[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49306.1

[Show Plain Result]


## Summary of Sequence Search
    1::343
   59::343     2e-41  32%  353 aa  YRRI_BACSU RecName: Full=UPF0118 membrane protein yrrI;
   43::343     3e-29  27%  369 aa  YUEF_BACSU RecName: Full=UPF0118 membrane protein yueF;
   56::370     3e-28  27%  388 aa  YUBA_BACSU RecName: Full=UPF0118 membrane protein yubA;
   41::344     1e-25  25%  349 aa  PERM_HAEIN RecName: Full=Putative permease perM homolog;
   35::323     2e-21  27%  344 aa  TQSA_SHIFL RecName: Full=AI-2 transport protein tqsA;AltName:
   35::323     2e-21  27%  344 aa  TQSA_ECOLI RecName: Full=AI-2 transport protein tqsA;AltName:
   35::323     1e-15  24%  349 aa  YHHT_ECOLI RecName: Full=UPF0118 inner membrane protein yhhT;
   35::323     1e-15  24%  349 aa  YHHT_ECO57 RecName: Full=UPF0118 inner membrane protein yhhT;
   36::309     1e-15  23%  334 aa  Y1211_METTH RecName: Full=UPF0118 membrane protein MTH_1211;
   99::342     4e-15  27%  353 aa  PERM_ECOLI RecName: Full=Putative permease perM;
   99::342     4e-15  27%  353 aa  PERM_ECO57 RecName: Full=Putative permease perM;
   62::357     4e-14  23%  395 aa  Y063_SYNY3 RecName: Full=UPF0118 membrane protein sll0063;
   32::295     2e-13  23%  340 aa  Y1800_ARCFU RecName: Full=UPF0118 membrane protein AF_1800;
  112::368     2e-12  21%  385 aa  YCT2_BACPF RecName: Full=UPF0118 membrane protein in ctaF
   37::314     8e-11  22%  324 aa  Y1187_THEMA RecName: Full=UPF0118 membrane protein TM_1187;
  267::337     1e-10  34%  344 aa  Y060_SYNY3 RecName: Full=UPF0118 membrane protein sll0060;
   69::323     2e-10  21%  350 aa  YDBI_BACSU RecName: Full=UPF0118 membrane protein ydbI;
  173::314     3e-08  35%  351 aa  Y630_RICPR RecName: Full=UPF0118 membrane protein RP630;
   35::322     1e-07  18%  371 aa  YTVI_BACSU RecName: Full=UPF0118 membrane protein ytvI;
  202::349     2e-05  27%  374 aa  Y006_BORBU RecName: Full=UPF0118 membrane protein BB_0006;
  280::370     2e-04  34%  403 aa  Y553_TREPA RecName: Full=UPF0118 membrane protein TP_0553;
   27::313     0.001  19%  334 aa  Y1177_METJA RecName: Full=UPF0118 membrane protein MJ1177;
    1::343

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVPFILAIVLVYMLNPLVERMEKRGSPRVVAILILYLG
YRRI_BACSU      ------------------------------------------------VTEWLHGKGLPRTLSILVIYVL
YUEF_BACSU      ----------------------------------PMLIAGILYFIFNPVVRLLEKK-IPRTXXXXXXXXX
