[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49033.1

[Show Plain Result]


## Summary of Sequence Search
    1::153
   15::164     1e-42  56%  165 aa  PDAD_METJA RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    5::155     1e-34  50%  157 aa  PDAD_PYRKO RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    5::143     5e-34  50%  158 aa  PDAD_PYRAB RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
   14::163     1e-33  46%  164 aa  PDAD_METM5 RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
   14::163     2e-33  46%  164 aa  PDAD_METMP RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
   14::163     2e-33  46%  164 aa  PDAD_METM6 RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    5::153     3e-33  49%  158 aa  PDAD_THESM RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
   14::163     1e-32  45%  164 aa  PDAD_METVS RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    5::144     1e-32  48%  158 aa  PDAD_PYRHO RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
   15::164     4e-31  46%  165 aa  PDAD_META3 RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
   14::163     5e-29  42%  164 aa  PDAD_METM7 RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    5::143     8e-27  44%  158 aa  PDAD_PYRFU RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    6::147     2e-23  41%  151 aa  PDAD_METTH RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    4::135     3e-17  35%  150 aa  PDAD_METKA RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    5::145     5e-13  35%  157 aa  PDAD2_ARCFU RecName: Full=Pyruvoyl-dependent arginine decarboxylase
    3::128     2e-11  38%  157 aa  PDAD1_ARCFU RecName: Full=Pyruvoyl-dependent arginine decarboxylase
    3::101     8e-11  36%  183 aa  PDAD2_METAC RecName: Full=Pyruvoyl-dependent arginine decarboxylase
    7::135     1e-10  37%  166 aa  PDAD_UNCMA RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    7::130     1e-10  35%  165 aa  PDAD1_METMA RecName: Full=Pyruvoyl-dependent arginine decarboxylase
    6::104     2e-10  37%  182 aa  PDAD_PICTO RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    3::101     2e-10  42%  180 aa  PDAD_METBU RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    3::101     2e-10  35%  183 aa  PDAD2_METMA RecName: Full=Pyruvoyl-dependent arginine decarboxylase
    7::122     5e-10  37%  165 aa  PDAD1_METAC RecName: Full=Pyruvoyl-dependent arginine decarboxylase
    5::103     2e-09  37%  181 aa  PDAD_CHLL2 RecName: Full=Probable pyruvoyl-dependent arginine
    5::114     3e-09  35%  181 aa  PDAD_PELLD RecName: Full=Probable pyruvoyl-dependent arginine
    5::103     8e-09  34%  181 aa  PDAD_PROA2 RecName: Full=Probable pyruvoyl-dependent arginine
