[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49162.1

[Show Plain Result]


## Summary of Sequence Search
    1::206
    8::196     4e-25  36%  210 aa  YADS_AERPU RecName: Full=UPF0126 membrane protein;
   37::227     5e-24  34%  239 aa  Y2382_VIBCH RecName: Full=UPF0126 membrane protein VC_2382;
    2::197     3e-23  33%  220 aa  Y1240_HAEIN RecName: Full=UPF0126 membrane protein HI1240;
    9::208     2e-22  36%  219 aa  Y5481_STRCO RecName: Full=UPF0126 membrane protein SCO5481;
    5::150     9e-16  35%  202 aa  YVGT_BACSU RecName: Full=UPF0126 membrane protein yvgT;
    8::200     9e-16  36%  210 aa  Y593_CAMJE RecName: Full=UPF0126 membrane protein Cj0593c;
    2::192     3e-15  31%  207 aa  YADS_ECOLI RecName: Full=UPF0126 inner membrane protein yadS;
    2::192     3e-15  31%  207 aa  YADS_ECOL6 RecName: Full=UPF0126 inner membrane protein yadS;
    8::157     1e-14  31%  218 aa  Y4104_STRCO RecName: Full=UPF0126 membrane protein SCO4104;
    2::175     2e-12  32%  205 aa  YICG_SHIFL RecName: Full=UPF0126 inner membrane protein yicG;
    2::175     2e-12  32%  205 aa  YICG_ECOLI RecName: Full=UPF0126 inner membrane protein yicG;
    2::175     2e-12  32%  205 aa  YICG_ECOL6 RecName: Full=UPF0126 inner membrane protein yicG;
   15::78      7e-07  38%  215 aa  Y2368_DEIRA RecName: Full=UPF0126 membrane protein DR_2368;
    1::206

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xTLLSLLDMIGTFAFALTGALVAVRKEMDLYGILLLSFVTAIGGGTTRDLLLGNTPVFFLNQPSYFYISL
YADS_AERPU      --IVYISDMFGTAVFAFSGVLVAGRLRMDGFGVMVLAAVTAIGGGTIRDMILGATPVFWVRDPLYIWVVI
Y2382_VIBCH     -SLLYLIDMFGTAVFAVSGVLLAGRLKMDPFGVMVLASVTAIGGGTIRDMALGATPVFWIKDTNYLWVIM
Y1240_HAEIN     --LLSILYIIGITAEGMTGALAAGREKMDIFGVIIIASVTAIGGGSVRDVLLGHYPLGWVKHPEYFLMVA
Y5481_STRCO     -TVQHTLDLVGIFVFAISGALLAVRKNFDVFGIAVLAEVTALGGGLFRDLVIGAVPPAAFTDLGYFLTPL
YVGT_BACSU      -----LLSVIGIIAFAVSGAIVAMEEEYDILGVYILGIVTAFGGGAIRNLLIGVPVSALWEQGAYFQIAL
Y593_CAMJE      ---ITTLYIIGISAEGMTGALAAGRHKMDLFGVIFIALVTAIGGGSIRDVLLGHYPLTWVKHPEYIILIC
YADS_ECOLI      --LVYWLDIVGTAVFAISGVLLAGKLRMDPFXXXXXXXXXXXXXXXIRDMALDHGPVFWVKDPTDLVVAM
YADS_ECOL6      --LVYWLDIVGTAVFAISGVLLAGKLRMDPFXXXXXXXXXXXXXXXIRDMALDHGPVFWVKDPTDLVVAM
Y4104_STRCO     ---LLALDLTGTFAFGLNGALTAVRARLDVVGVVVLGMITALGGGVIRDVLIDSLPPAAFLDWRYYTXXX
YICG_SHIFL      --LLHILYLVGITAEAMTGALAAGRRRMDTFGVXXXXXXXXXXXXSVRDILLGHYPLGWVKHPEYXXXXX
YICG_ECOLI      --LLHILYLVGITAEAMTGALAAGRRRMDTFGVXXXXXXXXXXXXSVRDILLGHYPLGWVKHPEYXXXXX
YICG_ECOL6      --LLHILYLVGITAEAMTGALAAGRRRMDTFGVXXXXXXXXXXXXSVRDILLGHYPLGWVKHPEYXXXXX
Y2368_DEIRA     ---LHWLDLIGVLAFAMSGALLGVRKRFDXXXXXXXXXXXXXXXXXIRDSLTGQTPPLFLRDETYLW---


