[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49390.1

[Show Plain Result]


## Summary of Sequence Search
    1::305
  437::515     4e-05  41%  712 aa  TSG10_RAT RecName: Full=Testis-specific gene 10 protein;AltName:
  422::500     1e-04  39%  697 aa  TSG10_MOUSE RecName: Full=Testis-specific gene 10 protein;
  137::236     1e-04  22%  264 aa  APOA1_CHICK RecName: Full=Apolipoprotein A-I;         Short=Apo-AI;
   94::149     3e-04  30%  474 aa  CC149_HUMAN RecName: Full=Coiled-coil domain-containing protein
   94::149     3e-04  30%  319 aa  CC149_BOVIN RecName: Full=Coiled-coil domain-containing protein
 2098::2150    5e-04  40% 3214 aa  BPA1_HUMAN RecName: Full=Bullous pemphigoid antigen 1, isoforms
 1078::1176    9e-04  26% 1581 aa  ANR26_MOUSE RecName: Full=Ankyrin repeat domain-containing protein
    1::305

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TSG10_RAT       ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
APOA1_CHICK     ----------------------------------------------------------------------
CC149_HUMAN     ----------------------------------------------------------------------
CC149_BOVIN     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TSG10_RAT       ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
APOA1_CHICK     ----------------------------------------------------------------------
CC149_HUMAN     ----------------------------------------------------------------------
CC149_BOVIN     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQYRQERDELVQDKKAWKDKVEQLQAQ
TSG10_RAT       ------------------------------------------------------EDAENWENKARQLEAE
TSG10_MOUSE     ------------------------------------------------------EDAENWENKARQTEAE
APOA1_CHICK     --------------------------------------------QYRQRLTPVAQEKELTKQKVELMQAK
CC149_HUMAN     ------------------------------------------------EREDLVQQLERAKEQIESLEHD
CC149_BOVIN     ------------------------------------------------EREDLVQQLERAKEQIESLEHD
BPA1_HUMAN      --------------------------------------------QFEKSHEQLLQNIKAEKDKIQRLNEE
ANR26_MOUSE     ------------------------------------------------------------QESIEERLAQ


                         .         .         .         +         .         .         .:280
query           LEQTRVEAQKELNAQADRVKEKIERLNEQHNEAMTRXXXXXXXXXXXXXXXXQREFMKEIAGLRESLAQC
TSG10_RAT       NNTLKLEL-ITAEAEGNRLKEKVDALNEQHLNA-------------------ERSYKSQIATLHKSLVKM
TSG10_MOUSE     NNTLKLELITA-EAEGNRLKEKVDALNEQHLNA-------------------ERSYKSQIATLHKSLVKM
APOA1_CHICK     LTPVAEEARDRLRGHVEELRKNLAPYSDELRQKLSQKLEEIREKGIPQASEYQAKVMEQLSNLREKMTPL
CC149_HUMAN     L-QASVDELQDVKEERSSYQDKVERLNQELNHILS-----------------------------------
CC149_BOVIN     L-QASVDELQDVKEERSSYQDKVERLNQELNHILS-----------------------------------
BPA1_HUMAN      LEKS--------NECAEMLKQKVEELTRQNNE--------------------------------------
ANR26_MOUSE     LQSENTLLRQQLDDAANKAESKIVNIQDQFQDVLTRFQAESQRHSLRLEDRNQ-ELVSECSHLRERLCQY


                         .         *         .         .         .         .         +:350
query           REEKAQFEAQVTVMQSKxxxxxxxx
TSG10_RAT       EEEKVQFE-----------------
TSG10_MOUSE     EEEKVQFE-----------------
APOA1_CHICK     VQE----------------------
CC149_HUMAN     -------------------------
CC149_BOVIN     -------------------------
BPA1_HUMAN      -------------------------
ANR26_MOUSE     ENEKAEREVVVRQLQQE--------