    5::103     1e-08  36%  181 aa  PDAD_CHLTE RecName: Full=Probable pyruvoyl-dependent arginine
    5::103     2e-08  34%  181 aa  PDAD_PROVI RecName: Full=Probable pyruvoyl-dependent arginine
    7::105     2e-08  33%  183 aa  PDAD_NITMS RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    5::116     2e-08  32%  181 aa  PDAD_CHLPB RecName: Full=Probable pyruvoyl-dependent arginine
    5::103     3e-08  35%  181 aa  PDAD_CHLP8 RecName: Full=Probable pyruvoyl-dependent arginine
    6::129     2e-07  31%  182 aa  PDAD_THEVO RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    6::131     4e-07  29%  182 aa  PDAD_THEAC RecName: Full=Pyruvoyl-dependent arginine decarboxylase;
    5::103     5e-07  32%  182 aa  PDAD_CHLT3 RecName: Full=Probable pyruvoyl-dependent arginine
    1::153

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxTPKKYFVTAASSEGKSKLTAFDNALLKARIGNVNLLRVSSILPPGCQEDPGMVLPPGSLVPTAYGYI
PDAD_METJA      ----PNTVSLVAGSSEGETPLNAFDGALLNAGIGNVNLIRISSIMPPEAEIVPLPKLPMGALVPTAYGYI
PDAD_PYRKO      ---TPKRAFIGAATAEGGTKLNAFDNALLKLGIGNVNLVKLSSVIPAHIEMEKVHDVPIGMLLPTVYAHI
PDAD_PYRAB      ---TPKKAIMLAAAAEGGTKLNAFDNALLKMGIGNVNLVKLSSVIPAHIEDELPKNIPIGMLLPTVYAHI
PDAD_METM5      ----PNTISLVAGTGDSNNPLNAFDMSLLKSGIGNLNLIRISSIMPPKADIIPLPKIPQGSLVPTAYGYQ
PDAD_METMP      ----PNTISLVAGTGDANNPLNAFDMSLLKSGIGNLNLIRISSIMPPKADIIPLPKIPQGSLVPTAYGYQ
PDAD_METM6      ----PNTISLVAGTGDAKNPLNAFDMSLLESGIGNLNLIRISSIMPPKADIIPLPKIPQGSLVPTAYGYQ
PDAD_THESM      ---TPKKAILLAASAEGSTKLNAFDNALLKMGIGNVNLVKLSSVIPAYIEDELPKNIPVGMLLPTVYAHI
PDAD_METVS      ----PNTISLVAGTGDAKNPLNAFDMALLSSGIGNLNLIRISSIMPPKAEIIPLPKIPQGSLVPTAYGYE
PDAD_PYRHO      ---TPKKAIMLAAAAEGGTKLNAFDNALLKMGIGNVNLVKLSSVIPAHIEDELPKNIPIGMLLPTVYAHI
PDAD_META3      ----PNTISLVAGKGDTNNPLNAFDMALLDAGICNVNLIKISSIMPPKAEVVPLPDIPMGSLVPTAYGYK
PDAD_METM7      ----PNTISLVAGTGDANNPLNAFDMSLLESGIGNLNLIRISSXXXXXXXXXXXXXXXQGSLVPTAYGYQ
PDAD_PYRFU      ---TPKKAIMLAAAAEGGTKLNAFDNALLKMGIGNVNLVKLSSVIPAHIEDELPKNIPIGMLLPTVYTHI
PDAD_METTH      ------KVAITSGAAEGPTKLNAFDNALLQAGIGDVNLIKVSSILPRNTRIVELPELEPGSIVNCVLSHM
PDAD_METKA      ----PKKYALVSGTGEADTSLAAFDAALIDAGIGDCNLVELSSILPPNAEEDDLPEFPPGSIVPAV---V
PDAD2_ARCFU     ----PKEVFFVSGVGRHEDELVSFELALRDAGIERFNLVPVSSIVPPGCKEEGLRKLSPGQIVFCVMARY
PDAD1_ARCFU     ----PRKVFFTKGVGRHTDPLVSFELALRDAGIEKFNLVTVSSIYPPYCEEKGLSELFPGQIVFCVMSRM
PDAD2_METAC     ----PRKAFLTKGTGVHKDRLASFELALRDAKIEKYNLVSVSSILPPNCREEGLSELKPGAIVHCVLARN
PDAD_UNCMA      ----PKKVFFTSGVGRHREMLESFEMALRDAGIEKFNLVTVSSILPPDCQKSEGLSLYPGEIVFTVMSRN
PDAD1_METMA     ----PKKVFFTSGAGTHPEKLESFEAALRDACIEKFNLVTVSSILPPRCEEEGLKELSPGEIVFCVMSRI
PDAD_PICTO      ----PSKVFFTRGIGRGRTELQSFENALRSAGIAQFNIVSVSSILPPRAEKDDGLLLNPGQILFTVLARN
PDAD_METBU      ----PKKAFVVKGTGVHKDKLASFELALRDAGIEKFNLVTVSSILPPNCRKEGLEELAPGQIVYCVMAKN
