFERAQRTIFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVGHVHPDVLAAVQRVLAD
GSA_BURM7       -NNQTLFERAQRTIFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVGHVHPDVLAAVQRVLAD
GSA1_EXIS2      ------------------GGAPVYMERGEGAYFYDVDGNRYIDYLAAYGPIITGHGHPHITEAITNASRN
GSA_MYXXD       ---------------------PVFFREGAGAWLTDVDGNRYVDLVGSWGPLILGHAYPPILDAIIDAARR
GSA_THET8       ------------------GGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILGHAHPKVLARVRETLER
GSA_METHJ       ---------------------PFYTVRGSGSRIYTVDGTELIDCCGAYGPLILGHACKPVGDAI----SS
GSA_BURP6       -NNQTLFERAQRTIFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVGHVHPDVLAAVQHVLAD
GSA_METKA       ---ERVMPGGVSSPVRRFDPYPFYVERAEGSRLYTVDGHVLIDYCLAFGPLILGHAHPXXXXXXXXXXXX
GSA_BDEBA       -------------------RAPVFFKKAEGAYLTSVEDKKYIDFCQSFGPLILGHLDAEVKEEVHRMVDT
GSA_DESDA       ---------------------PLFIAEAHGCHLTDVDGRQYIDFVLSWGPMILGHDEPSVTRAVCDAA--
GSA_DEIRA       ------------------GGVPRFIASAQGAYLTDADGARYLDYIGSWGPMILGHNHPAVRDAVAQALAT
GSA_METPE       ---------------------PFYTARGSGAVLTTIDGTDLIDCCLAYGPLILGHAFPAVQEAIAEQLQD
GSA_DESVM       ---------------------PLFVAHAKGSHLTTVDGTSFVDYVQSWGPMLLGHAHPVVASAIHAAVDR
GSA_ALCBS       ------------------GGTPVFFHSARGAHLFDEDDNKYIDYVGSWGPMILGHNHPHXXXXXXXXXEQ
GSA_NOCFA       ------------------GGTPRFIASADGYTLTDADGNEYVDLVCSWGPMILGHAHPAVVDAVRRAATG
GSA_CLAM3       ------------------GGTPRMMVKAAGPYVTDADGVEYVDLVNSWGPAILGHARPEVVQAV--QDXX
GSA_SULTO       ---------------------PFYVEKSEGAFLYTIDGQRLIDYVLGYGPLILGHAHPYVKKKIIEQIEK
GSA_PARUW       ------------------GQIPMIIDHAYRDTLVDVDGKTYVDYCGSWGALIHGHAHPSILEAVQQRMKK
GSA_PYRIL       ---------------------PLVAKGASGPYLYTDRGR-LVDYCMAFGAIILGHAHPRVKNAVTQQLER
GSA_METBU       ---RKILPGGVSSPVRAIKPYPFYTESANGCRIKDVDGNEYIDYCLAYGPNILGHANPVIKQAIIDQLDK
BIOA_BUCAP      -----------------------SVISAKGVYLKLKNGKNIIDGMSSWWSTIHGYNHPILNKSLKKQIRK
GSA_NITOC       ------------------GGEPVFFVRGEGAYLYDVDDNRYIDYVNSWGPLIVGHTHPXXXXXXXXXXXX
GSA_CALMQ       ---------------------PLIVKRAEGAFLYTIDGVKLIDYCMGFGPLILGHRHPTVLEAVRRSLED
GSA_VEREI       ------------------GGTPRFVKRARGAYFWDANDQRFIDYIGSWGPMILGHGHPAVLEAVQQAALE
GSA_MYCLE       ------------------GGTPLFITEARGCWLTDADGRRYVDLVCSWGPMILGHXXXXXXXXXXXXXXS
GSA_MYCLB       ------------------GGTPLFITEARGCWLTDADGRRYVDLVCSWGPMILGHXXXXXXXXXXXXXXS
LAT_NOCLA       --------------------LVLDLEASAGPWLVDATGTRYLDLFSGINPSCIVDDPAFVGELAAAAVNK
