[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49038.1

[Show Plain Result]


## Summary of Sequence Search
    1::208
  490::549     2e-04  30%  649 aa  TMCC1_MOUSE RecName: Full=Transmembrane and coiled-coil domains
  494::553     2e-04  30%  653 aa  TMCC1_HUMAN RecName: Full=Transmembrane and coiled-coil domains
    1::208

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFQEYRQIVYRIKGLDKPLSSLTRAERNDVLNLSIRQEEIEKHIGQQIQKSFKELQEGLExxxxxxxxxx
TMCC1_MOUSE     IMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALE----------
TMCC1_HUMAN     IMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALE----------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TMCC1_MOUSE     ----------------------------------------------------------------------
TMCC1_HUMAN     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TMCC1_MOUSE     --------------------------------------------------------------------
TMCC1_HUMAN     --------------------------------------------------------------------