[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49533.1

[Show Plain Result]


## Summary of Sequence Search
    1::2558
   20::337     1e-43  39%  591 aa  VRP2_SALTY RecName: Full=65 kDa virulence protein;
   16::337     2e-43  39%  591 aa  VRP2_SALCH RecName: Full=65 kDa virulence protein;AltName:
   20::337     4e-43  39%  593 aa  VRP2_SALDU RecName: Full=65 kDa virulence protein;
   20::337     7e-43  39%  591 aa  VRP2_SALEN RecName: Full=65 kDa virulence protein;
 1636::2186    5e-13  26% 2334 aa  WAPA_BACSU RecName: Full=Wall-associated protein;AltName: Full=Cell
  420::532     1e-08  32%  682 aa  RHSE_ECOLI RecName: Full=Putative protein rhsE;
  511::976     3e-08  28% 1426 aa  RHSD_ECOLI RecName: Full=Protein rhsD;
    5::153     7e-08  32%  233 aa  YIBJ_ECOLI RecName: Full=Putative uncharacterized protein yibJ;
  245::324     1e-07  36%  477 aa  YBFO_ECOLI RecName: Full=Putative uncharacterized protein ybfO;
   36::93      1e-07  47%  236 aa  YLBH_ECOLI RecName: Full=Putative uncharacterized protein ylbH;
 1100::1246    2e-07  29% 1411 aa  RHSB_ECOLI RecName: Full=Protein rhsB;
 1190::1246    2e-06  42% 1397 aa  RHSC_ECOLI RecName: Full=Protein rhsC;
 1100::1246    2e-06  29% 1377 aa  RHSA_ECOLI RecName: Full=Protein rhsA;
  659::784     2e-04  28%  989 aa  SERA_PLAFG RecName: Full=Serine-repeat antigen protein;AltName:
  659::784     2e-04  28%  989 aa  SERA_PLAFD RecName: Full=Serine-repeat antigen protein;AltName:
  667::792     2e-04  28%  997 aa  SERA_PLAF7 RecName: Full=Serine-repeat antigen protein;AltName:
    1::2558

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxTELSLPKGGGAIKGIGETFQPDPFSGTANLSIPVQMSPCRDFEPKISLNYX
VRP2_SALTY      -----------------------LPKGGKALSQSG----PD---GLASITLPLPISAERGFAPALALPYS
VRP2_SALCH      -------------------TPPSLPKGGKALSQSG----PD---GLASITLPLPISAERGFAPALALHYS
VRP2_SALDU      -----------------------LPKGGKALSQSG----PD---GLASITLPLPISAERGFAPALALHYS
VRP2_SALEN      -----------------------LPKGGKALSQSG----PD---GLASITLPLPISAERGFAPALALHYS
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXXXXXXXRKTEKGIPRYNDTDTFLFSNAEDLVSKMVKNQEGSWVKEERHVEENRVGW
VRP2_SALTY      SXXXXXXXXXXWSCATMSIARRTSHGVPQYNDSDEFLGPDGEVLVQTLSTGDAPNPVTCFAYGDVSPQSY
VRP2_SALCH      SXXXXXXXXXXWSCATMSIARSTSHGVPQYNDSDEFLGPDGEVLVQTLSTGDAPNPVTCFAYGDVSPQSY
VRP2_SALDU      SXXXXXXXXXXWSCATMSIARRTSHGVPQYNDSDEFLGPDGEVLVQTLSTGDAPNPVTCFAYGDVSPQSY
VRP2_SALEN      SXXXXXXXXXXWSCATMSIARSTSHGVPQYNDSDEFLGPDGEVLVQTLSTGDAPNPVTCFAYGDVSPQSY
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KVLSYIPRIEGLFAQIEYWQNSWESFWKVTTKDNTTSIYGQSENARIADPHDNTRVFKWLIEKTYDAKGN
VRP2_SALTY      TVTRYQPRTESSFYRLEYWNSNGDDFWLLHDSNGILHLLGKTAAARLSDPQAASHTAQWLVEESVTPAGE
VRP2_SALCH      TVTRYQPRTESSFYRLEYWNSNGDDFWLLHDSNGILHLLGKTAAARLSDPQAASHTAQWLVEESVTPAGE
VRP2_SALDU      TVTRYQPRTESSFYRLEYWNSNGDDFWLLHDSNGILHLLGKTAAARLSDPQAASHTAQWLVEESVTPAGE
VRP2_SALEN      TVTRYQPRTESSFYRLEYWNSNGDDFWLLHDSNGILHLLGKTAAARLSDPQAASHTAQWLVEESVTPAGE
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      KVGEQCPKVE------DHWMNLWDNGKILHNKNEPNSLDGKGYTAYESERHDNMDAFVKIIKTEVMNKGS
SERA_PLAFD      KVGEQCPKVE------DHWMNLWDNGKILHNKNEPNSLDGKGYTAYESERHDNMDAFVKIIKTEVMNKGS
