[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49673.1

[Show Plain Result]


## Summary of Sequence Search
    1::578
  242::603     4e-51  33%  608 aa  ATOS_ECOLI RecName: Full=Signal transduction histidine-protein
   61::424     5e-48  33%  428 aa  KINC_BACSU RecName: Full=Sporulation kinase C;         EC=2.7.13.3;
  492::727     8e-43  37%  738 aa  KINE_BACSU RecName: Full=Sporulation kinase E;       
  238::459     4e-39  36%  465 aa  ZRAS_SALTI RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
  238::459     3e-38  35%  465 aa  ZRAS_SALTY RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
  373::604     5e-38  38%  606 aa  KINA_BACSU RecName: Full=Sporulation kinase A;       
  277::503     9e-37  40%  506 aa  KIND_BACSU RecName: Full=Sporulation kinase D;       
  236::456     2e-33  35%  465 aa  ZRAS_ECOLI RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
  161::521     2e-33  30%  530 aa  PILS_PSEAE RecName: Full=Sensor protein pilS;         EC=2.7.13.3;
  229::449     8e-33  34%  458 aa  ZRAS_ECO57 RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
  186::423     8e-33  30%  428 aa  KINB_BACSU RecName: Full=Sporulation kinase B;         EC=2.7.13.3;
  229::456     1e-32  34%  462 aa  ZRAS_KLEOX RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
  153::371     2e-29  32%  373 aa  DEGM_BACB2 RecName: Full=Sensor protein degM;         EC=2.7.13.3;
  119::347     5e-29  42%  349 aa  NTRB_KLEOX RecName: Full=Nitrogen regulation protein ntrB;       
   12::347     3e-28  32%  349 aa  NTRB_SALTY RecName: Full=Nitrogen regulation protein NR(II);       
   12::347     3e-28  32%  349 aa  NTRB_SALTI RecName: Full=Nitrogen regulation protein NR(II);       
    9::348     1e-27  31%  350 aa  NTRB_VIBAL RecName: Full=Nitrogen regulation protein ntrB;       
  119::347     8e-27  39%  349 aa  NTRB_SHIFL RecName: Full=Nitrogen regulation protein NR(II);       
  119::347     8e-27  39%  349 aa  NTRB_ECOLI RecName: Full=Nitrogen regulation protein NR(II);       
  119::347     8e-27  39%  349 aa  NTRB_ECO57 RecName: Full=Nitrogen regulation protein NR(II);       
  238::596     1e-26  27%  608 aa  WALK_STAHJ RecName: Full=Sensor protein kinase walK;       
  131::504     4e-26  26%  505 aa  FIXL_BRAJA RecName: Full=Sensor protein fixL;         EC=2.7.13.3;
   34::382     7e-26  27%  400 aa  NTRB_AZOBR RecName: Full=Nitrogen regulation protein ntrB;       
  439::691     3e-25  32%  829 aa  VIRA_AGRT9 RecName: Full=Wide host range virA protein;       
  239::597     6e-25  25%  608 aa  WALK_STAAE RecName: Full=Sensor protein kinase walK;       
  142::498     6e-25  28%  504 aa  FIXL_AZOC5 RecName: Full=Sensor protein fixL;         EC=2.7.13.3;
  439::691     8e-25  32%  829 aa  VIRAW_RHIRD RecName: Full=Wide host range virA protein;       
  239::597     1e-24  25%  608 aa  WALK_STAAW RecName: Full=Sensor protein kinase walK;       
   46::404     1e-24  25%  415 aa  WALK_STAAU RecName: Full=Sensor protein kinase walK;       
  239::597     1e-24  25%  608 aa  WALK_STAAT RecName: Full=Sensor protein kinase walK;       
  239::597     1e-24  25%  608 aa  WALK_STAAS RecName: Full=Sensor protein kinase walK;       
  239::597     1e-24  25%  608 aa  WALK_STAAR RecName: Full=Sensor protein kinase walK;       
  239::597     1e-24  25%  608 aa  WALK_STAAN RecName: Full=Sensor protein kinase walK;       
  239::597     1e-24  25%  608 aa  WALK_STAAM RecName: Full=Sensor protein kinase walK;       
  239::597     1e-24  25%  608 aa  WALK_STAAC RecName: Full=Sensor protein kinase walK;       
  239::597     1e-24  25%  608 aa  WALK_STAAB RecName: Full=Sensor protein kinase walK;       
  239::597     1e-24  25%  608 aa  WALK_STAA9 RecName: Full=Sensor protein kinase walK;       
  239::597     1e-24  25%  608 aa  WALK_STAA8 RecName: Full=Sensor protein kinase walK;       
  239::597     1e-24  25%  608 aa  WALK_STAA3 RecName: Full=Sensor protein kinase walK;       
  239::597     1e-24  25%  608 aa  WALK_STAA2 RecName: Full=Sensor protein kinase walK;       
  239::597     1e-24  25%  608 aa  WALK_STAA1 RecName: Full=Sensor protein kinase walK;       
    8::351     1e-24  29%  356 aa  NTRB_RHOCA RecName: Full=Nitrogen regulation protein ntrB;       
  114::363     1e-24  29%  383 aa  NTRB_RHILP RecName: Full=Nitrogen regulation protein ntrB;       
  626::886     1e-24  30%  889 aa  NODV_BRAJA RecName: Full=Nodulation protein V;         EC=2.7.13.3;
  369::618     2e-24  32%  621 aa  DCTB_RHIME RecName: Full=C4-dicarboxylate transport sensor protein
  241::599     2e-24  27%  610 aa  WALK_STAES RecName: Full=Sensor protein kinase walK;       
  241::599     2e-24  27%  610 aa  WALK_STAEQ RecName: Full=Sensor protein kinase walK;       
   19::363     2e-24  25%  382 aa  NTRB_RHIME RecName: Full=Nitrogen regulation protein ntrB;       
  280::654     6e-24  29%  655 aa  Y3689_SHEFN RecName: Full=Putative sensor protein Sfri_3689;       
   46::406     6e-24  25%  419 aa  WALK_STASR RecName: Full=Sensor protein kinase walK;       
  329::695     8e-24  30%  833 aa  VIRA_AGRT5 RecName: Full=Wide host range virA protein;       
  240::598     1e-23  26%  610 aa  WALK_STAS1 RecName: Full=Sensor protein kinase walK;       
   18::351     1e-23  31%  377 aa  NTRB_BRASR RecName: Full=Nitrogen regulation protein ntrB;       
  239::571     2e-23  26%  579 aa  PHOR_BACSU RecName: Full=Alkaline phosphatase synthesis sensor
  247::603     2e-23  25%  611 aa  YYCG_BACSU RecName: Full=Sensor histidine kinase yycG;       
   49::302     2e-23  26%  632 aa  STC_CLOBE RecName: Full=Signal-transduction and
  671::1048    3e-23  28% 1055 aa  PDHS_OCHA4 RecName: Full=Cell-division control histidine kinase pdhS;
  367::619     9e-23  33%  622 aa  DCTB_RHILE RecName: Full=C4-dicarboxylate transport sensor protein
  360::578     2e-22  27%  610 aa  NTRYL_RICBR RecName: Full=Putative sensor histidine kinase
  167::392     4e-22  33%  393 aa  SASA_CYAP7 RecName: Full=Adaptive-response sensory-kinase sasA;    
  229::586     4e-22  26%  589 aa  RESE_BACSU RecName: Full=Sensor histidine kinase resE;       
  299::551     6e-22  29%  597 aa  DIVJ_CAUCR RecName: Full=Histidine protein kinase divJ;       
  157::382     8e-22  34%  383 aa  SASA_SYNY3 RecName: Full=Adaptive-response sensory-kinase sasA;    
  153::366     8e-22  31%  370 aa  SASA_PROMM RecName: Full=Adaptive-response sensory-kinase sasA;    
  245::496     8e-22  29%  505 aa  FIXL_RHIME RecName: Full=Sensor protein fixL;         EC=2.7.13.3;
  116::381     1e-21  30%  382 aa  SASA_CYAA5 RecName: Full=Adaptive-response sensory-kinase sasA;    
  653::1028    2e-21  26% 1035 aa  PDHS_BRUSU RecName: Full=Cell-division control histidine kinase pdhS;
  653::1028    2e-21  26% 1035 aa  PDHS_BRUSI RecName: Full=Cell-division control histidine kinase pdhS;
  653::1028    2e-21  26% 1035 aa  PDHS_BRUME RecName: Full=Cell-division control histidine kinase pdhS;
  653::1028    2e-21  26% 1035 aa  PDHS_BRUAB RecName: Full=Cell-division control histidine kinase pdhS;
  653::1028    2e-21  26% 1035 aa  PDHS_BRUA2 RecName: Full=Cell-division control histidine kinase pdhS;
  653::1028    2e-21  26% 1035 aa  PDHS_BRUA1 RecName: Full=Cell-division control histidine kinase pdhS;
  427::653     2e-21  30%  657 aa  DCTS_RHOCA RecName: Full=C4-dicarboxylate transport sensor protein
  567::828     3e-21  27%  842 aa  PLEC_CAUCR RecName: Full=Non-motile and phage-resistance protein;  
  653::1028    3e-21  26% 1035 aa  PDHS_BRUC2 RecName: Full=Cell-division control histidine kinase pdhS;
  528::742     3e-21  31%  777 aa  NTRY_AZOBR RecName: Full=Nitrogen regulation protein ntrY homolog; 
  153::366     4e-21  30%  370 aa  SASA_PROM3 RecName: Full=Adaptive-response sensory-kinase sasA;    
  262::517     4e-21  30%  567 aa  MTRB_MYCTU RecName: Full=Sensor histidine kinase mtrB;       
  262::517     4e-21  30%  567 aa  MTRB_MYCBO RecName: Full=Sensor histidine kinase mtrB;       
   47::390     5e-21  28%  534 aa  LOVHK_PSE14 RecName: Full=Blue-light-activated protein;Includes:
  130::372     7e-21  32%  377 aa  SASA_SYNJA RecName: Full=Adaptive-response sensory-kinase sasA;    
  137::360     7e-21  31%  372 aa  SASA_PROM2 RecName: Full=Adaptive-response sensory-kinase sasA;    
  353::589     9e-21  27%  599 aa  NTRYL_RICPR RecName: Full=Putative sensor histidine kinase
  351::712     9e-21  28%  859 aa  LUXQ_VIBHA RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  137::360     1e-20  31%  372 aa  SASA_PROMP RecName: Full=Adaptive-response sensory-kinase sasA;    
  653::1028    1e-20  26% 1035 aa  PDHS_BRUO2 RecName: Full=Cell-division control histidine kinase pdhS;
  431::695     2e-20  30%  835 aa  VIRAL_RHIRD RecName: Full=Limited host range virA protein;       
   47::390     2e-20  28%  534 aa  LOVHK_PSESM RecName: Full=Blue-light-activated protein;Includes:
  130::372     3e-20  28%  377 aa  SASA_SYNJB RecName: Full=Adaptive-response sensory-kinase sasA;    
  154::399     3e-20  29%  401 aa  SASA_NOSP7 RecName: Full=Adaptive-response sensory-kinase sasA;    
  215::580     4e-20  26%  583 aa  SRRB_STAAR RecName: Full=Sensor protein srrB;       
  182::368     4e-20  31%  381 aa  SASA_PROMA RecName: Full=Adaptive-response sensory-kinase sasA;    
  358::595     4e-20  31%  595 aa  KINB_PSEAE RecName: Full=Alginate biosynthesis sensor protein kinB;
  133::379     6e-20  34%  380 aa  SASA_THEEB RecName: Full=Adaptive-response sensory-kinase sasA;    
  353::578     6e-20  26%  599 aa  NTRYL_RICFE RecName: Full=Putative sensor histidine kinase
   47::390     6e-20  28%  534 aa  LOVHK_PSEU2 RecName: Full=Blue-light-activated protein;Includes:
  215::580     7e-20  26%  583 aa  SRRB_STAAW RecName: Full=Sensor protein srrB;       
  215::580     7e-20  26%  583 aa  SRRB_STAAU RecName: Full=Sensor protein srrB;       
  215::580     7e-20  26%  583 aa  SRRB_STAAS RecName: Full=Sensor protein srrB;       
  215::580     7e-20  26%  583 aa  SRRB_STAAC RecName: Full=Sensor protein srrB;       
  215::580     7e-20  26%  583 aa  SRRB_STAA8 RecName: Full=Sensor protein srrB;       
  147::381     7e-20  32%  387 aa  SASA_SYNE7 RecName: Full=Adaptive-response sensory-kinase sasA;    
  215::580     1e-19  26%  583 aa  SRRB_STAAN RecName: Full=Sensor protein srrB;       
  215::580     1e-19  26%  583 aa  SRRB_STAAM RecName: Full=Sensor protein srrB;       
  262::517     1e-19  29%  562 aa  MTRB_MYCLE RecName: Full=Sensor histidine kinase mtrB;       
  393::709     1e-19  27%  771 aa  NTRY_AZOC5 RecName: Full=Nitrogen regulation protein ntrY;       
  137::360     2e-19  31%  372 aa  SASA_PROM0 RecName: Full=Adaptive-response sensory-kinase sasA;    
   93::365     2e-19  29%  383 aa  SASA_SYNS3 RecName: Full=Adaptive-response sensory-kinase sasA;    
  275::517     2e-19  31%  565 aa  MTRB_MYCPA RecName: Full=Sensor histidine kinase mtrB;       
  271::643     3e-19  25%  653 aa  YCF26_PORYE RecName: Full=Uncharacterized sensor-like histidine
  137::360     3e-19  30%  372 aa  SASA_PROMS RecName: Full=Adaptive-response sensory-kinase sasA;    
  137::360     3e-19  31%  372 aa  SASA_PROM9 RecName: Full=Adaptive-response sensory-kinase sasA;    
  353::589     3e-19  25%  599 aa  NTRYL_RICCN RecName: Full=Putative sensor histidine kinase
  171::399     4e-19  32%  401 aa  SASA_ANASP RecName: Full=Adaptive-response sensory-kinase sasA;    
  181::365     5e-19  32%  383 aa  SASA_SYNPX RecName: Full=Adaptive-response sensory-kinase sasA;    
  171::399     6e-19  32%  401 aa  SASA_ANAVT RecName: Full=Adaptive-response sensory-kinase sasA;    
  353::589     6e-19  25%  599 aa  NTRYL_RICTY RecName: Full=Putative sensor histidine kinase
  345::711     8e-19  28%  858 aa  LUXQ_VIBPA RecName: Full=Autoinducer 2 sensor kinase/phosphatase
   81::422     1e-18  25%  431 aa  PHOR_SHIDY RecName: Full=Phosphate regulon sensor protein phoR;    
    6::347     2e-18  26%  348 aa  NTRB_PROVU RecName: Full=Nitrogen regulation protein NR(II);       
  181::365     3e-18  31%  383 aa  SASA_SYNS9 RecName: Full=Adaptive-response sensory-kinase sasA;    
  168::389     4e-18  32%  391 aa  SASA_CYAP8 RecName: Full=Adaptive-response sensory-kinase sasA;    
   81::422     5e-18  24%  431 aa  PHOR_KLEPN RecName: Full=Phosphate regulon sensor protein phoR;    
  339::575     7e-18  30%  580 aa  YVRG_BACSU RecName: Full=Sensor histidine kinase yvrG;       
   81::422     7e-18  25%  431 aa  PHOR_ECOLI RecName: Full=Phosphate regulon sensor protein phoR;    
  258::499     7e-18  26%  778 aa  ARCB_SHIFL RecName: Full=Aerobic respiration control sensor protein
  258::499     7e-18  26%  778 aa  ARCB_ECOLI RecName: Full=Aerobic respiration control sensor protein
  258::499     7e-18  26%  778 aa  ARCB_ECO57 RecName: Full=Aerobic respiration control sensor protein
  274::646     2e-17  24%  656 aa  YCF26_PORPU RecName: Full=Uncharacterized sensor-like histidine
  158::383     2e-17  29%  384 aa  SASA_MICAN RecName: Full=Adaptive-response sensory-kinase sasA;    
  415::656     4e-17  30%  663 aa  DSPA_SYNY3 RecName: Full=Drug sensory protein A;       
  245::463     6e-17  28%  525 aa  Y1002_RHIME RecName: Full=Uncharacterized sensor-like histidine
  431::654     6e-17  29%  668 aa  PGTB_SALTY RecName: Full=Phosphoglycerate transport system sensor
  681::944     1e-16  29% 1238 aa  BVGS_BORBR RecName: Full=Virulence sensor protein bvgS;       
  681::944     2e-16  29% 1238 aa  BVGS_BORPA RecName: Full=Virulence sensor protein bvgS;       
  353::592     2e-16  29%  596 aa  CHVG_AGRT5 RecName: Full=Sensor protein chvG;         EC=2.7.13.3;
  652::880     3e-16  29%  894 aa  KDPD_ECOLI RecName: Full=Sensor protein kdpD;         EC=2.7.13.3;
  211::526     4e-16  26%  535 aa  DCTS_BACSU RecName: Full=Probable C4-dicarboxylate sensor kinase;  
