[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO48876.1

[Show Plain Result]


## Summary of Sequence Search
    1::151
    4::112     9e-13  34%  289 aa  Y510_ARCFU RecName: Full=Uncharacterized transporter AF_0510;
  166::274     3e-10  37%  305 aa  YYAM_BACSU RecName: Full=Uncharacterized transporter yyaM;
    4::134     2e-08  30%  276 aa  Y266_ARCFU RecName: Full=Uncharacterized transporter AF_0266;
    6::134     4e-08  27%  304 aa  PAGO_SALTY RecName: Full=Protein pagO;
  237::312     2e-07  26%  330 aa  YETK_BACSU RecName: Full=Uncharacterized transporter yetK;
  210::337     1e-06  31%  343 aa  Y841_METTH RecName: Full=Uncharacterized transporter MTH_841;
   10::140     2e-06  22%  306 aa  YBFH_BACSU RecName: Full=Uncharacterized transporter ybhF;
    7::132     3e-06  21%  304 aa  YTR1_BUCSC RecName: Full=Uncharacterized transporter in trpA
   18::161     3e-06  30%  353 aa  YP264_YEAST RecName: Full=Probable transport protein YPL264C;
  216::296     8e-06  30%  305 aa  YVBV_BACSU RecName: Full=Uncharacterized transporter yvbV;
   12::135     8e-06  30%  324 aa  YTFF_ECOLI RecName: Full=Inner membrane protein ytfF;
  162::270     8e-06  26%  311 aa  Y3017_CLOK5 RecName: Full=Uncharacterized transporter
   39::162     5e-05  30%  308 aa  Y788_ARCFU RecName: Full=Uncharacterized transporter AF_0788;
  145::284     7e-05  24%  299 aa  EAMA_ECOLI RecName: Full=Probable amino-acid metabolite efflux
  215::284     9e-05  29%  299 aa  EAMA_SALTY RecName: Full=Probable amino-acid metabolite efflux
    5::133     2e-04  23%  278 aa  Y1533_ARCFU RecName: Full=Uncharacterized transporter AF_1533;
  153::263     3e-04  25%  306 aa  YDFC_BACSU RecName: Full=Uncharacterized transporter ydfC;
  236::301     3e-04  32%  312 aa  YCBK_BACSU RecName: Full=Uncharacterized transporter ycbK;
    6::152     4e-04  25%  373 aa  S35E1_DROME RecName: Full=Solute carrier family 35 member E1
  203::284     7e-04  28%  306 aa  YEDA_ECOLI RecName: Full=Uncharacterized inner membrane transporter
  203::284     7e-04  28%  306 aa  YEDA_ECOL6 RecName: Full=Uncharacterized inner membrane transporter
  203::284     7e-04  28%  306 aa  YEDA_ECO57 RecName: Full=Uncharacterized inner membrane transporter
    6::61      7e-04  37%  300 aa  Y270_BUCAP RecName: Full=Uncharacterized transporter BUsg_270;
  142::233     0.001  25%  388 aa  GPT2_ARATH RecName: Full=Glucose-6-phosphate/phosphate translocator
    1::151