YUBA_BACSU      ---------------------------------LPIILTGIVFYLLNPVVDFLEXXXXXXXXXXXXXXXX
PERM_HAEIN      ----------------------------------PLLIALVLSYLLEPINFLNQYLKCPRMLATILIFGS
TQSA_SHIFL      ---------------------------------VPFILALFIAVILNPLVQHMVRWRVPRVLAVSILMTI
TQSA_ECOLI      ---------------------------------VPFILALFIAVILNPLVQHMVRWRVPRVLAVSILMTI
YHHT_ECOLI      ---------------------------------VQLLLALFFAIVLNPLVTWFIRRGVQRPVAITIVVVV
YHHT_ECO57      ---------------------------------VQLLLALFFAIVLNPLVTWFIRRGVQRPVAITIVVVV
Y1211_METTH     -------------------------------------LGAVFAYIVRPVALRINRRIPYLSVSIILAMIV
PERM_ECOLI      ----------------------------------------------------------------------
PERM_ECO57      ----------------------------------------------------------------------
Y063_SYNY3      ------------------------------------LIASVIAFLLNYPVAWLEKQGAKRFVAASFVFLT
Y1800_ARCFU     ------------------------------------VMGVVFAYVAKPVKRKIEHVG--RIKASVIATAI
YCT2_BACPF      ----------------------------------------------------------------------
Y1187_THEMA     -------------------------------------LSIIIDYVARFLEVFIKKRVLPRVISNVLVFLT
Y060_SYNY3      ----------------------------------------------------------------------
YDBI_BACSU      -------------------------------------------------------------ITFLYMLLA
Y630_RICPR      ----------------------------------------------------------------------
YTVI_BACSU      ----------------------------------PFLIALILSSVIHPVVDYLDKTGFPRTIXXXTILVA
Y006_BORBU      ----------------------------------------------------------------------
Y553_TREPA      ----------------------------------------------------------------------
Y1177_METJA     ----------------------------------PFIYSCAFAYMALPVYNILRKKFNKTISAGLAISIY


                         .         .         *         .         .         .         .:140
query           VVIVATSLLMYGVPRMVNQLEKMVENIPLYTDQVEEIVRNIQKRFADSSMPPGVQQIVDERIRWVESRVL
YRRI_BACSU      FFGGIGWALYKGVPVLIVQLTDLSENIPMFAETYNGLLLHVHNHTDD--WPDGMHHRIDKMIRQTEAFFA
YUEF_BACSU      XXXXXXXXSASVGPIITAQVTGLFNNLPDYIKQIQALTKDLSHSQWFTWMMN--QDYVS--ISKIEQSLT
YUBA_BACSU      XXXXXXXXXXXXXPFLKEQIMSLIDNIPRYVDVVE----NQTKQLIGSNFVNQAQQTMNINISDLATKVA
PERM_HAEIN      FIGLAAVFFLVLVPMLWNQTISLLSDLPAMFNKSNEWLLNLPKNYPDYSMVDSIFNSVREKILGFGE---
TQSA_SHIFL      IVMAMVLLLAY----LGSALNELTRTLPQYRNSIMTPLQALEPLL----QRVGIDVSVDQLAHYIDPXXX
TQSA_ECOLI      IVMAMVLLLAY----LGSALNELTRTLPQYRNSIMTPLQALEPLL----QRVGIDVSVDQLAHYIDPXXX
YHHT_ECOLI      MLIALTALV--GV--LAASFNEFISMLPKFNKELTRKLFKLQEMFLNLHMSP------ERMLQRMDSE--