SERA_PLAF7      KVGEQCPKVE------DHWMNLWDNGKILHNKNEPNSLDGKGYTAYESERHDNMDAFVKIIKTEVMNKGS


                         .         .         .         +         .         .         .:280
query           KIEYFYKQEDNENAPDNICEKNRTYATNKYVSSIKYGNYLDGKGEEAWAFEVVFDYGQYDISDQYLSQPG
VRP2_SALTY      HIYYSYLAENGDNVDLNGNEAGRDRSAMRYLSKVQYGNYLWTSATPAWLFTLVFDYGERGVDPQVPPA--
VRP2_SALCH      HIYYSYLAENGDNVDLNGNEAGRDRSAMRYLSKVQYGNYLWTSATPAWLFTLVFDYGERGVDPQVPPA--
VRP2_SALDU      HIYYSYLAENGDNVDLNGNEAGRDRSAMRYLSKVQYGNYLWTSATPAWLFTLVFDYGERGVDPQVPPA--
VRP2_SALEN      HIYYSYLAENGDNVDLNGNEAGRDRSAMRYLSKVQYGNYLWTSATPAWLFTLVFDYGERGVDPQVPPA--
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      VIAYIKAEEFSGKKVQNLCGDD---TADHAVNIVGYGNYVNSEGEKKSYWIVRNSWGPY-----------
SERA_PLAFD      VIAYIKAEEFSGKKVQNLCGDD---TADHAVNIVGYGNYVNSEGEKKSYWIVRNSWGPY-----------
SERA_PLAF7      VIAYIKAEEFSGKKVQNLCGDD---TADHAVNIVGYGNYVNSEGEKKSYWIVRNSWGPY-----------


                         .         *         .         .         .         .         +:350
query           CNPYIPARKWPARQDPFSSYRSGFEIRTLRLCRNILMFHHFKKELGETPCLVKATQLTYRExxxxxxxxx
VRP2_SALTY      ---FTAQNSWLARQDPFSLYNYGFEIRLLRLCRQVLMFHHFPDELGEADTLVSRLLLEYDE---------
VRP2_SALCH      ---FTAQNSWLARQDPFSLYNYGFEIRLHRLCRQVLMFHHFPDELGEADTLVSRLLLEYDE---------
VRP2_SALDU      ---FTAQNSWLARQDPFSLYNYGFEIRLHRLCRQVLMFHHFPDELGEADTLVSRLLLEYDE---------
VRP2_SALEN      ---FTAQNSWLARQDPFSLYNYGFEIRLHRLCRQVLMFHHFPDELGEADTLVSRLLLEYDE---------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxKYVYDMQKKPLSVDSADAGLKLSLSNIFGNTVHSWDSRGFHTRKMYDSLQRCVQIGVEGN
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------RYRYDDAHSELPATTTDASTRQMTWSRYGQLLAFTDCSGYQTRYEYDRFGQMTAVHRE--
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           DGRGLVLHQAVEKFVYGEFYEEKEEASKDKNLRGQVYKHFDQAGVVTCNLYNLKGKAVQTDRQFLADYKK
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      -------------------YDETGKKTSETDAKGEKTTYYDQADQLT-NMTLSNGTSI------LHSYDK
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      --EGISLYRR---------YDNRGRLTSVKDAQGRETRYYNAAGDLTAVIYDAWGKAVSTTQGGLT---R
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           EANWDNVNKSSLADELFSIGCSYDALERVISETAPDGSIYTHIYNQAGLLRKVVVAFKDGSEEEFIKDIQ
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      EGNEVSKTIRAGADQTYKF--EYDVMGKLVKTTDPLGNVLASEYDANSNLTKTIVSLSDGTDRVKSKSYN
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      SMEYDAAGRVSLTNENGSHSVSYDALDRLVQQGGFDGRTQRYHYDLTGKLTQVILWYYDESDREPAEQWQ
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1890
query           YNANGQRLKIIYGNGVTTEYSYTDPALRLTDILSLKPDSNNTKDFKGCLLQKIHYTYDPVGNVTRLRDNS
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      YDKNGNETSVVNKEQNTTKKRTFDNKNRLTELTTYPSDSDKLKTFSGDQKGTNQFTYNKLDQMIEMKDST
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      YDGHGWLTDISHGHRVAVHYGYDDKG-RLTGECQ---TVENPETGELLWQHETKHAYNEQGLANRVTPDS
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1960
query           YPTVFYNQQKVEPLSDYSYNPLYQLVSATGRQHPGIFDGSHRDGFKQSKFIPIKSSNPNDGTSLENYRQD
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      --------------SSYSFD-----YDENGNVQTFITGNGGGTSFSYDERNLVSSLHIGDKNGGDILTES
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      LPPVYLAGMKLTPLVEYTRDRLHR---ETVRSF-GSMAGSNAAYELTSTYTPAGQLQSQHLNSLV-YDRD