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSAKRVYILMVLAALFWSGAFITGKLAVREFPPFALTFFRFSFALPFVLWEKPLTYLPNATTEGWLAILY
Y510_ARCFU      ----KTHLLLALTMLIWAGSFIFIKIGLKELDPFNLAFYRFLLASPWVFWKRGLA---KPSGSEWLHLSV
YYAM_BACSU      ----------------WALYGVLGRRFVKDGTPLSTTTYTMSLIVVSLFTSKPVS-LSNIPIGVWGAIAF
Y266_ARCFU      ------WIVLALTVTFWGLAFTAIKYSVRFLSPIAIASLRFAFAVIIILGKRKWKDLPKVFALGIFGVSV
PAGO_SALTY      -----ISILFMLVSLTWGTTWLAMRIAVETIPPVFATGMRFMFAAPFLIWKKTLLFPPGQR----LFQFV
YETK_BACSU      ------------------------------------------------------------TVLDWSYVLY
Y841_METTH      --------LVMAAAFFWSLDTVLSKFLSRKRDLIFISGVKSSFVLLIIMLELPLEMLPYA--------LG
YBFH_BACSU      ------HIAAIVTILIWGTTFISTKVLLADFSPMEILFYRFLMGFIALILVRP-NMIPFRNWRQELLFAG
YTR1_BUCSC      -----ILLLFIIVSITWGTTFIAIRIASDTIPPLCITGMRFLLASFFLIFKTPLLFPSNKK----IFQLI
YP264_YEAST     -------ILLIVSYFFNSSMVVSTKVLENDINPLQILLVRMSITLVYMHWNKPDIPWGPAPCRKWLILRG
YVBV_BACSU      ------------------------------------------------------------------SLLF
YTFF_ECOLI      ----------LLAGLMW-GLIFVGPLIVPEYPAMLQSMGRYLIALP-IAWLGRVR-LRQLARRDWLTALM
Y3017_CLOK5     ----------LVAAVVWSLYTVISKKRIEIYGGYVFNCISFFFGVIALLILLVVTGRPGITLNNILVLLY
Y788_ARCFU      ---KRLYLGLALVALIWGSTFPVVKIALDSMSPFAFNTVRFFIACLF--------FLP--FLKGWFKDGF
EAMA_ECOLI      ------FMLTLAAAFSWAGNIFNKKIMSHSTRPAVMSLVIWSALIPIIPFFVASLILDGSATTTILSLMY
EAMA_SALTY      -----------------------------------------------------------------LSLLY
Y1533_ARCFU     -------LMSLTAAICWAFNGIAYRKGVKDVSAFTANFHRTLFALPLALRDFPGVVIDLQTA---LVLVI
YDFC_BACSU      -------LVILLAAFSESIYFVFQARYIKKFIPF-VTFTIWGGTIPMLVFLPGLEEMMNASISATLSIVY
YCBK_BACSU      ----------------------------------------------------------------------
S35E1_DROME     -TGSRHIAVVLLMCLFWSSNNVIGKMVLNEFPPMTVTLVQLCYSGPFFLWR--IRKYQDIPRPYYYRLIV
YEDA_ECOLI      -----------------------------------------------------LTALPSLS--GFLAVGY
YEDA_ECOL6      -----------------------------------------------------LTALPSLS--GFLAVGY
YEDA_ECO57      -----------------------------------------------------LTALPSLS--GFLAVGY
Y270_BUCAP      -----IIMLFFLVSITWGTTWIAMKIAVETIPPFFATGIRFLAASPLLLTKKPLLF--------------
GPT2_ARATH      -----------------------------------------------VSWATRIADAPKTDLEFWKTLFP