  345::710     1e-15  26%  857 aa  LUXQ_VIBVU RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  282::515     1e-15  26%  519 aa  RPRX_BACFR RecName: Full=Sensor protein rprX;         EC=2.7.13.3;
  345::710     1e-15  26%  857 aa  LUXQ_VIBVY RecName: Full=Autoinducer 2 sensor kinase/phosphatase
 1026::1262    1e-15  31% 1671 aa  DOKA_DICDI RecName: Full=Hybrid signal transduction protein dokA;
  681::944     1e-15  28% 1238 aa  BVGS_BORPE RecName: Full=Virulence sensor protein bvgS;       
  485::704     2e-15  27%  857 aa  LUXQ_VIBCH RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  107::344     3e-15  23%  351 aa  SAES_STAAW RecName: Full=Histidine protein kinase saeS;       
  107::344     3e-15  23%  351 aa  SAES_STAAS RecName: Full=Histidine protein kinase saeS;       
  107::344     3e-15  23%  351 aa  SAES_STAAR RecName: Full=Histidine protein kinase saeS;       
  107::344     3e-15  23%  351 aa  SAES_STAAN RecName: Full=Histidine protein kinase saeS;       
  107::344     3e-15  23%  351 aa  SAES_STAAM RecName: Full=Histidine protein kinase saeS;       
  107::344     3e-15  23%  351 aa  SAES_STAAE RecName: Full=Histidine protein kinase saeS;       
  107::344     3e-15  23%  351 aa  SAES_STAAC RecName: Full=Histidine protein kinase saeS;       
  107::344     3e-15  23%  351 aa  SAES_STAAB RecName: Full=Histidine protein kinase saeS;       
  107::344     3e-15  23%  351 aa  SAES_STAA8 RecName: Full=Histidine protein kinase saeS;       
  107::344     3e-15  23%  351 aa  SAES_STAA3 RecName: Full=Histidine protein kinase saeS;       
  187::438     3e-15  30% 1546 aa  DHKD_DICDI RecName: Full=Hybrid signal transduction histidine
  336::554     4e-15  31%  577 aa  CHVG_RHIME RecName: Full=Sensor protein chvG;       
  211::528     5e-15  28%  532 aa  DCTS_BACHD RecName: Full=Probable C4-dicarboxylate sensor kinase;  
  241::456     1e-14  26%  457 aa  CPXA_ECOLI RecName: Full=Sensor protein cpxA;         EC=2.7.13.3;
  241::456     1e-14  26%  457 aa  CPXA_ECOL6 RecName: Full=Sensor protein cpxA;         EC=2.7.13.3;
  241::456     1e-14  26%  457 aa  CPXA_ECO57 RecName: Full=Sensor protein cpxA;         EC=2.7.13.3;
  216::534     1e-14  28%  538 aa  CITS_BACHD RecName: Full=Sensor protein citS;         EC=2.7.13.3;
  142::373     2e-14  29%  384 aa  VANS_ENTFC RecName: Full=Sensor protein vanS;       
  222::456     2e-14  31%  469 aa  RSSA_SERMA RecName: Full=Swarming motility regulation sensor
  516::746     2e-14  33%  765 aa  PHYA_ANASP RecName: Full=Cyanobacterial phytochrome A;       
 1392::1617    2e-14  35% 2150 aa  DHKA_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  267::514     3e-14  27%  519 aa  NIFL_AZOVI RecName: Full=Nitrogen fixation regulatory protein;     
  246::459     4e-14  26%  467 aa  BAES_ECOLI RecName: Full=Signal transduction histidine-protein
  121::349     5e-14  24%  352 aa  SAES_STAES RecName: Full=Histidine protein kinase saeS;       
  121::349     5e-14  24%  352 aa  SAES_STAEQ RecName: Full=Histidine protein kinase saeS;       
  537::746     5e-14  26%  748 aa  PHY1_SYNY3 RecName: Full=Phytochrome-like protein cph1;       
  217::535     5e-14  28%  543 aa  DCUS_SHIFL RecName: Full=Sensor protein dcuS;         EC=2.7.13.3;
  217::535     5e-14  28%  543 aa  DCUS_ECOLI RecName: Full=Sensor protein dcuS;         EC=2.7.13.3;
  217::535     5e-14  28%  543 aa  DCUS_ECOL6 RecName: Full=Sensor protein dcuS;         EC=2.7.13.3;
  217::535     5e-14  28%  543 aa  DCUS_ECO57 RecName: Full=Sensor protein dcuS;         EC=2.7.13.3;
  206::498     8e-14  27%  907 aa  GACS_PSESY RecName: Full=Sensor protein gacS;         EC=2.7.13.3;
  173::385     1e-13  27%  395 aa  DLTS_STRA5 RecName: Full=Sensor protein dltS;         EC=2.7.13.3;
  234::440     1e-13  30%  454 aa  YKOH_BACSU RecName: Full=Sensor histidine kinase ykoH;       
  538::744     1e-13  28%  751 aa  PHYB_ANASP RecName: Full=Cyanobacterial phytochrome B;       
  173::385     1e-13  27%  395 aa  DLTS_STRA3 RecName: Full=Sensor protein dltS;         EC=2.7.13.3;
  449::662     2e-13  27%  914 aa  TORS_ECO57 RecName: Full=Sensor protein torS;         EC=2.7.13.3;
  636::897     2e-13  29%  900 aa  KDPD_CLOAB RecName: Full=Sensor protein kdpD;         EC=2.7.13.3;
  964::1215    2e-13  30% 1639 aa  MAK1_SCHPO RecName: Full=Peroxide stress-activated histidine kinase
   59::306     4e-13  25%  311 aa  YCBM_BACSU RecName: Full=Sensor histidine kinase ycbM;       
  548::759     1e-12  26%  769 aa  DIVL_CAUCR RecName: Full=Sensor protein divL;         EC=2.7.13.3;
  282::512     1e-12  26%  918 aa  BARA_SHIFL RecName: Full=Signal transduction histidine-protein
  282::512     1e-12  26%  918 aa  BARA_ECOLI RecName: Full=Signal transduction histidine-protein
  282::512     1e-12  26%  918 aa  BARA_ECOL6 RecName: Full=Signal transduction histidine-protein
  282::512     1e-12  26%  918 aa  BARA_ECO57 RecName: Full=Signal transduction histidine-protein
  237::438     3e-12  28%  450 aa  ENVZ_SALTI RecName: Full=Osmolarity sensor protein envZ;       
  968::1185    3e-12  27% 1969 aa  DHKB_DICDI RecName: Full=Hybrid signal transduction histidine kinase
   11::187     3e-12  22%  605 aa  ACOR_BACSU RecName: Full=Acetoin dehydrogenase operon
  449::662     3e-12  27%  914 aa  TORS_ECOLI RecName: Full=Sensor protein torS;         EC=2.7.13.3;
  237::438     4e-12  28%  450 aa  ENVZ_SALTY RecName: Full=Osmolarity sensor protein envZ;       
  214::529     4e-12  26%  542 aa  CITS_BACSU RecName: Full=Sensor protein citS;         EC=2.7.13.3;
  212::449     6e-12  27%  451 aa  ARLS_STAS1 RecName: Full=Signal transduction histidine-protein
  240::468     7e-12  28%  473 aa  YCLK_BACSU RecName: Full=Sensor histidine kinase yclK;       
  119::368     7e-12  27%  384 aa  SENX3_MYCS2 RecName: Full=Signal-transduction histidine kinase
  266::479     1e-11  26%  480 aa  CUSS_ECOL6 RecName: Full=Sensor kinase cusS;         EC=2.7.13.3;
  236::450     2e-11  25%  453 aa  ARLS_STAHJ RecName: Full=Signal transduction histidine-protein
  267::488     4e-11  27%  497 aa  SILS_SALTY RecName: Full=Probable sensor kinase silS;       
   86::425     4e-11  23%  443 aa  PHOR_PSEAE RecName: Full=Phosphate regulon sensor protein phoR;    
  252::469     5e-11  25%  475 aa  YFHK_ECOLI RecName: Full=Putative sensor-like histidine kinase
 1741::1978    5e-11  29% 2310 aa  MAK2_SCHPO RecName: Full=Peroxide stress-activated histidine kinase
  715::1062    5e-11  27% 1709 aa  DHKL_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  235::462     6e-11  27%  464 aa  IRLS_BURPS RecName: Full=Sensor protein irlS;         EC=2.7.13.3;
  331::569     8e-11  28%  740 aa  ETR1_CUCSA RecName: Full=Ethylene receptor 1;       
   75::272     8e-11  23%  641 aa  DHAR_CITFR RecName: Full=Glycerol metabolism operon regulatory
  266::479     8e-11  26%  480 aa  CUSS_ECOLI RecName: Full=Sensor kinase cusS;         EC=2.7.13.3;
  240::456     1e-10  25%  459 aa  SPAK_BACSU RecName: Full=Sensor histidine kinase spaK;       
  131::366     1e-10  28%  677 aa  RPFC_XANCP RecName: Full=Sensory/regulatory protein rpfC;       
  131::366     1e-10  28%  677 aa  RPFC_XANC8 RecName: Full=Sensory/regulatory protein rpfC;       
  444::681     1e-10  26%  849 aa  LUXN_VIBHB RecName: Full=Autoinducer 1 sensor kinase/phosphatase
  444::681     1e-10  26%  849 aa  LUXN_VIBHA RecName: Full=Autoinducer 1 sensor kinase/phosphatase
  349::582     1e-10  28%  738 aa  ETR1_PRUPE RecName: Full=Ethylene receptor;         EC=2.7.13.3;
  349::569     1e-10  29%  740 aa  ETR1_CUCMR RecName: Full=Ethylene receptor 1;       
  236::454     1e-10  26%  456 aa  ARLS_STAES RecName: Full=Signal transduction histidine-protein
  236::454     1e-10  26%  456 aa  ARLS_STAEQ RecName: Full=Signal transduction histidine-protein
  250::460     2e-10  28%  484 aa  MPRB_MYCVP RecName: Full=Signal transduction histidine-protein
  266::479     2e-10  26%  482 aa  CUSS_ECO57 RecName: Full=Sensor kinase cusS;         EC=2.7.13.3;
  381::507     2e-10  33%  535 aa  AFSQ2_STRCO RecName: Full=Signal transduction histidine-protein
  363::584     3e-10  30%  754 aa  ETR1_SOLLC RecName: Full=Ethylene receptor 1;         Short=LeETR1;
  237::438     3e-10  28%  450 aa  ENVZ_SHIFL RecName: Full=Osmolarity sensor protein envZ;       
  237::438     3e-10  28%  450 aa  ENVZ_ECOLI RecName: Full=Osmolarity sensor protein envZ;       
  246::467     4e-10  27%  522 aa  MPRB_MYCPA RecName: Full=Signal transduction histidine-protein
  349::568     4e-10  30%  736 aa  ETR2_SOLLC RecName: Full=Ethylene receptor 2;         Short=LeETR2;
  225::436     4e-10  27%  444 aa  CIAH_STRR6 RecName: Full=Sensor protein ciaH;         EC=2.7.13.3;
  225::436     4e-10  27%  444 aa  CIAH_STRPN RecName: Full=Sensor protein ciaH;         EC=2.7.13.3;
  582::691     5e-10  38%  949 aa  RCSC_ECOLI RecName: Full=Sensor kinase protein rcsC;       
  818::1052    5e-10  28% 1213 aa  DHKK_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  175::416     9e-10  24%  686 aa  CQSS_VIBCH RecName: Full=CAI-1 autoinducer sensor
   28::231     1e-09  25%  437 aa  YTH3_RHOER RecName: Full=Uncharacterized 47.3 kDa protein in thcA
  246::467     1e-09  27%  522 aa  MPRB_MYCA1 RecName: Full=Signal transduction histidine-protein
  247::450     1e-09  27%  460 aa  HSSS_STAS1 RecName: Full=Heme sensor protein hssS;       
  347::568     1e-09  31%  738 aa  ETR1_TOBAC RecName: Full=Ethylene receptor;       
  423::651     1e-09  29% 1225 aa  DHKC_DICDI RecName: Full=Hybrid signal transduction histidine
  148::340     1e-09  33%  356 aa  BASS_SALTY RecName: Full=Sensor protein basS;         EC=2.7.13.3;
  235::449     1e-09  25%  451 aa  ARLS_STAAW RecName: Full=Signal transduction histidine-protein
  235::449     1e-09  25%  451 aa  ARLS_STAAS RecName: Full=Signal transduction histidine-protein
  235::449     1e-09  25%  451 aa  ARLS_STAAR RecName: Full=Signal transduction histidine-protein
  235::449     1e-09  25%  451 aa  ARLS_STAAN RecName: Full=Signal transduction histidine-protein
  235::449     1e-09  25%  451 aa  ARLS_STAAM RecName: Full=Signal transduction histidine-protein
  235::449     1e-09  25%  451 aa  ARLS_STAAC RecName: Full=Signal transduction histidine-protein
  235::449     1e-09  25%  451 aa  ARLS_STAAB RecName: Full=Signal transduction histidine-protein
  235::449     1e-09  25%  451 aa  ARLS_STAA8 RecName: Full=Signal transduction histidine-protein
  235::449     1e-09  25%  451 aa  ARLS_STAA3 RecName: Full=Signal transduction histidine-protein
  582::691     2e-09  36%  948 aa  RCSC_SALTY RecName: Full=Sensor protein rcsC;       
  582::691     2e-09  36%  948 aa  RCSC_SALTI RecName: Full=Sensor protein rcsC;       
  308::414     2e-09  37%  414 aa  CUTS_STRLI RecName: Full=Sensor protein cutS;         EC=2.7.13.3;
  308::414     2e-09  37%  414 aa  CUTS_STRCO RecName: Full=Sensor protein cutS;         EC=2.7.13.3;
    3::131     3e-09  33%  147 aa  SP2AB_BACME RecName: Full=Anti-sigma F factor;       
  104::333     3e-09  21%  346 aa  GRAS_STAAR RecName: Full=Sensor histidine kinase graS;       
  349::570     3e-09  29%  740 aa  ETR1_PELHO RecName: Full=Ethylene receptor 1;       
  349::570     3e-09  29%  741 aa  ETR1_MALDO RecName: Full=Ethylene receptor;         EC=2.7.13.3;
  256::462     3e-09  23%  474 aa  CREC_ECOLI RecName: Full=Sensor protein creC;         EC=2.7.13.3;
  204::412     3e-09  26%  425 aa  PHOR_HAEIN RecName: Full=Phosphate regulon sensor protein phoR;    
  110::315     4e-09  28%  370 aa  GTCS_ANEMI RecName: Full=Sensor protein gtcS;         EC=2.7.13.3;
  349::566     6e-09  27%  738 aa  ETR1_ARATH RecName: Full=Ethylene receptor 1;         Short=AtETR1;
  124::328     6e-09  28%  334 aa  BCES_BACSU RecName: Full=Sensor protein bceS;         EC=2.7.13.3;
  243::440     8e-09  31%  451 aa  QSEC_HAEIN RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  244::443     8e-09  26%  446 aa  PFES_PSEAE RecName: Full=Sensor protein pfeS;         EC=2.7.13.3;
  102::329     8e-09  22%  344 aa  GRAS_STAHJ RecName: Full=Sensor histidine kinase graS;       
  214::424     1e-08  30%  433 aa  RSTB_ECOLI RecName: Full=Sensor protein rstB;         EC=2.7.13.3;
  242::463     1e-08  26%  519 aa  MPRB_MYCLE RecName: Full=Signal transduction histidine-protein
  349::570     1e-08  29%  741 aa  ETR2_PELHO RecName: Full=Ethylene receptor 2;       
  177::449     2e-08  28%  452 aa  YEDV_ECOLI RecName: Full=Putative sensor-like histidine kinase
  349::567     2e-08  27%  735 aa  ETR1_BRAOL RecName: Full=Ethylene receptor 1;         EC=2.7.13.3;
  299::403     3e-08  36%  410 aa  GLNK_BACSU RecName: Full=Sensor histidine kinase glnK;       
   75::272     4e-08  21%  639 aa  DHAR_ECOLI RecName: Full=PTS-dependent dihydroxyacetone kinase
  236::454     4e-08  25%  476 aa  CZCS_RALME RecName: Full=Sensor protein czcS;       
   95::315     5e-08  25%  325 aa  YXDK_BACSU RecName: Full=Sensor histidine kinase yxdK;       
  141::377     5e-08  23%  410 aa  SENX3_MYCTU RecName: Full=Sensor-like histidine kinase senX3;      
  141::377     5e-08  23%  410 aa  SENX3_MYCBO RecName: Full=Sensor-like histidine kinase senX3;      
  234::464     5e-08  26%  515 aa  MPRB_MYCSS RecName: Full=Signal transduction histidine-protein
  234::464     5e-08  26%  515 aa  MPRB_MYCSK RecName: Full=Signal transduction histidine-protein
  234::464     5e-08  26%  515 aa  MPRB_MYCSJ RecName: Full=Signal transduction histidine-protein
  207::524     5e-08  24%  533 aa  MALK_BACSU RecName: Full=Sensor histidine kinase malK;       
  636::842     6e-08  23%  860 aa  KDPD_MYCTU RecName: Full=Sensor protein kdpD;         EC=2.7.13.3;
  171::410     6e-08  21%  681 aa  CQSS_VIBHB RecName: Full=CAI-1 autoinducer sensor
  248::463     1e-07  27%  466 aa  PCOS_ECOLX RecName: Full=Probable sensor protein pcoS;       
  726::835     1e-07  35%  854 aa  KDPD_RATRA RecName: Full=Sensor protein kdpD;         EC=2.7.13.3;