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:2030
query           YQYDEAGNLTNIRHISSSTSWTRQLDISKGTNRTVQIASLNGAKNFFKTAYDPCGNMLNLENLASINWSY
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      YEYDANGNRTTI---NSSASGKVQYEYGK-LNQLVKETHEDGT--VIEYTYDGFGNRKTVTTIKTVNASF
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      YGWSDNGDLVRI----SGPRQTREYGYS-ATGRLESVRTLAPDLDIIPYATDPAGNRLPDPEL-------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:2100
query           RNNLSRVDVILRENNSSDSEYFIYDSSGQRVRKVSERKCGSLREIEEKLYLGNFEIKRIKKKSDHLESQI
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      NNQLTKVNYDKNGNRTSDGKFYTWDAEDNAVTKKGEDKPFATYKYDEK---GNRIQKTVNGK---VTNYF
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      --HPDSTLTVWPDNRIAEDAHYVYDEYGRLTEKTDRIPAGVIRTDDERTH--------------------
YIBJ_ECOLI      ---------------------------------------------------------------DRLESEI
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ---------------------------------------------------------------DRLESEI
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ---------------------------------------------------------------DRLESEI
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:2170
query           LDRQSLHIMDGKSRIAITDIWLKDDLNRETEKTMERKFRYQLNNNLGSACLEVDEKVNIISCEEYFPYGG
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      YDGDSLNVLETDADNNVTKSYTYGDSGQLLSYTENGKKYFYHYNAHGDIIAISDSTGKTVAKYQYDAWGN
RHSE_ECOLI      ----------------------------EPEYTPARKVHFYHCDHRGLPLALISEDGNTAWRGEYDEWGN
RHSD_ECOLI      ----------------------------EPEYTPARKAHLYHCDHRGLPLALISEDGNTAWSAEYDEWGN
YIBJ_ECOLI      LDRVSEESRRWLASCGLTVEQMKNQM--DPVYTPARKIHLYHCDHRGLPLALISTEGATAWCAEYDEWGN
YBFO_ECOLI      -------------------------------------------------------------CAEYDEWGN
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      LDRVSEESRRWLASCGLTVEQMQNQM--DPVYTPARKIHLYHCDHRGLPLALISTEGATAWCAEYDEWGN
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      LDRVSEESRRWLASCGLTVEQMQNQM--DPVYTPARKIHLYHCDHRGLPLALISKEGTTEWCAEYDEWGN
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:2240
query           TSFIAGRDKREVKLKEYRYCGKERDDSTGFYYYGARYYLPWLGRWINPDPAGTVDGLNLYSFVKGNPVNF
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      PTKTEASD--EVKDNRYRYAGYQYDEETGLYYLMARYYEPRNGVFXXXXXXXXXXXXNGYAYGNNNPVMN
RHSE_ECOLI      Q---LNEENPHHLHQPYRLPGQQHDEESGLYYNRHRHYDPLQGRYITPDPIGLRGGWNMYQYPL-NPIQV
RHSD_ECOLI      Q---LNEENPHHVYQPYRLPGQQHDEESGLYYNRHRYYDPLQGRYITQDPMGLKGGWNLYQYPL-NPLQQ
YIBJ_ECOLI      LL----SDENPHHLQQLRLPGQQYDEESGLYYNRHRYYDPLLGRYITQDPIGLKGGWNFYQYPL-NPVIN
YBFO_ECOLI      ---LLNEENPHQLQQLIRLPGQQYDEESGLYYNRHRYYDPLQGRYITQDPIGLKGGWNFYQYPL-NPVQY
YLBH_ECOLI      ----------------YRLPGQQYDKESGLYYNRNRYYDPLQGRYITQDPIGLEGGWSLYAYPL-NPVNG
RHSB_ECOLI      ---LLNEENPHQLQQLIRLPGQQYDEESGLYYNRHRYYDPLQGRYITQDPIGLKGGWNLYGY-QLNPISD
RHSC_ECOLI      -----------------RLPGQQYDEESGLYYNRHRYYDPLQGRYITQDPIGLKGGWNFYQYPL-NPISN
RHSA_ECOLI      ---LLNEENPHQLQQLIRLPGQQYDEESGLYYNRHRYYDPLQGRYITQDPIGLKGGWNFYQYPL-NPVTN
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:2310
query           IDTSGKVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      VDPDG-----------------------------------------------------------------