YHHT_ECO57      MLIALTALV--GV--LAASFNEFISMLPKFNKELTRKLFKLQEMFLNLHMSP------ERMLQRMDSE--
Y1211_METTH     VIMPLVGILVFTVDSIINSAPSLLS-------------------LAGSIHVPGLQPSAENTLANLRTVLR
PERM_ECOLI      ----------------------LIRDMPGMLNKLSDFAATLPRRYP-ALMDAGIIDAMAENMR---SRML
PERM_ECO57      ----------------------LIRDMPGMLNKLSDFAATLPRRYP-ALMDAGIIDAMAENMR---SRML
Y063_SYNY3      ALIIFTALGVTLIPLALSQAQQLVARLPDWLDSGQKQLVLLDQKAEILGWPVNFDGLIPQ----INSRLA
Y1800_ARCFU     VILPISVLMFYGLIQGLNQAIYLITHYKV----IESGILNILSKM-------GIEE-GEEYVKWITSNVF
YCT2_BACPF      ----------YIATKAITQGTQIVENSPQYISDINRAWLNFQRNLEEKNLPPELVQEINITVTNTLSDLR
Y1187_THEMA     IAYSAVNFF----PVIVREAQKVFSEI----DRIRSGLENID-------IPGWXXXXXXXXXXXXXXXXX
Y060_SYNY3      ----------------------------------------------------------------------
YDBI_BACSU      VLLTVGGFVFYPVAAQIQQLVKQIKHIAYHPDSIP-FFDEITSVFGDIN----ISSYVKEGFNVVYTYLA
Y630_RICPR      ----------------------------------------------------------------------
YTVI_BACSU      EIVTGTAYLAKTLPPHISTFISYCEK--LFTTHIQPLYNELTLLFQEASIVTHIQTLGDSAAKNA-GLLL
Y006_BORBU      ----------------------------------------------------------------------
Y553_TREPA      ----------------------------------------------------------------------
Y1177_METJA     ILPIMTITIYALLTFMEIILSFNTKSIEPYINEILSIYNSFMERIINNEQI--IAKYIDEFIKYLVSQFS


                         +         .         .         .         .         *         .:210
query           AIVRKSMDLLMALLSNLFYIALAPVLAFYIMKDLKLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIRG
YRRI_BACSU      GTIEGAISGIRNVLDYFLIAATIPFLVFYMVKDIELMKKTVWYLTPKSWRKRGSAFLRDVDDSLGDYIRG
YUEF_BACSU      SFLQNLPQNITSSLSAVFXXXXXPFILFYMLKDGHRFPHLAVKILPASYRTEGLKIFKDLSDTLAAYFQG
YUBA_BACSU      TIVNSTFNFIGALTEIIISIVTVPFILFYLLKDGRKLPVYILKFVPTRLKEQTYTVLSEMNHRLSSYIRG
PERM_HAEIN      SAVKLSLASIMNLVSLGIYAFLVPLMMFFMLKDKSELLQGVSRFLPKNR-NLAFXRWKEMQQQISNYIHG
TQSA_SHIFL      XXXXXXXXXXXXXMSSIFXXXXXXXXXXXEVPQLKFQQMMARP------VEGMAAIQRAIDSV-SHYLVL
TQSA_ECOLI      XXXXXXXXXXXXXMSSIFXXXXXXXXXXXEVPQLKFQQMMARP------VEGMAAIQRAIDSV-SHYLVL
YHHT_ECOLI      KVVTFTTALMTGLSGAMASXXXXXXXXXXXXXEVRHVPYKMRFALNNPQIH-IAGLHRALKGV-SHYLAL
YHHT_ECO57      KVVTFTTALMTGLSGAMASXXXXXXXXXXXXXEVRHVPYKMRFALNNPQIH-IAGLHRALKGV-SHYLAL
Y1211_METTH     DILSGSLNYVVAILQSVPMISLQLFVTFYFARDGKRLVGYIRTLIPEETRPFMERMASETERVLLSIFYG
PERM_ECOLI      SVVKISLASLVGLLTIAXXXXXXXXXXXXXXKDKEQMLNAVRRVLPRNLAGQVW---KEMNQQITNYIRG
PERM_ECO57      SVVKISLASLVGLLTIAXXXXXXXXXXXXXXKDKEQMLNAVRRVLPRNLAGQVW---KEMNQQITNYIRG