  243::452     1e-07  26%  492 aa  MPRB_MYCS2 RecName: Full=Signal transduction histidine-protein
  107::333     1e-07  20%  346 aa  GRAS_STAAN RecName: Full=Sensor histidine kinase graS;       
  107::333     1e-07  20%  346 aa  GRAS_STAAM RecName: Full=Sensor histidine kinase graS;       
  107::333     1e-07  20%  346 aa  GRAS_STAA9 RecName: Full=Sensor histidine kinase graS;       
  107::333     1e-07  20%  346 aa  GRAS_STAA2 RecName: Full=Sensor histidine kinase graS;       
  107::333     1e-07  20%  346 aa  GRAS_STAA1 RecName: Full=Sensor histidine kinase graS;       
  220::429     2e-07  23%  447 aa  NISK_LACLA RecName: Full=Nisin biosynthesis sensor protein nisK;   
  349::570     2e-07  31%  738 aa  ETR1_PASED RecName: Full=Ethylene receptor;       
  124::328     2e-07  25%  334 aa  BCES_BACHD RecName: Full=Sensor protein bceS;         EC=2.7.13.3;
  242::451     2e-07  23%  511 aa  MPRB_MYCUA RecName: Full=Signal transduction histidine-protein
  353::453     2e-07  33%  456 aa  HSSS_STAHJ RecName: Full=Heme sensor protein hssS;       
  107::333     2e-07  20%  346 aa  GRAS_STAAW RecName: Full=Sensor histidine kinase graS;       
  107::333     2e-07  20%  346 aa  GRAS_STAAT RecName: Full=Sensor histidine kinase graS;       
  107::333     2e-07  20%  346 aa  GRAS_STAAS RecName: Full=Sensor histidine kinase graS;       
  107::333     2e-07  20%  346 aa  GRAS_STAAE RecName: Full=Sensor histidine kinase graS;       
  107::333     2e-07  20%  346 aa  GRAS_STAAC RecName: Full=Sensor histidine kinase graS;       
  107::333     2e-07  20%  346 aa  GRAS_STAAB RecName: Full=Sensor histidine kinase graS;       
  107::333     2e-07  20%  346 aa  GRAS_STAA8 RecName: Full=Sensor histidine kinase graS;       
  107::333     2e-07  20%  346 aa  GRAS_STAA3 RecName: Full=Sensor histidine kinase graS;       
  427::540     4e-07  36%  547 aa  CITA_KLEPN RecName: Full=Sensor kinase citA;         EC=2.7.13.3;
  150::538     5e-07  25%  552 aa  DPIB_ECOLI RecName: Full=Sensor kinase dpiB;       
  586::719     5e-07  33%  728 aa  BPHY_PSEAE RecName: Full=Bacteriophytochrome;       
  242::463     7e-07  24%  504 aa  MPRB_MYCBP RecName: Full=Signal transduction histidine-protein
  242::463     7e-07  24%  504 aa  MPRB_MYCBO RecName: Full=Signal transduction histidine-protein
  230::453     7e-07  25%  457 aa  HSSS_STAAT RecName: Full=Heme sensor protein hssS;       
  230::453     7e-07  25%  457 aa  HSSS_STAAE RecName: Full=Heme sensor protein hssS;       
  230::453     7e-07  25%  457 aa  HSSS_STAAC RecName: Full=Heme sensor protein hssS;       
  230::453     7e-07  25%  457 aa  HSSS_STAA8 RecName: Full=Heme sensor protein hssS;       
  230::453     7e-07  25%  457 aa  HSSS_STAA3 RecName: Full=Heme sensor protein hssS;       
 2490::2617    7e-07  28% 3432 aa  DHKG_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  136::343     9e-07  27%  356 aa  YVCQ_BACSU RecName: Full=Sensor histidine kinase yvcQ;       
    5::135     9e-07  31%  143 aa  SP2AB_THETN RecName: Full=Anti-sigma F factor;       
  242::463     9e-07  24%  504 aa  MPRB_MYCTU RecName: Full=Signal transduction histidine-protein
  242::463     9e-07  24%  504 aa  MPRB_MYCTA RecName: Full=Signal transduction histidine-protein
  148::340     9e-07  28%  363 aa  BASS_ECOLI RecName: Full=Sensor protein basS;         EC=2.7.13.3;
    5::135     2e-06  31%  143 aa  SP2AB_THEPX RecName: Full=Anti-sigma F factor;       
    5::135     2e-06  31%  143 aa  SP2AB_THEP3 RecName: Full=Anti-sigma F factor;       
  246::460     2e-06  25%  486 aa  PHOQ_SHIFL RecName: Full=Virulence sensor protein phoQ;       
  246::460     2e-06  25%  486 aa  PHOQ_ECOLI RecName: Full=Sensor protein phoQ;         EC=2.7.13.3;
  246::460     2e-06  25%  486 aa  PHOQ_ECOL6 RecName: Full=Sensor protein phoQ;         EC=2.7.13.3;
    3::134     2e-06  30%  146 aa  SP2AB_GEOTN RecName: Full=Anti-sigma F factor;       
    3::134     2e-06  29%  146 aa  SP2AB_GEOKA RecName: Full=Anti-sigma F factor;       
    3::130     2e-06  26%  140 aa  SP2AB_CLOPE RecName: Full=Anti-sigma F factor;       
    3::130     2e-06  26%  140 aa  SP2AB_CLOP1 RecName: Full=Anti-sigma F factor;       
  230::453     2e-06  25%  457 aa  HSSS_STAAW RecName: Full=Heme sensor protein hssS;       
  230::453     2e-06  25%  457 aa  HSSS_STAAS RecName: Full=Heme sensor protein hssS;       
    3::134     3e-06  29%  146 aa  SP2AB_BACST RecName: Full=Anti-sigma F factor;       
  230::453     3e-06  25%  457 aa  HSSS_STAAN RecName: Full=Heme sensor protein hssS;       
  230::453     3e-06  25%  457 aa  HSSS_STAAM RecName: Full=Heme sensor protein hssS;       
  230::453     3e-06  25%  457 aa  HSSS_STAA9 RecName: Full=Heme sensor protein hssS;       
  230::453     3e-06  25%  457 aa  HSSS_STAA2 RecName: Full=Heme sensor protein hssS;       
  230::453     3e-06  25%  457 aa  HSSS_STAA1 RecName: Full=Heme sensor protein hssS;       
  492::742     3e-06  23%  755 aa  BPHY_DEIRA RecName: Full=Bacteriophytochrome;       
  157::395     4e-06  25%  413 aa  SPHS_SYNE7 RecName: Full=Sensor protein sphS;         EC=2.7.13.3;
  230::430     4e-06  22%  507 aa  CSEC_STRCO RecName: Full=Sensor protein cseC;         EC=2.7.13.3;
  684::847     5e-06  40% 1065 aa  TCSB_EMENI RecName: Full=Two-component system protein B;       
    3::130     5e-06  26%  146 aa  SP2AB_BACLD RecName: Full=Anti-sigma F factor;       
    3::130     5e-06  26%  146 aa  SP2AB_ANOFW RecName: Full=Anti-sigma F factor;       
  230::453     5e-06  25%  457 aa  HSSS_STAAB RecName: Full=Heme sensor protein hssS;       
  518::906     5e-06  31% 1736 aa  DHKI_DICDI RecName: Full=Hybrid signal transduction histidine
    3::130     6e-06  29%  146 aa  SP2AB_BACWK RecName: Full=Anti-sigma F factor;       
    3::130     6e-06  29%  146 aa  SP2AB_BACHK RecName: Full=Anti-sigma F factor;       
    3::130     6e-06  29%  146 aa  SP2AB_BACCZ RecName: Full=Anti-sigma F factor;       
    3::130     6e-06  29%  146 aa  SP2AB_BACCQ RecName: Full=Anti-sigma F factor;       
    3::130     6e-06  29%  146 aa  SP2AB_BACC7 RecName: Full=Anti-sigma F factor;       
    3::130     6e-06  29%  146 aa  SP2AB_BACC3 RecName: Full=Anti-sigma F factor;       
    3::130     6e-06  29%  146 aa  SP2AB_BACC1 RecName: Full=Anti-sigma F factor;       
    3::130     6e-06  29%  146 aa  SP2AB_BACC0 RecName: Full=Anti-sigma F factor;       
    3::130     6e-06  29%  146 aa  SP2AB_BACAN RecName: Full=Anti-sigma F factor;       
    3::130     6e-06  29%  146 aa  SP2AB_BACAH RecName: Full=Anti-sigma F factor;       
    3::130     6e-06  29%  146 aa  SP2AB_BACAC RecName: Full=Anti-sigma F factor;       
    3::130     6e-06  29%  146 aa  SP2AB_BACAA RecName: Full=Anti-sigma F factor;       
 1329::1516    6e-06  21% 2062 aa  DHKJ_DICDI RecName: Full=Hybrid signal transduction histidine kinase
   94::184     6e-06  27%  668 aa  ACOR_RALEH RecName: Full=Acetoin catabolism regulatory protein;
  272::509     8e-06  27%  682 aa  TCSA_EMENI RecName: Full=Two-component system protein A;       
    3::130     8e-06  29%  146 aa  SP2AB_BACC4 RecName: Full=Anti-sigma F factor;       
    3::130     8e-06  29%  146 aa  SP2AB_BACC2 RecName: Full=Anti-sigma F factor;       
  246::460     8e-06  25%  486 aa  PHOQ_ECO57 RecName: Full=Sensor protein phoQ;         EC=2.7.13.3;
  572::721     1e-05  30% 1220 aa  SLN1_YEAST RecName: Full=Osmosensing histidine protein kinase SLN1;
  230::453     1e-05  25%  457 aa  HSSS_STAAR RecName: Full=Heme sensor protein hssS;       
  106::329     1e-05  20%  346 aa  GRAS_STAES RecName: Full=Sensor histidine kinase graS;       
  106::329     1e-05  20%  346 aa  GRAS_STAEQ RecName: Full=Sensor histidine kinase graS;       
    3::130     2e-05  26%  146 aa  SP2AB_BACLI RecName: Full=Anti-sigma F factor;       
  238::432     2e-05  25%  487 aa  CSEC_STRAW RecName: Full=Sensor protein cseC;         EC=2.7.13.3;
  473::574     2e-05  36%  589 aa  LYTS_BACAN RecName: Full=Sensor protein lytS;         EC=2.7.13.3;
  469::638     2e-05  24% 1378 aa  DHKH_DICDI RecName: Full=Hybrid signal transduction histidine
  473::574     3e-05  36%  589 aa  LYTS_BACCR RecName: Full=Sensor protein lytS;         EC=2.7.13.3;
    3::130     4e-05  29%  146 aa  SP2AB_BACCR RecName: Full=Anti-sigma F factor;       
  340::450     4e-05  24%  451 aa  CSSS_BACSU RecName: Full=Sensor histidine kinase cssS;       
  236::405     4e-05  24%  487 aa  COPS_PSESM RecName: Full=Sensor protein copS;         EC=2.7.13.3;
    3::118     5e-05  24%  140 aa  SP2AB_CLOPS RecName: Full=Anti-sigma F factor;       
  141::377     7e-05  22%  443 aa  SEX3_MYCLE RecName: Full=Sensor-like histidine kinase senX3;       
  197::421     7e-05  24%  462 aa  REGB_RHOS4 RecName: Full=Sensor histidine kinase regB;       
  245::429     7e-05  24%  449 aa  QSEC_SALTY RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  245::429     7e-05  24%  449 aa  QSEC_SALTI RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  875::940     7e-05  44% 1699 aa  DHKE_DICDI RecName: Full=Hybrid signal transduction histidine
  261::475     9e-05  22%  487 aa  PHOQ_SALTY RecName: Full=Virulence sensor histidine kinase phoQ;   
  261::475     9e-05  22%  487 aa  PHOQ_SALTI RecName: Full=Virulence sensor histidine kinase phoQ;   
  261::475     9e-05  22%  487 aa  PHOQ_SALPA RecName: Full=Virulence sensor histidine kinase phoQ;   
  261::475     9e-05  22%  487 aa  PHOQ_SALCH RecName: Full=Virulence sensor histidine kinase phoQ;   
  102::329     9e-05  24%  342 aa  GRAS_STAS1 RecName: Full=Sensor histidine kinase graS;       
   98::158     1e-04  38%  524 aa  CNPD_PELLD RecName: Full=2',3'-cyclic-nucleotide
  245::434     1e-04  32%  449 aa  QSEC_ECO57 RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  177::344     2e-04  26%  344 aa  NREB_STAAR RecName: Full=Oxygen sensor histidine kinase nreB;      
  397::539     2e-04  36%  671 aa  CHEA_THEMA RecName: Full=Chemotaxis protein cheA;       
  100::359     3e-04  22%  692 aa  YQIR_BACSU RecName: Full=Putative sigma L-dependent transcriptional
  177::344     3e-04  25%  344 aa  NREB_STAAW RecName: Full=Oxygen sensor histidine kinase nreB;      
  177::344     3e-04  25%  344 aa  NREB_STAAT RecName: Full=Oxygen sensor histidine kinase nreB;      
  177::344     3e-04  25%  344 aa  NREB_STAAS RecName: Full=Oxygen sensor histidine kinase nreB;      
  177::344     3e-04  25%  344 aa  NREB_STAAN RecName: Full=Oxygen sensor histidine kinase nreB;      
  177::344     3e-04  25%  344 aa  NREB_STAAM RecName: Full=Oxygen sensor histidine kinase nreB;      
  177::344     3e-04  25%  344 aa  NREB_STAAE RecName: Full=Oxygen sensor histidine kinase nreB;      
  177::344     3e-04  25%  344 aa  NREB_STAAC RecName: Full=Oxygen sensor histidine kinase nreB;      
  177::344     3e-04  25%  344 aa  NREB_STAAB RecName: Full=Oxygen sensor histidine kinase nreB;      
  177::344     3e-04  25%  344 aa  NREB_STAA9 RecName: Full=Oxygen sensor histidine kinase nreB;      
  177::344     3e-04  25%  344 aa  NREB_STAA8 RecName: Full=Oxygen sensor histidine kinase nreB;      
  177::344     3e-04  25%  344 aa  NREB_STAA3 RecName: Full=Oxygen sensor histidine kinase nreB;      
  177::344     3e-04  25%  344 aa  NREB_STAA2 RecName: Full=Oxygen sensor histidine kinase nreB;      
  177::344     3e-04  25%  344 aa  NREB_STAA1 RecName: Full=Oxygen sensor histidine kinase nreB;      
  245::434     3e-04  28%  449 aa  QSEC_ECOLI RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
   33::140     0.001  30%  602 aa  TOP6B_ARCFU RecName: Full=Type 2 DNA topoisomerase 6 subunit B;    
  178::277     0.001  35%  310 aa  HPRK_STAES RecName: Full=HPr kinase/phosphorylase;       
  178::277     0.001  35%  310 aa  HPRK_STAEQ RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAAW RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAAT RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAAS RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAAR RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAAN RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAAM RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAAE RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAAC RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAAB RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAA9 RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAA8 RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAA3 RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAA2 RecName: Full=HPr kinase/phosphorylase;       
  178::300     0.001  34%  310 aa  HPRK_STAA1 RecName: Full=HPr kinase/phosphorylase;       
    1::578

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxLYSIWEKFINGQRIETKDLFSETYKAWLRCVEYRINPYQITTXXXXXXXXXYRKS
ATOS_ECOLI      ----------------------------------------------------------------------
KINC_BACSU      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
KINA_BACSU      ----------------------------------------------------------------------
KIND_BACSU      ----------------------------------------------------------------------
ZRAS_ECOLI      ----------------------------------------------------------------------
PILS_PSEAE      ----------------------------------------------------------------------
ZRAS_ECO57      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
ZRAS_KLEOX      ----------------------------------------------------------------------
DEGM_BACB2      ----------------------------------------------------------------------
NTRB_KLEOX      ----------------------------------------------------------------------
NTRB_SALTY      ----------------------------------------------------------------------
NTRB_SALTI      ----------------------------------------------------------------------