                         .         .         *         .         .         .         .:140
query           MAVFASVLGYLFQLIAIQNIGAPKAAIFINLVPVFTIMQSLLFLGEPFSWFKMLSACIIVTGVYLTTRPE
Y510_ARCFU      LALSGVTLLYAFQFLALKYTTATNASILINTSAVFVALWGLV----------------------------
YYAM_BACSU      MAFFTSVLGYLWWNQGIKEIGASKTSLFFNLVPVVTMIISFA-VGTPIKVFQ------------------
Y266_ARCFU      YHVFLN-LGEVY-------ISSGVASVVISLAPIFVLILSAIFLRERITYSKVVGIIIAFLGVVVISEP-
PAGO_SALTY      ICIFYFCIPFSLMIYGETYVNSGLAAIIFANMPVAVLIASVLFLNEKAKLMQIAGLTIAITAL-------
YETK_BACSU      YALFVTVLAFYLWYSGVTKVPAGVSGIFTSVLPVSAVILSGVILKEPFEFVHFIGIACVIGGIFVT----
Y841_METTH      VSVFSIGCSFILIYIAIREIGASMVGALFPLSSLFGAIFAFIILREPFSIMQGISGIVMLTGVFI-----
YBFH_BACSU      AGLFGVTLYFLLENIALTYTYASNVGMIVSIIPMITVLAHFLLEGEKLRLTFLIGFISALIGLLLIT---
YTR1_BUCSC      ICIFYFSLPFLLILYGGRYVNSTIASVIFAIMPIIVLFLSFIFFNKKLYFFQFIGLVLAI----------
YP264_YEAST     IMGFFGVFGMYFSLMYLS---ISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRP-
YVBV_BACSU      ISVFVIALGWLVFFTLVGSGEASKVASYTFLIPLISIVASSIFLHEPXXXXXXXXXXXIVTSICLVNTKS
YTFF_ECOLI      LTMMGNLIYYFCLASAIQRTGAPVSTMIIGTLPVIPVFANLLYSQRKLAWGKLAPALICI----------
Y3017_CLOK5     MGIFIKAVGYICYLGAIKETSAVTASTVFLIKPALATVLAILILGE------------------------
Y788_ARCFU      KIGIASFLGYTFQTVGLDYTTATNAGFITSTYVVLAPIISWLVYKDVFDKRDVSGVLLAFVGFY------
EAMA_ECOLI      LAFVATIVGYGIWGTLLGRYETWRVAPLSLLVPVVGLASAALLLDERLTGLQFLGAVLIMTGLYI-----
EAMA_SALTY      LAFVATILGYGIWGALLGRYETWRVAPLSLLVPVVGLASAAVLLGETLTGMQLAGAVLIMAGLYI-----
Y1533_ARCFU     SAMLSFYIGDLSYFASLKRSPVSIALPASSTYPVYVVLLSTVIYGAELSLNALISAILVFVAVYI-----
YDFC_BACSU      LGLLPTVIPYFALAYVTSFVGASEATLSLYVTPALALIISWLWIGE------------------------
YCBK_BACSU      IAVVTTVIPFVLMLEGIKRIGAQRAAAISMAGPILTIFYGALFLGERLGLIQVIGVFFVITGM-------
S35E1_DROME     PLALGKLLASVTSHISLWKVPVSYAHTVKATMPLFTVVLTRVFFGEKQPTLVYLSLLPIITGVGIATVTE
YEDA_ECOLI      LALFGSIIAINAYMYLIRNVSPALATSYAYVNPVVAVXXXXXXXXXXXSKIEWLALGVIVFAVVLVT---
YEDA_ECOL6      LALFGSIIAINAYMYLIRNVSPALATSYAYVNPVVAVXXXXXXXXXXXSKIEWLALGVIVFAVVLVT---
YEDA_ECO57      LALFGSIIAINAYMYLIRNVSPALATSYAYVNPVVAVXXXXXXXXXXXSKIEWLALGVIVFAVVLVT---
Y270_BUCAP      ----------------------------------------------------------------------
GPT2_ARATH      VAV-AHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFFMGETFPLPVYLSLLPIIGGCALAAITE


                         +         .         .         .         .         *         .:210
query           SGVKEAAxxxx
Y510_ARCFU      -----------
YYAM_BACSU      -----------
Y266_ARCFU      -----------
PAGO_SALTY      -----------
YETK_BACSU      -----------
Y841_METTH      -----------
YBFH_BACSU      -----------
YTR1_BUCSC      -----------
YP264_YEAST     -----------
YVBV_BACSU      KAQKAAA----
YTFF_ECOLI      -----------
Y3017_CLOK5     -----------
Y788_ARCFU      -----------
EAMA_ECOLI      -----------
EAMA_SALTY      -----------
Y1533_ARCFU     -----------
YDFC_BACSU      -----------
YCBK_BACSU      -----------
S35E1_DROME     -----------
YEDA_ECOLI      -----------
YEDA_ECOL6      -----------
YEDA_ECO57      -----------
Y270_BUCAP      -----------
GPT2_ARATH      -----------