Y063_SYNY3      A-------ELQNLAGSTLNLALS-LTVFTVVRLLDVXXXXXXXXXXXXHTDDVWWLPERFQKPFSNYFLG
Y1800_ARCFU     SILQSSIQKKATLLILNFFISI--VVCFYALADMENFVRRTTSVVPXXXXXXXXXXXXXIDVTFESLWFG
YCT2_BACPF      SNIRDRTSLISSIPGYLVTFLVYLIALFLFMLELPRLREKLYSYLSERTKEKVNFMTSRLSYVIWGFFKA
Y1187_THEMA     XLVNK----IVGYVPSFITAAILIVITAFIVSSLKLIKENVHYLFPTNPSDGKEFLKTTYTE-FERFVGG
Y060_SYNY3      ----------------------------------------------------------------------
YDBI_BACSU      DISTFGLQVVMALILSMFFLFEKKRLSEFMAK--------FKTSKLRVFYEEIAFFGSKFARTFGKVLEA
Y630_RICPR      ----------------------------------KIITNM-ESLLPIKTRPKILEILSAINNLLSSYIRG
YTVI_BACSU      SHILEMIPRFFALLPNTAAVLIFSLLAFFMTKDWHKLKAMLVLILPDRVTANSKAISSELKKAMTGFIKA
Y006_BORBU      -------------------------------------------------------------DTINNQIGK
Y553_TREPA      ----------------------------------------------------------------------
Y1177_METJA     GKIIDVGYLIVKVIMVLF-------LTFYFLRDGDKAKNLIISFVPDEYKEKMRIYLSYLHDSYKNLFXX


                         .         .         .         +         .         .         .:280
query           HLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVGIALLHSKYMTLKVILAVLI
YRRI_BACSU      QLLVCLILGVIAGISFWVFGLPYPLILGLISGVTNVIPYFGPFIGAVPALLIAMTISVKAVLVVVITVFI
YUEF_BACSU      QLLICLFVGTACFIGYLIAGLPYALILGIVMAITNIIPYVGPFLGAAPAVIVGFMDSPAKALFAIIVVVI
YUBA_BACSU      QIIVSXXXXXXXXXXXXXXXXDYASLLAVIAACTSIVPYLGXXXXXXXXXXXXXVTSPLMLLKLVIVWTI
PERM_HAEIN      KLLEILIVTLITYIIFLIFGLNYPLLLAFAVGLSVLVPYIGAVIVTIPVALVALFQFGISPTYIIIAFAV
TQSA_SHIFL      KTAISIITGLVAWAMLAALDVRFAFVWGLLAFALNYIPNIGSVLAAIPPIAVLVFNGFYEALLVLAGYLL
TQSA_ECOLI      KTAISIITGLVAWAMLAALDVRFAFVWGLLAFALNYIPNIGSVLAAIPPIAVLVFNGFYEALLVLAGYLL
YHHT_ECOLI      KTLLSLWTGVIVWLGLELMGVQFALMWAVLAFLLNYVPNIGAVISAVPPIQVLLFNGVYECILVGALFLV
YHHT_ECO57      KTLLSLWTGVIVWLGLELMGVQFALMWAVLAFLLNYVPNIGAVISAVPPIQVLLFNGVYECILVGALFLV
Y1211_METTH     HFLTALAIGLMAAVGFHLLGYPYAILLGIMTGLFQLIPVIGPWAAYTP-----LSIYDFVTGNILRGVLV
PERM_ECOLI      KVLEMIVVGIATWXXXXXXXXXXXXXXAVLVGFSVLIPYIGAFVVTIPVVGVALFQFGAGTWSCFAVYLI
PERM_ECO57      KVLEMIVVGIATWXXXXXXXXXXXXXXAVLVGFSVLIPYIGAFVVTIPVVGVALFQFGAGTWSCFAVYLI
Y063_SYNY3      QLVSATCMALGLISGFLLLKVPFGLLFGLTVGVMALIP-FGGSVGIVLVTFLVALRDIGMXXXXXXXXXX
Y1800_ARCFU     NFVVAILIGLVSLPFFLYFNVPFAPLLSGLMFLAALIPIFAEWMIILPVSLYLLLVDVGRGLSLLIGVVF
YCT2_BACPF      QFLVSIIIFIVTLIGLLFIAPEVALLMAFIIWLIDFVPIIGSIVILAPWAIFQLIVGDVSTGSKXXXXXX
Y1187_THEMA     QVLVAIFVGLFVGFGAFIFKIPSAFFLGMLAFVTDFVPYLGVVISAIPLLMLAFVHXXXXXXXXXXXXVA
Y060_SYNY3      ---------------------------------------------------IASFQSIWLGIKVLAIATV