NTRB_VIBAL      ----------------------------------------------------------------------
NTRB_SHIFL      ----------------------------------------------------------------------
NTRB_ECOLI      ----------------------------------------------------------------------
NTRB_ECO57      ----------------------------------------------------------------------
WALK_STAHJ      ----------------------------------------------------------------------
FIXL_BRAJA      ----------------------------------------------------------------------
NTRB_AZOBR      ----------------------------------------------------------------------
VIRA_AGRT9      ----------------------------------------------------------------------
WALK_STAAE      ----------------------------------------------------------------------
FIXL_AZOC5      ----------------------------------------------------------------------
VIRAW_RHIRD     ----------------------------------------------------------------------
WALK_STAAW      ----------------------------------------------------------------------
WALK_STAAU      ----------------------------------------------------------------------
WALK_STAAT      ----------------------------------------------------------------------
WALK_STAAS      ----------------------------------------------------------------------
WALK_STAAR      ----------------------------------------------------------------------
WALK_STAAN      ----------------------------------------------------------------------
WALK_STAAM      ----------------------------------------------------------------------
WALK_STAAC      ----------------------------------------------------------------------
WALK_STAAB      ----------------------------------------------------------------------
WALK_STAA9      ----------------------------------------------------------------------
WALK_STAA8      ----------------------------------------------------------------------
WALK_STAA3      ----------------------------------------------------------------------
WALK_STAA2      ----------------------------------------------------------------------
WALK_STAA1      ----------------------------------------------------------------------
NTRB_RHOCA      ----------------------------------------------------------------------
NTRB_RHILP      ----------------------------------------------------------------------
NODV_BRAJA      ----------------------------------------------------------------------
DCTB_RHIME      ----------------------------------------------------------------------
WALK_STAES      ----------------------------------------------------------------------
WALK_STAEQ      ----------------------------------------------------------------------
NTRB_RHIME      ----------------------------------------------------------------------
Y3689_SHEFN     ----------------------------------------------------------------------
WALK_STASR      ----------------------------------------------------------------------
VIRA_AGRT5      ----------------------------------------------------------------------
WALK_STAS1      ----------------------------------------------------------------------
NTRB_BRASR      ----------------------------------------------------------------------
PHOR_BACSU      ----------------------------------------------------------------------
YYCG_BACSU      ----------------------------------------------------------------------
STC_CLOBE       ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
DCTB_RHILE      ----------------------------------------------------------------------
NTRYL_RICBR     ----------------------------------------------------------------------
SASA_CYAP7      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
SASA_SYNY3      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
FIXL_RHIME      ----------------------------------------------------------------------
SASA_CYAA5      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
DCTS_RHOCA      ----------------------------------------------------------------------
PLEC_CAUCR      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
NTRY_AZOBR      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
MTRB_MYCTU      ----------------------------------------------------------------------
MTRB_MYCBO      ----------------------------------------------------------------------
LOVHK_PSE14     ----------------------------------------------------------------------
SASA_SYNJA      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
NTRYL_RICPR     ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
VIRAL_RHIRD     ----------------------------------------------------------------------
LOVHK_PSESM     ----------------------------------------------------------------------
SASA_SYNJB      ----------------------------------------------------------------------
SASA_NOSP7      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SASA_PROMA      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------
SASA_THEEB      ----------------------------------------------------------------------
NTRYL_RICFE     ----------------------------------------------------------------------
LOVHK_PSEU2     ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_SYNE7      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
MTRB_MYCLE      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
SASA_SYNS3      ----------------------------------------------------------------------
MTRB_MYCPA      ----------------------------------------------------------------------
YCF26_PORYE     ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
NTRYL_RICCN     ----------------------------------------------------------------------
SASA_ANASP      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
SASA_ANAVT      ----------------------------------------------------------------------
NTRYL_RICTY     ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
PHOR_SHIDY      ----------------------------------------------------------------------
NTRB_PROVU      ----------------------------------------------------------------------
SASA_SYNS9      ----------------------------------------------------------------------
SASA_CYAP8      ----------------------------------------------------------------------
PHOR_KLEPN      ----------------------------------------------------------------------
YVRG_BACSU      ----------------------------------------------------------------------
PHOR_ECOLI      ----------------------------------------------------------------------
ARCB_SHIFL      ----------------------------------------------------------------------
ARCB_ECOLI      ----------------------------------------------------------------------
ARCB_ECO57      ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SASA_MICAN      ----------------------------------------------------------------------
DSPA_SYNY3      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
PGTB_SALTY      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
CHVG_AGRT5      ----------------------------------------------------------------------
KDPD_ECOLI      ----------------------------------------------------------------------
DCTS_BACSU      ----------------------------------------------------------------------
LUXQ_VIBVU      ----------------------------------------------------------------------
RPRX_BACFR      ----------------------------------------------------------------------
LUXQ_VIBVY      ----------------------------------------------------------------------
DOKA_DICDI      ----------------------------------------------------------------------
BVGS_BORPE      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
SAES_STAAW      ----------------------------------------------------------------------
SAES_STAAS      ----------------------------------------------------------------------
SAES_STAAR      ----------------------------------------------------------------------
SAES_STAAN      ----------------------------------------------------------------------
SAES_STAAM      ----------------------------------------------------------------------
SAES_STAAE      ----------------------------------------------------------------------
SAES_STAAC      ----------------------------------------------------------------------
SAES_STAAB      ----------------------------------------------------------------------
SAES_STAA8      ----------------------------------------------------------------------
SAES_STAA3      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
CHVG_RHIME      ----------------------------------------------------------------------
DCTS_BACHD      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
CITS_BACHD      ----------------------------------------------------------------------
VANS_ENTFC      ----------------------------------------------------------------------
RSSA_SERMA      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
NIFL_AZOVI      ----------------------------------------------------------------------
BAES_ECOLI      ----------------------------------------------------------------------
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
DCUS_SHIFL      ----------------------------------------------------------------------
DCUS_ECOLI      ----------------------------------------------------------------------
DCUS_ECOL6      ----------------------------------------------------------------------
DCUS_ECO57      ----------------------------------------------------------------------
GACS_PSESY      ----------------------------------------------------------------------
DLTS_STRA5      ----------------------------------------------------------------------
YKOH_BACSU      ----------------------------------------------------------------------
PHYB_ANASP      ----------------------------------------------------------------------
DLTS_STRA3      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
KDPD_CLOAB      ----------------------------------------------------------------------
MAK1_SCHPO      ----------------------------------------------------------------------
YCBM_BACSU      ----------------------------------------------------------------------
DIVL_CAUCR      ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
ENVZ_SALTI      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
ACOR_BACSU      -------------------WKRFVKDGVLDEARLRKRIAESWHRCKKAEVNPYLEKGPKVLQQTELDQQS
TORS_ECOLI      ----------------------------------------------------------------------
ENVZ_SALTY      ----------------------------------------------------------------------
CITS_BACSU      ----------------------------------------------------------------------
ARLS_STAS1      ----------------------------------------------------------------------
YCLK_BACSU      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
CUSS_ECOL6      ----------------------------------------------------------------------
ARLS_STAHJ      ----------------------------------------------------------------------
SILS_SALTY      ----------------------------------------------------------------------
PHOR_PSEAE      ----------------------------------------------------------------------
YFHK_ECOLI      ----------------------------------------------------------------------
MAK2_SCHPO      ----------------------------------------------------------------------
DHKL_DICDI      ----------------------------------------------------------------------
IRLS_BURPS      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
DHAR_CITFR      ----------------------------------------------------------------------
CUSS_ECOLI      ----------------------------------------------------------------------
SPAK_BACSU      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
LUXN_VIBHB      ----------------------------------------------------------------------
LUXN_VIBHA      ----------------------------------------------------------------------
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
ARLS_STAES      ----------------------------------------------------------------------
ARLS_STAEQ      ----------------------------------------------------------------------
MPRB_MYCVP      ----------------------------------------------------------------------
CUSS_ECO57      ----------------------------------------------------------------------
AFSQ2_STRCO     ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
ENVZ_SHIFL      ----------------------------------------------------------------------
ENVZ_ECOLI      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
CQSS_VIBCH      ----------------------------------------------------------------------
YTH3_RHOER      ---------------LSSAHQSFIDARGVPGQGLTDDSHESWMRSRNKGVNP-DVVGNPEMLEGLELEKY
MPRB_MYCA1      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
BASS_SALTY      ----------------------------------------------------------------------
ARLS_STAAW      ----------------------------------------------------------------------
ARLS_STAAS      ----------------------------------------------------------------------
ARLS_STAAR      ----------------------------------------------------------------------
ARLS_STAAN      ----------------------------------------------------------------------
ARLS_STAAM      ----------------------------------------------------------------------
ARLS_STAAC      ----------------------------------------------------------------------
ARLS_STAAB      ----------------------------------------------------------------------
ARLS_STAA8      ----------------------------------------------------------------------
ARLS_STAA3      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
SP2AB_BACME     ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------------
ETR1_PELHO      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
PHOR_HAEIN      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