PDAD2_METMA     ----PRKAFLTKGTGVHKDRLASFELALRDAKIEKYNLVSVSSILPPNCREEGLAELKPGAIVHCVLARN
PDAD1_METAC     ----PRKVFFTSGVGLHSEKLESFEVSLRDAGIEKFNLVTVSSILPPNCEEEGLKELSPGEVVFCVMSRI
PDAD_CHLL2      ----PTKVFFTKGVGRHKEYLSSFELALRDAKIEKCNLVTVSSIFPPKCEEEGLKLLSPGQITFAVMARN
PDAD_PELLD      ----PSKVFFTKGVGRHKEYLSSFELALRDAKIEKCNLVTVSSIFPPKCEEEGVKMLTPGQITFAVMARN
PDAD_PROA2      ----PTKVFFTKGVGRHKEYLSSFELALREAKIEKCNLVTVSSIFPPQCEEEGLKSLSPGEITFAVMARN
PDAD_CHLTE      ----PTKVFFTKGVGRHKEYLSSFELALRDAKIEKCNLVTVSSIFPPKCEEEGLKHLKPGQITFAVMARN
PDAD_PROVI      ----PTKVFFTKGVGRHKEYLSSFELALRDAKIEKCNLVTVSSIFPPKCEEEGIKLLTPGQITFAVMARN
PDAD_NITMS      -----KKLFLTRGKGIHEDRLTSFEYALRDAGIAGTNLVLISSIFPPKARKEGLQQIKPGQILFTIYSKN
PDAD_CHLPB      ----PEKVFFTKGVGRHKEYLSSFELALRDAKIEKCNLVTVSSIFPPKCEEEGLKRLSPGEITFAVMARN
PDAD_CHLP8      ----PTKVFFTKGVGRHKEYLSSFELALRDAKIEKCNLVTVSSIFPPKCEEEGLKHLKPGQITFAVMARN
PDAD_THEVO      ----PSEIFFTRGVGRGETQLESFEAALRDAGIAQFNLSSISSIFPPHAKEEGLKKLSPGQILFTVLARN
PDAD_THEAC      ----PTHIFFTRGVGRGETQLVSFEAALRDAGIAPYNLSSISSIFPPHAEEEGLKKLSPGQILFTVLARN
PDAD_CHLT3      ----PSKIFFTKGVGRHREYLSSFELALRDAKIEKCNLVTVSSIYPPSCKEEGLKHLSPGQITFCVMARN


                         .         .         *         .         .         .         .:140
query           VSNVPGEIISACVGVGINSNDSFGVIMEFSGKCSKEEAEQNITNMVKEAFETRGMELKDIKIASAEHKVE
PDAD_METJA      ISDVPGETISAAISVAIPKDKSLGLIMEYEGKCSKKEAEKTVREMAKIGFEMRGWELDRIESIAVEHTVE
PDAD_PYRKO      ESDEPGMTISAALGVGISKNNEGGLIYEYSGYCTKEEAEEMVRKMVEEGFRQRGWELGEFKVASAEITVD
PDAD_PYRAB      ESDEPGSTISAALGVGLSENNEGGLIYEYAGYCTKEEAEEMVRKMVEEGFKVRGWKLKEIKVISAEITVK
PDAD_METM5      ISEIKGETVAAGISVAIKDKELCGLIMEYECVGGKKECEDTVRNMAKEGFEMRGWEIDEIISIASEHTVE
PDAD_METMP      ISEIKGETVAAGISVAIKDKELCGLIMEYECIGGKKECEDTVRNMAKEGFEMRGWEIDEIISIASEHTVE
PDAD_METM6      ISELKGETVAAGISVAIKDKELCGLIMEYECIGGKKECEDTVRNMAKEGFEMRGWEIDEIISIASEHTVE
PDAD_THESM      ESDEPGSTITAALGVGISEGNEGGLIYEYSGYCTKEEAEKMVHKMVEEGFKVRGWKLKEFKAAVAEITVD
PDAD_METVS      ISKIKGETVAAGISVAIKDKELCGLIMEYECVGSKKECEDTVREMAKDGFEMRGWEIDEIISIASEQTVE
PDAD_PYRHO      ESDEPGSTISAALGVGISEGNEGGLIYEYAGYCKREEAEDMVRKMVEEGFKVRGWKLKEFKVVSAEITVK
PDAD_META3      TSDIKGETVSAAVSVAIKDKELCGLIMEYSAIGGKKETEDTVREMAKTGFEMRGWEIDKIISLASECTVE
PDAD_METM7      ISEVKGETVAAGISVAVPKDKELGLIMEYECIGGKKECEDTVRNMAKEGFEMRGWEIDEIISIASEHTVE
PDAD_PYRFU      ESDEPGSTISAALGIGLSEGNEGGLIYEYSGYCXXXXXXXXXXXXXXXGFRVRGWKLKEIKIVSAEITVK
PDAD_METTH      VSERRGDLISAAVAVATSSD--FGCVVENSSNRDPEDVRSEAISMVRYMMSVRGLEIKELIVEETNHVVE
PDAD_METKA      AKAVGRGLVSSCICVG-RLESGLGIVSERAATDSVETVRRLAKRDVEEMARLRGEKLVEVRTVTASTEPE
PDAD2_ARCFU     ASNVEGREIFASVGAAFEDKDMNGYIAEHSGEW-YEGAEQHAKRLAEEMLKTQGSKVARTFAITARGKVK
PDAD1_ARCFU     TSNEQGKRIFASVGAAIPPDPSLGYLTEYHGYCNGEDAEESAAYMLKTAFE-------------------