YDBI_BACSU      QFIIALVNCILTFIALWIMHFPQLFGLSIMVFFLGLIPVAGVVISLIPLSIIAYSTGGGMVLYIVLVIFA
Y630_RICPR      QLNICLLLSTYYSIAFTXXXXXXXXXXXXXXXXXXXXPLLGTFISLTLIIGYLTFGITSKLLYIMIIYLI
YTVI_BACSU      QAVLVFITMVIVFIGLSLLKVEHAATIAFLIGLVDLLPYLGAGSVFVPWILYLSITGQLPQAXXXXXXXX
Y006_BORBU      YLGIKILVGILVFIGLTLFGQDFPLVWAVLSFVFNFIPSIGSIL-AVFFIVITSLIQFYPNLNIVLYVFI
Y553_TREPA      ---------------------------------------FLPLVGCACVVGISIFTSGWMTLFLFVAGSS
Y1177_METJA     XXXXXXXXXXXXXXXXXXXXXPYAELFAIITGIFALLPILGGMVYISIAIYFFLIHDTKAVFMFIYGELF


                         .         *         .         .         .         .         +:350
query           IQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLAVPLAAIIKIIVSFVWRKLx
YRRI_BACSU      LQFMEGNILSPFIVGRSLKMHPVVIMXXXXXXXXXXXIVGMILAVPATAVLKVMM--------
YUEF_BACSU      VQQLDGNLLSPLVIGKRLNTHPLTIILLLIGAGSFGGILGMILAVPVYAVVK-----------
YUBA_BACSU      VQLIEGKLISPQIMGKNLHIHPITIIFLLLTAGKLFGVVGIILAIPGYAVAKVITTFDWFKM-
PERM_HAEIN      SQLLDGNLLVPYLFSEAVNLHPLIIIISXXXXXXXXXXXXXXXAIPLATLVKAVIN-------
TQSA_SHIFL      INLVFGNILEPRIMGRGLGLSTLVVFLSLIFWGWLLGPVGMLLSVPLTIIVKI----------
TQSA_ECOLI      INLVFGNILEPRIMGRGLGLSTLVVFLSLIFWGWLLGPVGMLLSVPLTIIVKI----------
YHHT_ECOLI      VHMVIGNILEPRMMGHRLGMSTMVVFLSLLIWGWLLGPVGMLLSVPLTSVCKI----------
YHHT_ECO57      VHMVIGNILEPRMMGHRLGMSTMVVFLSLLIWGWLLGPVGMLLSVPLTSVCKI----------
Y1211_METTH     L--IFGLFLSPKLSGKYADIHPMIFLVGFLGGPVVWGVAGFIV--------------------
PERM_ECOLI      IQALDGNLLVPVLFSEAVNLHPLVIILSXXXXXXXXXXXXXXXAIPLATLIKAVI--------
PERM_ECO57      IQALDGNLLVPVLFSEAVNLHPLVIILSXXXXXXXXXXXXXXXAIPLATLIKAVI--------
Y063_SYNY3      XXXXXENGIAPRVLGSVTGLNPFWVLISLLTGARIGGLLGVIVAVPSAVMIK-----------
Y1800_ARCFU     LYVLPELILRPYFVGYTSKIHPLVLMLA-----------------------------------
YCT2_BACPF      XXXXXRRTVEPKVMGKHIGLSPLATLIAMYLGLMLFGVIGFIIG-PLLVI-------------
Y1187_THEMA     ANQLEMWVLAPKIQSNTLNVHWFXXXXXXXXXGDLFSFGGVLIALPFLIFLK-----------
Y060_SYNY3      VDQVVENGLAPKLLGRVTGVHPVWILLSLMIGAKVAGLLGILVAIPIASFIR-----------
YDBI_BACSU      IHAIETYFLNPKLMSAKTELPIFFTFTVLIFSEHFFGIWGLIIGIPI----------------
Y630_RICPR      GNIGESYILTPKIIGDKIGLHPLWIIFAIFACGSL----------------------------
YTVI_BACSU      XXXXQRQLTEPKILSKSIGIDPL----------------------------------------
Y006_BORBU      IQMLIGNILEPKMQGKRLDISPXXXXXXXXXXXXXXXXXXXXISYPFTVIVKVIVDNVWLK--
Y553_TREPA      ITIID-SFLRPLLLQNKMRIHPLLIFFSMLGGVQTFGFNGMVLGPILVILLFTVI--------
Y1177_METJA     LSIAPDFVIRPYLVKKEVDIHPVLVVIAFLMAPLSLGLSGFAI--------------------