ETR1_ARATH      ----------------------------------------------------------------------
BCES_BACSU      ----------------------------------------------------------------------
QSEC_HAEIN      ----------------------------------------------------------------------
PFES_PSEAE      ----------------------------------------------------------------------
GRAS_STAHJ      ----------------------------------------------------------------------
RSTB_ECOLI      ----------------------------------------------------------------------
MPRB_MYCLE      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
YEDV_ECOLI      ----------------------------------------------------------------------
ETR1_BRAOL      ----------------------------------------------------------------------
GLNK_BACSU      ----------------------------------------------------------------------
DHAR_ECOLI      ----------------------------------------------------------------------
CZCS_RALME      ----------------------------------------------------------------------
YXDK_BACSU      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
MPRB_MYCSS      ----------------------------------------------------------------------
MPRB_MYCSK      ----------------------------------------------------------------------
MPRB_MYCSJ      ----------------------------------------------------------------------
MALK_BACSU      ----------------------------------------------------------------------
KDPD_MYCTU      ----------------------------------------------------------------------
CQSS_VIBHB      ----------------------------------------------------------------------
PCOS_ECOLX      ----------------------------------------------------------------------
KDPD_RATRA      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
GRAS_STAAN      ----------------------------------------------------------------------
GRAS_STAAM      ----------------------------------------------------------------------
GRAS_STAA9      ----------------------------------------------------------------------
GRAS_STAA2      ----------------------------------------------------------------------
GRAS_STAA1      ----------------------------------------------------------------------
NISK_LACLA      ----------------------------------------------------------------------
ETR1_PASED      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
MPRB_MYCUA      ----------------------------------------------------------------------
HSSS_STAHJ      ----------------------------------------------------------------------
GRAS_STAAW      ----------------------------------------------------------------------
GRAS_STAAT      ----------------------------------------------------------------------
GRAS_STAAS      ----------------------------------------------------------------------
GRAS_STAAE      ----------------------------------------------------------------------
GRAS_STAAC      ----------------------------------------------------------------------
GRAS_STAAB      ----------------------------------------------------------------------
GRAS_STAA8      ----------------------------------------------------------------------
GRAS_STAA3      ----------------------------------------------------------------------
CITA_KLEPN      ----------------------------------------------------------------------
DPIB_ECOLI      ----------------------------------------------------------------------
BPHY_PSEAE      ----------------------------------------------------------------------
MPRB_MYCBP      ----------------------------------------------------------------------
MPRB_MYCBO      ----------------------------------------------------------------------
HSSS_STAAT      ----------------------------------------------------------------------
HSSS_STAAE      ----------------------------------------------------------------------
HSSS_STAAC      ----------------------------------------------------------------------
HSSS_STAA8      ----------------------------------------------------------------------
HSSS_STAA3      ----------------------------------------------------------------------
DHKG_DICDI      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
SP2AB_THETN     ----------------------------------------------------------------------
MPRB_MYCTU      ----------------------------------------------------------------------
MPRB_MYCTA      ----------------------------------------------------------------------
BASS_ECOLI      ----------------------------------------------------------------------
SP2AB_THEPX     ----------------------------------------------------------------------
SP2AB_THEP3     ----------------------------------------------------------------------
PHOQ_SHIFL      ----------------------------------------------------------------------
PHOQ_ECOLI      ----------------------------------------------------------------------
PHOQ_ECOL6      ----------------------------------------------------------------------
SP2AB_GEOTN     ----------------------------------------------------------------------
SP2AB_GEOKA     ----------------------------------------------------------------------
SP2AB_CLOPE     ----------------------------------------------------------------------
SP2AB_CLOP1     ----------------------------------------------------------------------
HSSS_STAAW      ----------------------------------------------------------------------
HSSS_STAAS      ----------------------------------------------------------------------
SP2AB_BACST     ----------------------------------------------------------------------
HSSS_STAAN      ----------------------------------------------------------------------
HSSS_STAAM      ----------------------------------------------------------------------
HSSS_STAA9      ----------------------------------------------------------------------
HSSS_STAA2      ----------------------------------------------------------------------
HSSS_STAA1      ----------------------------------------------------------------------
BPHY_DEIRA      ----------------------------------------------------------------------
SPHS_SYNE7      ----------------------------------------------------------------------
CSEC_STRCO      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
SP2AB_BACLD     ----------------------------------------------------------------------
SP2AB_ANOFW     ----------------------------------------------------------------------
HSSS_STAAB      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
SP2AB_BACWK     ----------------------------------------------------------------------
SP2AB_BACHK     ----------------------------------------------------------------------
SP2AB_BACCZ     ----------------------------------------------------------------------
SP2AB_BACCQ     ----------------------------------------------------------------------
SP2AB_BACC7     ----------------------------------------------------------------------
SP2AB_BACC3     ----------------------------------------------------------------------
SP2AB_BACC1     ----------------------------------------------------------------------
SP2AB_BACC0     ----------------------------------------------------------------------
SP2AB_BACAN     ----------------------------------------------------------------------
SP2AB_BACAH     ----------------------------------------------------------------------
SP2AB_BACAC     ----------------------------------------------------------------------
SP2AB_BACAA     ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
ACOR_RALEH      ----------------------------------------------------------------------
TCSA_EMENI      ----------------------------------------------------------------------
SP2AB_BACC4     ----------------------------------------------------------------------
SP2AB_BACC2     ----------------------------------------------------------------------
PHOQ_ECO57      ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
HSSS_STAAR      ----------------------------------------------------------------------
GRAS_STAES      ----------------------------------------------------------------------
GRAS_STAEQ      ----------------------------------------------------------------------
SP2AB_BACLI     ----------------------------------------------------------------------
CSEC_STRAW      ----------------------------------------------------------------------
LYTS_BACAN      ----------------------------------------------------------------------
DHKH_DICDI      ----------------------------------------------------------------------
LYTS_BACCR      ----------------------------------------------------------------------
SP2AB_BACCR     ----------------------------------------------------------------------
CSSS_BACSU      ----------------------------------------------------------------------
COPS_PSESM      ----------------------------------------------------------------------
SP2AB_CLOPS     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
REGB_RHOS4      ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
PHOQ_SALTY      ----------------------------------------------------------------------
PHOQ_SALTI      ----------------------------------------------------------------------
PHOQ_SALPA      ----------------------------------------------------------------------
PHOQ_SALCH      ----------------------------------------------------------------------
GRAS_STAS1      ----------------------------------------------------------------------
CNPD_PELLD      ----------------------------------------------------------------------
QSEC_ECO57      ----------------------------------------------------------------------
NREB_STAAR      ----------------------------------------------------------------------
CHEA_THEMA      ----------------------------------------------------------------------
YQIR_BACSU      ----------------------------------------------------------------------
NREB_STAAW      ----------------------------------------------------------------------
NREB_STAAT      ----------------------------------------------------------------------
NREB_STAAS      ----------------------------------------------------------------------
NREB_STAAN      ----------------------------------------------------------------------
NREB_STAAM      ----------------------------------------------------------------------
NREB_STAAE      ----------------------------------------------------------------------
NREB_STAAC      ----------------------------------------------------------------------
NREB_STAAB      ----------------------------------------------------------------------
NREB_STAA9      ----------------------------------------------------------------------
NREB_STAA8      ----------------------------------------------------------------------
NREB_STAA3      ----------------------------------------------------------------------
NREB_STAA2      ----------------------------------------------------------------------
NREB_STAA1      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
TOP6B_ARCFU     ----------------------------------------------------------------------
HPRK_STAES      ----------------------------------------------------------------------
HPRK_STAEQ      ----------------------------------------------------------------------
HPRK_STAAW      ----------------------------------------------------------------------
HPRK_STAAT      ----------------------------------------------------------------------
HPRK_STAAS      ----------------------------------------------------------------------
HPRK_STAAR      ----------------------------------------------------------------------
HPRK_STAAN      ----------------------------------------------------------------------
HPRK_STAAM      ----------------------------------------------------------------------
HPRK_STAAE      ----------------------------------------------------------------------
HPRK_STAAC      ----------------------------------------------------------------------
HPRK_STAAB      ----------------------------------------------------------------------
HPRK_STAA9      ----------------------------------------------------------------------
HPRK_STAA8      ----------------------------------------------------------------------
HPRK_STAA3      ----------------------------------------------------------------------
HPRK_STAA2      ----------------------------------------------------------------------
HPRK_STAA1      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KLTDMLELLTPHIETIKTTLSTHSDTFLILITDHEGFILESFTGKDSTKDLINVPYAPGIGYAEHLAGNN
ATOS_ECOLI      ----------------------------------------------------------------------
KINC_BACSU      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
KINA_BACSU      ----------------------------------------------------------------------
KIND_BACSU      ----------------------------------------------------------------------
ZRAS_ECOLI      ----------------------------------------------------------------------
PILS_PSEAE      ----------------------------------------------------------------------
ZRAS_ECO57      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
ZRAS_KLEOX      ----------------------------------------------------------------------
DEGM_BACB2      ----------------------------------------------------------------------
NTRB_KLEOX      ----------------------------------------------------------------------
NTRB_SALTY      ----------------------------------------------------------------------
NTRB_SALTI      ----------------------------------------------------------------------
NTRB_VIBAL      ----------------------------------------------------------------------
NTRB_SHIFL      ----------------------------------------------------------------------
NTRB_ECOLI      ----------------------------------------------------------------------
NTRB_ECO57      ----------------------------------------------------------------------