PDAD2_METAC     DTNEPHRLMASAIGTAVPVNDNYGYISE------------------------------------------
PDAD_UNCMA      SSNEPSRRIAASIGCAISEHHSYGETEQYAGMYAEKLAENMLFTWTKE----------------------
PDAD1_METMA     SSNDPGKTLTSSVGCALPVDISHGYISEYHAEESAQDAGAHAVKLAESMYST------------------
PDAD_PICTO      SSNELNRMISSAIGYAVPSDDHWGYLSE------------------------------------------
PDAD_METBU      QTNEPERMIAAAIGVPVDSND-YGYISE------------------------------------------
PDAD2_METMA     DTNEPHRLMASAIGTAVPVNENYGYISE------------------------------------------
PDAD1_METAC     SSNEPGKTLSTSVGCALPRDISHGYISEYH---AYEENAQDVGEHAKK----------------------
PDAD_CHLL2      ATNEYNRLISASVGVAIPADDTYGYLSE------------------------------------------
PDAD_PELLD      STNEYNRLIAASIGVAIPADDTYGYLSEHHP--FGEDAEQS-----------------------------
PDAD_PROA2      STNEHGRLIASSIGVALPADESYGYLSE------------------------------------------
PDAD_CHLTE      STNENNRLISASVGVALPADESYGYLSE------------------------------------------
PDAD_PROVI      STNEYNRLMAASIGVAIPADDTYGYLSE------------------------------------------
PDAD_NITMS      QTNEPHRMCSASVGIAPKDKDRYGYLSEY-----------------------------------------
PDAD_CHLPB      STNEHNRLIASSIGVALPADESYGYLSEHHGQTSEQSGE-------------------------------
PDAD_CHLP8      STNENNRLISASVGVALPADETYGYLSE------------------------------------------
PDAD_THEVO      TSNELNRMISAAIGYAISEHHSFGETEKVAGSFAEKLAAEMLSS--------------------------
PDAD_THEAC      TSNELNRMVSAAIGYAISEHHSFGETEKVAGSFAEKLAAEMLASTI------------------------
PDAD_CHLT3      STNERNRLIASSIGVALPADASYGYLSE------------------------------------------


                         +         .         .         .         .         *         .:210
query           KIGCALAAVPLWY
PDAD_METJA      KLGCAFAAAALWY
PDAD_PYRKO      KPAAAIAVVVMF-
PDAD_PYRAB      -------------
PDAD_METM5      NIGCAFAAAALWY
PDAD_METMP      NIGCAFAAAALWY
PDAD_METM6      NIGCAFAAAALWY
PDAD_THESM      RPVAAIAAV----
PDAD_METVS      NIGCAFAAAALWY
PDAD_PYRHO      E------------
PDAD_META3      NIGCAFAAVALWY
PDAD_METM7      NIGCAFAAAALWY
PDAD_PYRFU      -------------
PDAD_METTH      KCGAAVSAV----
PDAD_METKA      -------------
PDAD2_ARCFU     E------------
PDAD1_ARCFU     -------------
PDAD2_METAC     -------------
PDAD_UNCMA      -------------
PDAD1_METMA     -------------
PDAD_PICTO      -------------
PDAD_METBU      -------------
PDAD2_METMA     -------------
PDAD1_METAC     -------------
PDAD_CHLL2      -------------
PDAD_PELLD      -------------
PDAD_PROA2      -------------
PDAD_CHLTE      -------------
PDAD_PROVI      -------------
PDAD_NITMS      -------------
PDAD_CHLPB      -------------
PDAD_CHLP8      -------------
PDAD_THEVO      -------------
PDAD_THEAC      -------------
PDAD_CHLT3      -------------