[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49594.1

[Show Plain Result]


## Summary of Sequence Search
    1::128
    3::130     2e-35  50%  133 aa  SP3AD_BACSU RecName: Full=Stage III sporulation protein AD;
   81::140     4e-05  33%  255 aa  COAX_PETMO RecName: Full=Type III pantothenate kinase;       
    1::128

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDILQIVGLGLVVCILAIILRQQKPPMATLLTMTAGIIIFFAMMSQITAVFNVLRDLASQANVSMVYMGT
SP3AD_BACSU     IDIVQIVGLGLIATFLSLIVKEQKPTFAFLIVVFAGCAIFLYLVDQIYDIIRMIEKIAINANVNMVYVET
COAX_PETMO      -------------------------------------------------------------NVEIIFVGT


                         .         .         *         .         .         .         .:140
query           ILKIVGIAYIADFGSQICRDAGESALASKIEFAAKIIVLVMAVPIIVAVLQSLIKLVP
SP3AD_BACSU     ILKIIGIAYIAEFGAQLTKDAGQGAIASKIELAGKILILVMAVPILTVIIETILGLIP
COAX_PETMO      KNKINNIAYLVDYPKEVGADRICNVIACKQEYGDNVIALDFGTAITVDVLE-------