WALK_STAHJ      ----------------------------------------------------------------------
FIXL_BRAJA      ----------------------------------------------------------------------
NTRB_AZOBR      ----------------------------------------------------------------------
VIRA_AGRT9      ----------------------------------------------------------------------
WALK_STAAE      ----------------------------------------------------------------------
FIXL_AZOC5      ----------------------------------------------------------------------
VIRAW_RHIRD     ----------------------------------------------------------------------
WALK_STAAW      ----------------------------------------------------------------------
WALK_STAAU      ----------------------------------------------------------------------
WALK_STAAT      ----------------------------------------------------------------------
WALK_STAAS      ----------------------------------------------------------------------
WALK_STAAR      ----------------------------------------------------------------------
WALK_STAAN      ----------------------------------------------------------------------
WALK_STAAM      ----------------------------------------------------------------------
WALK_STAAC      ----------------------------------------------------------------------
WALK_STAAB      ----------------------------------------------------------------------
WALK_STAA9      ----------------------------------------------------------------------
WALK_STAA8      ----------------------------------------------------------------------
WALK_STAA3      ----------------------------------------------------------------------
WALK_STAA2      ----------------------------------------------------------------------
WALK_STAA1      ----------------------------------------------------------------------
NTRB_RHOCA      ----------------------------------------------------------------------
NTRB_RHILP      ----------------------------------------------------------------------
NODV_BRAJA      ----------------------------------------------------------------------
DCTB_RHIME      ----------------------------------------------------------------------
WALK_STAES      ----------------------------------------------------------------------
WALK_STAEQ      ----------------------------------------------------------------------
NTRB_RHIME      ----------------------------------------------------------------------
Y3689_SHEFN     ----------------------------------------------------------------------
WALK_STASR      ----------------------------------------------------------------------
VIRA_AGRT5      ----------------------------------------------------------------------
WALK_STAS1      ----------------------------------------------------------------------
NTRB_BRASR      ----------------------------------------------------------------------
PHOR_BACSU      ----------------------------------------------------------------------
YYCG_BACSU      ----------------------------------------------------------------------
STC_CLOBE       ----LIEIARPFMEILYNFLK--GSGFSLYFTEKNGVVLTXXXXXXXXXXXXXXXXXEGADMSEKSAGTN
PDHS_OCHA4      ----------------------------------------------------------------------
DCTB_RHILE      ----------------------------------------------------------------------
NTRYL_RICBR     ----------------------------------------------------------------------
SASA_CYAP7      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
SASA_SYNY3      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
FIXL_RHIME      ----------------------------------------------------------------------
SASA_CYAA5      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
DCTS_RHOCA      ----------------------------------------------------------------------
PLEC_CAUCR      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
NTRY_AZOBR      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
MTRB_MYCTU      ----------------------------------------------------------------------
MTRB_MYCBO      ----------------------------------------------------------------------
LOVHK_PSE14     ----------------------------------------------------------------------
SASA_SYNJA      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
NTRYL_RICPR     ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
VIRAL_RHIRD     ----------------------------------------------------------------------
LOVHK_PSESM     ----------------------------------------------------------------------
SASA_SYNJB      ----------------------------------------------------------------------
SASA_NOSP7      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SASA_PROMA      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------
SASA_THEEB      ----------------------------------------------------------------------
NTRYL_RICFE     ----------------------------------------------------------------------
LOVHK_PSEU2     ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_SYNE7      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
MTRB_MYCLE      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
SASA_SYNS3      ----------------------------------------------------------------------
MTRB_MYCPA      ----------------------------------------------------------------------
YCF26_PORYE     ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
NTRYL_RICCN     ----------------------------------------------------------------------
SASA_ANASP      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
SASA_ANAVT      ----------------------------------------------------------------------
NTRYL_RICTY     ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
PHOR_SHIDY      ----------------------------------------------------------------------
NTRB_PROVU      ----------------------------------------------------------------------
SASA_SYNS9      ----------------------------------------------------------------------
SASA_CYAP8      ----------------------------------------------------------------------
PHOR_KLEPN      ----------------------------------------------------------------------
YVRG_BACSU      ----------------------------------------------------------------------
PHOR_ECOLI      ----------------------------------------------------------------------
ARCB_SHIFL      ----------------------------------------------------------------------
ARCB_ECOLI      ----------------------------------------------------------------------
ARCB_ECO57      ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SASA_MICAN      ----------------------------------------------------------------------
DSPA_SYNY3      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
PGTB_SALTY      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
CHVG_AGRT5      ----------------------------------------------------------------------
KDPD_ECOLI      ----------------------------------------------------------------------
DCTS_BACSU      ----------------------------------------------------------------------
LUXQ_VIBVU      ----------------------------------------------------------------------
RPRX_BACFR      ----------------------------------------------------------------------
LUXQ_VIBVY      ----------------------------------------------------------------------
DOKA_DICDI      ----------------------------------------------------------------------
BVGS_BORPE      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
SAES_STAAW      ----------------------------------------------------------------------
SAES_STAAS      ----------------------------------------------------------------------
SAES_STAAR      ----------------------------------------------------------------------
SAES_STAAN      ----------------------------------------------------------------------
SAES_STAAM      ----------------------------------------------------------------------
SAES_STAAE      ----------------------------------------------------------------------
SAES_STAAC      ----------------------------------------------------------------------
SAES_STAAB      ----------------------------------------------------------------------
SAES_STAA8      ----------------------------------------------------------------------
SAES_STAA3      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
CHVG_RHIME      ----------------------------------------------------------------------
DCTS_BACHD      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
CITS_BACHD      ----------------------------------------------------------------------
VANS_ENTFC      ----------------------------------------------------------------------
RSSA_SERMA      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
NIFL_AZOVI      ----------------------------------------------------------------------
BAES_ECOLI      ----------------------------------------------------------------------
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
DCUS_SHIFL      ----------------------------------------------------------------------
DCUS_ECOLI      ----------------------------------------------------------------------
DCUS_ECOL6      ----------------------------------------------------------------------
DCUS_ECO57      ----------------------------------------------------------------------
GACS_PSESY      ----------------------------------------------------------------------
DLTS_STRA5      ----------------------------------------------------------------------
YKOH_BACSU      ----------------------------------------------------------------------
PHYB_ANASP      ----------------------------------------------------------------------
DLTS_STRA3      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
KDPD_CLOAB      ----------------------------------------------------------------------
MAK1_SCHPO      ----------------------------------------------------------------------
YCBM_BACSU      ----------------------------------------------------------------------
DIVL_CAUCR      ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
ENVZ_SALTI      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
ACOR_BACSU      KKHSFLTTAKPYLEKLLPAIKEME--MMALLIDSDGVVLALDGHPRALYEAKRINFVEGACWTETAVGTN
TORS_ECOLI      ----------------------------------------------------------------------
ENVZ_SALTY      ----------------------------------------------------------------------
CITS_BACSU      ----------------------------------------------------------------------
ARLS_STAS1      ----------------------------------------------------------------------
YCLK_BACSU      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
CUSS_ECOL6      ----------------------------------------------------------------------
ARLS_STAHJ      ----------------------------------------------------------------------
SILS_SALTY      ----------------------------------------------------------------------
PHOR_PSEAE      ----------------------------------------------------------------------
YFHK_ECOLI      ----------------------------------------------------------------------
MAK2_SCHPO      ----------------------------------------------------------------------
DHKL_DICDI      ----------------------------------------------------------------------
IRLS_BURPS      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
DHAR_CITFR      ----------------------------LLILDESACILSRCGDPQTVEQLAELGFRDGSYCAESIIGSC
CUSS_ECOLI      ----------------------------------------------------------------------
SPAK_BACSU      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
LUXN_VIBHB      ----------------------------------------------------------------------
LUXN_VIBHA      ----------------------------------------------------------------------
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
ARLS_STAES      ----------------------------------------------------------------------
ARLS_STAEQ      ----------------------------------------------------------------------
MPRB_MYCVP      ----------------------------------------------------------------------
CUSS_ECO57      ----------------------------------------------------------------------
AFSQ2_STRCO     ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
ENVZ_SHIFL      ----------------------------------------------------------------------
ENVZ_ECOLI      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
CQSS_VIBCH      ----------------------------------------------------------------------
YTH3_RHOER      RSAHPMSLIRPVIR--KLLVEDAAETLLIAISDAHGRLLW-VEGDNSAKDALSMNFVEGADWSEDRVGTN
MPRB_MYCA1      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
BASS_SALTY      ----------------------------------------------------------------------
ARLS_STAAW      ----------------------------------------------------------------------
ARLS_STAAS      ----------------------------------------------------------------------
ARLS_STAAR      ----------------------------------------------------------------------
ARLS_STAAN      ----------------------------------------------------------------------
ARLS_STAAM      ----------------------------------------------------------------------
ARLS_STAAC      ----------------------------------------------------------------------
ARLS_STAAB      ----------------------------------------------------------------------
ARLS_STAA8      ----------------------------------------------------------------------
ARLS_STAA3      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
SP2AB_BACME     ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------------
ETR1_PELHO      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
PHOR_HAEIN      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
ETR1_ARATH      ----------------------------------------------------------------------
BCES_BACSU      ----------------------------------------------------------------------