                         .         .         *         .         .         .         .:140
query           LAGFCTFLFHKELFKINSXXXXXXXXXXXXFVCVGVSIALSAHISFXXXXXXXXXXXXXXXXXRDLLAGE
YADS_AERPU      ----ATALIGMWMVKLPRVLPVADAFGLALFTVIGAQKALNFGTSGLIAVLMGTMTGVAGGMIRDVLARE
Y2382_VIBCH     ITCALTMLLVRRPKRLAWILPVCDAIGLAVFVGIGVEKALIYQDSALIAIIMGVITGCGGGIIRDVLARE
Y1240_HAEIN     SAAVITFINHFMRY-FRTIFLVLDAMGLVVYSIIGAQIAMDMGHSLTIVCIAGCITGAFGGVLRDMLCNR
Y5481_STRCO     LATLLVFFLHPHVERLQTGVNIFDAAGLGLFCVAGTTKAYDYGLGLTASACXXXXXXXXXXXXRDVLANE
YVGT_BACSU      LSITIVFLFPKLLLKWNKWGNLSDAIGLAAFAIQGALYAVKMGHPLSAVIVAAVLTGSGGGIIRDLLAGR
Y593_CAMJE      FCALVATKIPRVVTKLETLFLTLDAIGLVVFSILGAQIAIDQNHXXXXXXXXXXXXXXXXXXLRDILCMR
YADS_ECOLI      VTSMLTIVLVRQPRRLPKWMLPVLDAVGLAFVGIGVNKAFNAEAGPLIAVCMXXXXXXXXXXXRDVLARE
YADS_ECOL6      VTSMLTIVLVRQPRRLPKWMLPVLDAVGLAFVGIGVNKAFNAEAGPLIAVCMXXXXXXXXXXXRDVLARE
Y4104_STRCO     XXXXXXXXVSRHLRRLEPAITVLDAVGLSTFAVIGASKALDAGLAVVPAMLLGVITAVGGGTIRDTLVGR
YICG_SHIFL      XXXXXXXXXXPVMPYLRKVFLVLDALGLVVFSIIGAQVALDMGHGPIIXXXXXXXXXXXXXXLRDMFCKR
YICG_ECOLI      XXXXXXXXXXPVMPYLRKVFLVLDALGLVVFSIIGAQVALDMGHGPIIXXXXXXXXXXXXXXLRDMFCKR
YICG_ECOL6      XXXXXXXXXXPVMPYLRKVFLVLDALGLVVFSIIGAQVALDMGHGPIIXXXXXXXXXXXXXXLRDMFCKR
Y2368_DEIRA     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IPTVLVKDFYALICVVGGILYVYLHHLNVPHDITLLVSASVIFFLRLAAIKLKWNFVKAxxxxxxx
YADS_AERPU      VPMVLQKEIYATACILGGILYTLSLEVGVDRVSAMLISMLGVFGLRVAAI----------------
Y2382_VIBCH     IPMVLRSEVYATACIIGGIFHTTALAMGYSSSTALLSGVFSTLLIRLGAIR---------------
Y1240_HAEIN     IPLVFQKELYASIALFATLTYYALSTLQVEHTLAVLLTLINSFTLRLLAIHFEW------------
Y5481_STRCO     VPSLLDRDLYAVPAIVGSAMVALCIRYEALTPFTSGLAVVTAFVLRLLALRFHWRAPRA-------
YVGT_BACSU      KPLVLKAEIY--------------------------------------------------------
Y593_CAMJE      IPLVFQKEXXXXXXXXXXIIWLELNAL-----VCTLLTLFIGVFARLLAIKYQWS-----------
YADS_ECOLI      IPMILRTEIYATACIIGGIVHATAYYFSVPLETASMMGMVVTLLIRLAAIR---------------
YADS_ECOL6      IPMILRTEIYATACIIGGIVHATAYYFSVPLETASMMGMVVTLLIRLAAIR---------------
Y4104_STRCO     IPTVLRTGLYAI------------------------------------------------------
YICG_SHIFL      IPLVFQKELYAGVSFASAVLYIALQHYVSNHDVVII------------------------------
YICG_ECOLI      IPLVFQKELYAGVSFASAVLYIALQHYVSNHDVVII------------------------------
YICG_ECOL6      IPLVFQKELYAGVSFASAVLYIALQHYVSNHDVVII------------------------------
Y2368_DEIRA     ------------------------------------------------------------------