GSA_RHOSR       ---------------HSVGGTPRFIKEASGYTLTDVDGNDYVDLICSWGPMILGHAHPAVVEAVQKAAAT
GSA_LEPBL       ------------------GGTPVFFVSANGATLTDVSGKEYVDFCLSFGPLILGHRDPEVEEVV------
GSA_LEPBJ       ------------------GGTPVFFVSANGATLTDVSGKEYVDFCLSFGPLILGHRDPEVEEVV------
GSA_HALSA       ---------------------PTFVQSGDGGHVIDADGNRYIDWVMXXXXXXXXXXXXXXVTAAIQRTPT
GSA_HALS3       ---------------------PTFVQSGDGGHVIDADGNRYIDWVMXXXXXXXXXXXXXXVTAAIQRTPT
GSA_CLAMS       ------------------GGTPRMMVRAAGPYVTDADGVEYVDLVNSWGPAILGHARPEVVKAV--QDXX
GSA_THENV       ---------------------PLVANGASGPYLYTDRGR-LVDYCMAFGAIILGHAHPRVKNAVAKQLER
GSA_THEFY       ------------------GGTPPFMVSGKGPYLTDADGNTYVDLICSWGPLILGHXXXXXXXXXXXXXXQ
GSA_MYCVP       ---------------SSVGGTPRFITSANGCWLTDADGNRYVDLVCSWGPMILGHAHPAVVEAVQRAAAD
GSA_XANCP       ------------------GGEPFFVARADGAYLFDVDGNRYIDYVGSWGPMIAGHNHPAVREAVERAIRD
GSA_XANCB       ------------------GGEPFFVARADGAYLFDVDGNRYIDYVGSWGPMIAGHNHPAVREAVERAIRD
GSA_XANC8       ------------------GGEPFFVARADGAYLFDVDGNRYIDYVGSWGPMIAGHNHPAVREAVERAIRD
GSA_PYRAR       --------------------LPSSLVAASGPYLYTDRGR-LVDYCMAFGAIILGHAHPRVKRAVEEQLER
GSA_THEAC       -----LFPMGVNSPVRYFKDYPFYVDNASGSRIYDVDGNEYIDYCLAYGPSILGHADPDVVRAVRDQAEK
GSA_MYCA9       ------------------GGVPRFVRSGAGCWLTDVDDNRYVDLVCSWGPLILGHAHPAVVEAVQRAAKD
GSA_METMJ       ---------------------PFYVERAAGSHLTTVDGADLIDCCLGYGPLILGHAHPEVREAIERQLKG
GSA_CORJK       ------------------GGTPPFITSAQGSTLHDVDGNSYVDLFCSWGPMIHGHAHPQIVEAVREAAGH
GSA_CORGL       --------------------------KAHGSTLIDVDGNEYVDLVCSWGPMLMGHAHPAVVEAVQKAV--
GSA_CORGB       --------------------------KAHGSTLIDVDGNEYVDLVCSWGPMLMGHAHPAVVEAVQKAV--
GSA_METLZ       ---------------------PFYVKSARGATLETEDGESLVDCCMGYGPLLLGHAHP----AIQKAIEA
GSA_CHLAD       ------------------GGSPIFFERGQGAHIWDVDGNRYIDYVLSWGPLLLGHAHPAVVNAIATQAQR
GSA_LEIXX       ------------------GGTPRFMVFANGPYIVDAEGREYVDLVASWGPAILGHAHPAVVSAVQEAAAR
GSA_MYCGI       ---------------NSVGGTPRFITSAKGCRLTDVDGNQYVDLVCSWGPMILGHAHPAVVEAV---QRV
GSA_CHLMU       ---------------------PPVVTRASGDFFTDSQGKTYIDFCGSWGSLIHGHSHPYICEAIQQGLQR
GSA_SULAC       ---------------------PFYVERAEGAYLYTADNKQLIDYVLGYGPLILGHANQYVTKKIIEQV--
GSA_LEPBP       MNSETLFQRSKQVVFSSVGGTPIFFSEARGAYLKSVEGNDFIDYCLSFGPLLFGHRHPEIQEVVEDTV--
GSA_LEPBA       MNSETLFQRSKQVVFSSVGGTPIFFSEARGAYLKSVEGNDFIDYCLSFG