QSEC_HAEIN      ----------------------------------------------------------------------
PFES_PSEAE      ----------------------------------------------------------------------
GRAS_STAHJ      ----------------------------------------------------------------------
RSTB_ECOLI      ----------------------------------------------------------------------
MPRB_MYCLE      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
YEDV_ECOLI      ----------------------------------------------------------------------
ETR1_BRAOL      ----------------------------------------------------------------------
GLNK_BACSU      ----------------------------------------------------------------------
DHAR_ECOLI      ----------------------------LFILDETACILSRNGDPQTLQQLSALGFNDGTYCAEGIIGTC
CZCS_RALME      ----------------------------------------------------------------------
YXDK_BACSU      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
MPRB_MYCSS      ----------------------------------------------------------------------
MPRB_MYCSK      ----------------------------------------------------------------------
MPRB_MYCSJ      ----------------------------------------------------------------------
MALK_BACSU      ----------------------------------------------------------------------
KDPD_MYCTU      ----------------------------------------------------------------------
CQSS_VIBHB      ----------------------------------------------------------------------
PCOS_ECOLX      ----------------------------------------------------------------------
KDPD_RATRA      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
GRAS_STAAN      ----------------------------------------------------------------------
GRAS_STAAM      ----------------------------------------------------------------------
GRAS_STAA9      ----------------------------------------------------------------------
GRAS_STAA2      ----------------------------------------------------------------------
GRAS_STAA1      ----------------------------------------------------------------------
NISK_LACLA      ----------------------------------------------------------------------
ETR1_PASED      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
MPRB_MYCUA      ----------------------------------------------------------------------
HSSS_STAHJ      ----------------------------------------------------------------------
GRAS_STAAW      ----------------------------------------------------------------------
GRAS_STAAT      ----------------------------------------------------------------------
GRAS_STAAS      ----------------------------------------------------------------------
GRAS_STAAE      ----------------------------------------------------------------------
GRAS_STAAC      ----------------------------------------------------------------------
GRAS_STAAB      ----------------------------------------------------------------------
GRAS_STAA8      ----------------------------------------------------------------------
GRAS_STAA3      ----------------------------------------------------------------------
CITA_KLEPN      ----------------------------------------------------------------------
DPIB_ECOLI      ----------------------------------------------------------------------
BPHY_PSEAE      ----------------------------------------------------------------------
MPRB_MYCBP      ----------------------------------------------------------------------
MPRB_MYCBO      ----------------------------------------------------------------------
HSSS_STAAT      ----------------------------------------------------------------------
HSSS_STAAE      ----------------------------------------------------------------------
HSSS_STAAC      ----------------------------------------------------------------------
HSSS_STAA8      ----------------------------------------------------------------------
HSSS_STAA3      ----------------------------------------------------------------------
DHKG_DICDI      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
SP2AB_THETN     ----------------------------------------------------------------------
MPRB_MYCTU      ----------------------------------------------------------------------
MPRB_MYCTA      ----------------------------------------------------------------------
BASS_ECOLI      ----------------------------------------------------------------------
SP2AB_THEPX     ----------------------------------------------------------------------
SP2AB_THEP3     ----------------------------------------------------------------------
PHOQ_SHIFL      ----------------------------------------------------------------------
PHOQ_ECOLI      ----------------------------------------------------------------------
PHOQ_ECOL6      ----------------------------------------------------------------------
SP2AB_GEOTN     ----------------------------------------------------------------------
SP2AB_GEOKA     ----------------------------------------------------------------------
SP2AB_CLOPE     ----------------------------------------------------------------------
SP2AB_CLOP1     ----------------------------------------------------------------------
HSSS_STAAW      ----------------------------------------------------------------------
HSSS_STAAS      ----------------------------------------------------------------------
SP2AB_BACST     ----------------------------------------------------------------------
HSSS_STAAN      ----------------------------------------------------------------------
HSSS_STAAM      ----------------------------------------------------------------------
HSSS_STAA9      ----------------------------------------------------------------------
HSSS_STAA2      ----------------------------------------------------------------------
HSSS_STAA1      ----------------------------------------------------------------------
BPHY_DEIRA      ----------------------------------------------------------------------
SPHS_SYNE7      ----------------------------------------------------------------------
CSEC_STRCO      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
SP2AB_BACLD     ----------------------------------------------------------------------
SP2AB_ANOFW     ----------------------------------------------------------------------
HSSS_STAAB      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
SP2AB_BACWK     ----------------------------------------------------------------------
SP2AB_BACHK     ----------------------------------------------------------------------
SP2AB_BACCZ     ----------------------------------------------------------------------
SP2AB_BACCQ     ----------------------------------------------------------------------
SP2AB_BACC7     ----------------------------------------------------------------------
SP2AB_BACC3     ----------------------------------------------------------------------
SP2AB_BACC1     ----------------------------------------------------------------------
SP2AB_BACC0     ----------------------------------------------------------------------
SP2AB_BACAN     ----------------------------------------------------------------------
SP2AB_BACAH     ----------------------------------------------------------------------
SP2AB_BACAC     ----------------------------------------------------------------------
SP2AB_BACAA     ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
ACOR_RALEH      --------------------------YVVLLTDAQGVTVDYIGEARSDAALRHAGLYLGAEWSESGAGTC
TCSA_EMENI      ----------------------------------------------------------------------
SP2AB_BACC4     ----------------------------------------------------------------------
SP2AB_BACC2     ----------------------------------------------------------------------
PHOQ_ECO57      ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
HSSS_STAAR      ----------------------------------------------------------------------
GRAS_STAES      ----------------------------------------------------------------------
GRAS_STAEQ      ----------------------------------------------------------------------
SP2AB_BACLI     ----------------------------------------------------------------------
CSEC_STRAW      ----------------------------------------------------------------------
LYTS_BACAN      ----------------------------------------------------------------------
DHKH_DICDI      ----------------------------------------------------------------------
LYTS_BACCR      ----------------------------------------------------------------------
SP2AB_BACCR     ----------------------------------------------------------------------
CSSS_BACSU      ----------------------------------------------------------------------
COPS_PSESM      ----------------------------------------------------------------------
SP2AB_CLOPS     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
REGB_RHOS4      ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
PHOQ_SALTY      ----------------------------------------------------------------------
PHOQ_SALTI      ----------------------------------------------------------------------
PHOQ_SALPA      ----------------------------------------------------------------------
PHOQ_SALCH      ----------------------------------------------------------------------
GRAS_STAS1      ----------------------------------------------------------------------
CNPD_PELLD      ----------------------------------------------------------------------
QSEC_ECO57      ----------------------------------------------------------------------
NREB_STAAR      ----------------------------------------------------------------------
CHEA_THEMA      ----------------------------------------------------------------------
YQIR_BACSU      ----------------------------------------------------------------------
NREB_STAAW      ----------------------------------------------------------------------
NREB_STAAT      ----------------------------------------------------------------------
NREB_STAAS      ----------------------------------------------------------------------
NREB_STAAN      ----------------------------------------------------------------------
NREB_STAAM      ----------------------------------------------------------------------
NREB_STAAE      ----------------------------------------------------------------------
NREB_STAAC      ----------------------------------------------------------------------
NREB_STAAB      ----------------------------------------------------------------------
NREB_STAA9      ----------------------------------------------------------------------
NREB_STAA8      ----------------------------------------------------------------------
NREB_STAA3      ----------------------------------------------------------------------
NREB_STAA2      ----------------------------------------------------------------------
NREB_STAA1      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
TOP6B_ARCFU     ----------------------------------------------------------------------
HPRK_STAES      ----------------------------------------------------------------------
HPRK_STAEQ      ----------------------------------------------------------------------
HPRK_STAAW      ----------------------------------------------------------------------
HPRK_STAAT      ----------------------------------------------------------------------
HPRK_STAAS      ----------------------------------------------------------------------
HPRK_STAAR      ----------------------------------------------------------------------
HPRK_STAAN      ----------------------------------------------------------------------
HPRK_STAAM      ----------------------------------------------------------------------
HPRK_STAAE      ----------------------------------------------------------------------
HPRK_STAAC      ----------------------------------------------------------------------
HPRK_STAAB      ----------------------------------------------------------------------
HPRK_STAA9      ----------------------------------------------------------------------
HPRK_STAA8      ----------------------------------------------------------------------
HPRK_STAA3      ----------------------------------------------------------------------
HPRK_STAA2      ----------------------------------------------------------------------
HPRK_STAA1      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GIGSVLATGIPLAVLGAEHFVKDFHRWSCVGSPIIGDKGDIIAVLGVFMPCGMESPYTFSLTVAATKAVE
ATOS_ECOLI      ----------------------------------------------------------------------
KINC_BACSU      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
KINA_BACSU      ----------------------------------------------------------------------
KIND_BACSU      ----------------------------------------------------------------------
ZRAS_ECOLI      ----------------------------------------------------------------------
PILS_PSEAE      -----------------------------------------------------------TLCFAAALVIQ
ZRAS_ECO57      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
ZRAS_KLEOX      ----------------------------------------------------------------------
DEGM_BACB2      ----------------------------------------------------------------------
NTRB_KLEOX      ----------------------------------------------------------------------
NTRB_SALTY      ----------------------------------------------------------------------
NTRB_SALTI      ----------------------------------------------------------------------
NTRB_VIBAL      ----------------------------------------------------------------------
NTRB_SHIFL      ----------------------------------------------------------------------
NTRB_ECOLI      ----------------------------------------------------------------------
NTRB_ECO57      ----------------------------------------------------------------------
WALK_STAHJ      ---------------------------------------------------------------------E
FIXL_BRAJA      ----------------------------------------------------------------------