RHSE_ECOLI      IDPMG-----------------------------------------------------------------
RHSD_ECOLI      IDPMG-----------------------------------------------------------------
YIBJ_ECOLI      VDPQGLV---------------------------------------------------------------
YBFO_ECOLI      IDSMG-----------------------------------------------------------------
YLBH_ECOLI      IDPLG-----------------------------------------------------------------
RHSB_ECOLI      IDPLG-----------------------------------------------------------------
RHSC_ECOLI      IDPLG-----------------------------------------------------------------
RHSA_ECOLI      TDPLG-----------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:2380
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:2450
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:2520
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      ----------------------------------------------------------------------
VRP2_SALCH      ----------------------------------------------------------------------
VRP2_SALDU      ----------------------------------------------------------------------
VRP2_SALEN      ----------------------------------------------------------------------
WAPA_BACSU      ----------------------------------------------------------------------
RHSE_ECOLI      ----------------------------------------------------------------------
RHSD_ECOLI      ----------------------------------------------------------------------
YIBJ_ECOLI      ----------------------------------------------------------------------
YBFO_ECOLI      ----------------------------------------------------------------------
YLBH_ECOLI      ----------------------------------------------------------------------
RHSB_ECOLI      ----------------------------------------------------------------------
RHSC_ECOLI      ----------------------------------------------------------------------
RHSA_ECOLI      ----------------------------------------------------------------------
SERA_PLAFG      ----------------------------------------------------------------------
SERA_PLAFD      ----------------------------------------------------------------------
SERA_PLAF7      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:2590
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRP2_SALTY      --------------------------------------
VRP2_SALCH      --------------------------------------
VRP2_SALDU      --------------------------------------
VRP2_SALEN      --------------------------------------
WAPA_BACSU      --------------------------------------
RHSE_ECOLI      --------------------------------------
RHSD_ECOLI      --------------------------------------
YIBJ_ECOLI      --------------------------------------
YBFO_ECOLI      --------------------------------------
YLBH_ECOLI      --------------------------------------
RHSB_ECOLI      --------------------------------------
RHSC_ECOLI      --------------------------------------
RHSA_ECOLI      --------------------------------------
SERA_PLAFG      --------------------------------------
SERA_PLAFD      --------------------------------------
SERA_PLAF7      --------------------------------------