NTRB_AZOBR      ----------------------------------------------------------------------
VIRA_AGRT9      ----------------------------------------------------------------------
WALK_STAAE      ---------------------------------------------------------------------E
FIXL_AZOC5      ----------------------------------------------------------------------
VIRAW_RHIRD     ----------------------------------------------------------------------
WALK_STAAW      ---------------------------------------------------------------------E
WALK_STAAU      ---------------------------------------------------------------------E
WALK_STAAT      ---------------------------------------------------------------------E
WALK_STAAS      ---------------------------------------------------------------------E
WALK_STAAR      ---------------------------------------------------------------------E
WALK_STAAN      ---------------------------------------------------------------------E
WALK_STAAM      ---------------------------------------------------------------------E
WALK_STAAC      ---------------------------------------------------------------------E
WALK_STAAB      ---------------------------------------------------------------------E
WALK_STAA9      ---------------------------------------------------------------------E
WALK_STAA8      ---------------------------------------------------------------------E
WALK_STAA3      ---------------------------------------------------------------------E
WALK_STAA2      ---------------------------------------------------------------------E
WALK_STAA1      ---------------------------------------------------------------------E
NTRB_RHOCA      ----------------------------------------------------------------------
NTRB_RHILP      ----------------------------------------------------------------------
NODV_BRAJA      ----------------------------------------------------------------------
DCTB_RHIME      ----------------------------------------------------------------------
WALK_STAES      ---------------------------------------------------------------------E
WALK_STAEQ      ---------------------------------------------------------------------E
NTRB_RHIME      ----------------------------------------------------------------------
Y3689_SHEFN     -----------------------------------------------------------------TKALD
WALK_STASR      ---------------------------------------------------------------------E
VIRA_AGRT5      ----------------------------------------------------------------------
WALK_STAS1      ---------------------------------------------------------------------E
NTRB_BRASR      ----------------------------------------------------------------------
PHOR_BACSU      ----------------------------------------------------------------------
YYCG_BACSU      ----------------------------------------------------------------------
STC_CLOBE       GIGTAFAENISLQISGEEHFIKVFQIWTCSSSVVHDEDGNIIGCLNLTGRRQLAHPHTLGLVVAAVKSIE
PDHS_OCHA4      ----------------------------------------------------------------------
DCTB_RHILE      ----------------------------------------------------------------------
NTRYL_RICBR     ----------------------------------------------------------------------
SASA_CYAP7      ----------------------------------------------------------------------
RESE_BACSU      ---------------------------------------------------------------------E
DIVJ_CAUCR      ----------------------------------------------------------------------
SASA_SYNY3      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
FIXL_RHIME      ----------------------------------------------------------------------
SASA_CYAA5      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
DCTS_RHOCA      ----------------------------------------------------------------------
PLEC_CAUCR      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
NTRY_AZOBR      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
MTRB_MYCTU      ----------------------------------------------------------------------
MTRB_MYCBO      ----------------------------------------------------------------------
LOVHK_PSE14     ----------------------------------------------------------------------
SASA_SYNJA      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
NTRYL_RICPR     ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
VIRAL_RHIRD     ----------------------------------------------------------------------
LOVHK_PSESM     ----------------------------------------------------------------------
SASA_SYNJB      ----------------------------------------------------------------------
SASA_NOSP7      ----------------------------------------------------------------------
SRRB_STAAR      -----------------------------------------------------EGDYSYKPSVT-TKDEI
SASA_PROMA      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------
SASA_THEEB      ----------------------------------------------------------------------
NTRYL_RICFE     ----------------------------------------------------------------------
LOVHK_PSEU2     ----------------------------------------------------------------------
SRRB_STAAW      -----------------------------------------------------EGDYSYKPSVT-TKDEI
SRRB_STAAU      -----------------------------------------------------EGDYSYKPSVT-TKDEI
SRRB_STAAS      -----------------------------------------------------EGDYSYKPSVT-TKDEI
SRRB_STAAC      -----------------------------------------------------EGDYSYKPSVT-TKDEI
SRRB_STAA8      -----------------------------------------------------EGDYSYKPSVT-TKDEI
SASA_SYNE7      ----------------------------------------------------------------------
SRRB_STAAN      -----------------------------------------------------EGDYSYKPSVT-TKDEI
SRRB_STAAM      -----------------------------------------------------EGDYSYKPSVT-TKDEI
MTRB_MYCLE      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
SASA_SYNS3      ----------------------------------------------------------------------
MTRB_MYCPA      ----------------------------------------------------------------------
YCF26_PORYE     ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
NTRYL_RICCN     ----------------------------------------------------------------------
SASA_ANASP      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
SASA_ANAVT      ----------------------------------------------------------------------
NTRYL_RICTY     ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
PHOR_SHIDY      ----------------------------------------------------------------------
NTRB_PROVU      ----------------------------------------------------------------------
SASA_SYNS9      ----------------------------------------------------------------------
SASA_CYAP8      ----------------------------------------------------------------------
PHOR_KLEPN      ----------------------------------------------------------------------
YVRG_BACSU      ----------------------------------------------------------------------
PHOR_ECOLI      ----------------------------------------------------------------------
ARCB_SHIFL      ----------------------------------------------------------------------
ARCB_ECOLI      ----------------------------------------------------------------------
ARCB_ECO57      ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SASA_MICAN      ----------------------------------------------------------------------
DSPA_SYNY3      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
PGTB_SALTY      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
CHVG_AGRT5      ----------------------------------------------------------------------
KDPD_ECOLI      ----------------------------------------------------------------------
DCTS_BACSU      ----------------------------------------------------------------------
LUXQ_VIBVU      ----------------------------------------------------------------------
RPRX_BACFR      ----------------------------------------------------------------------
LUXQ_VIBVY      ----------------------------------------------------------------------
DOKA_DICDI      ----------------------------------------------------------------------
BVGS_BORPE      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
SAES_STAAW      ----------------------------------------------------------------------
SAES_STAAS      ----------------------------------------------------------------------
SAES_STAAR      ----------------------------------------------------------------------
SAES_STAAN      ----------------------------------------------------------------------
SAES_STAAM      ----------------------------------------------------------------------
SAES_STAAE      ----------------------------------------------------------------------
SAES_STAAC      ----------------------------------------------------------------------
SAES_STAAB      ----------------------------------------------------------------------
SAES_STAA8      ----------------------------------------------------------------------
SAES_STAA3      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
CHVG_RHIME      ----------------------------------------------------------------------
DCTS_BACHD      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
CITS_BACHD      ----------------------------------------------------------------------
VANS_ENTFC      ----------------------------------------------------------------------
RSSA_SERMA      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
NIFL_AZOVI      ----------------------------------------------------------------------
BAES_ECOLI      ----------------------------------------------------------------------
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
DCUS_SHIFL      ----------------------------------------------------------------------
DCUS_ECOLI      ----------------------------------------------------------------------
DCUS_ECOL6      ----------------------------------------------------------------------
DCUS_ECO57      ----------------------------------------------------------------------
GACS_PSESY      ----------------------------------------------------------------------
DLTS_STRA5      ----------------------------------------------------------------------
YKOH_BACSU      ----------------------------------------------------------------------
PHYB_ANASP      ----------------------------------------------------------------------
DLTS_STRA3      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
KDPD_CLOAB      ----------------------------------------------------------------------
MAK1_SCHPO      ----------------------------------------------------------------------
YCBM_BACSU      ----------------------------------------------------------------------
DIVL_CAUCR      ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
ENVZ_SALTI      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
ACOR_BACSU      AIGTALHISEPVAIQGSEHYSIASHLWNCSAAPIHHEDGSLAGVIDISCPAAGAHPH-------------
TORS_ECOLI      ----------------------------------------------------------------------
ENVZ_SALTY      ----------------------------------------------------------------------
CITS_BACSU      ----------------------------------------------------------------------
ARLS_STAS1      ----------------------------------------------------------------------
YCLK_BACSU      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
CUSS_ECOL6      ----------------------------------------------------------------------
ARLS_STAHJ      ----------------------------------------------------------------------
SILS_SALTY      ----------------------------------------------------------------------
PHOR_PSEAE      ----------------------------------------------------------------------
YFHK_ECOLI      ----------------------------------------------------------------------
MAK2_SCHPO      ----------------------------------------------------------------------
DHKL_DICDI      ----------------------------------------------------------------------
IRLS_BURPS      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
DHAR_CITFR      ALSLATMPGQPTKTSGDQHFKQALHPWSFCSTPVFDNHGRLFGSISLCCLVEHECVSDLSLTLAIAREVG
CUSS_ECOLI      ----------------------------------------------------------------------
SPAK_BACSU      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
LUXN_VIBHB      ----------------------------------------------------------------------
LUXN_VIBHA      ----------------------------------------------------------------------
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
ARLS_STAES      ----------------------------------------------------------------------
ARLS_STAEQ      ----------------------------------------------------------------------
MPRB_MYCVP      ----------------------------------------------------------------------
CUSS_ECO57      ----------------------------------------------------------------------
AFSQ2_STRCO     ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
ENVZ_SHIFL      ----------------------------------------------------------------------
ENVZ_ECOLI      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
CQSS_VIBCH      ----------------------------------------------------------------------
YTH3_RHOER      APGTALALDHAVQIFGSEHFNRTVHDWSCSAAPVHDTTGQILGAIDITGGPRVAVPEVLSLIRATVAAAE
MPRB_MYCA1      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
BASS_SALTY      ----------------------------------------------------------------------
ARLS_STAAW      ----------------------------------------------------------------------
ARLS_STAAS      ----------------------------------------------------------------------
ARLS_STAAR      ----------------------------------------------------------------------
ARLS_STAAN      ----------------------------------------------------------------------
ARLS_STAAM      ----------------------------------------------------------------------
ARLS_STAAC      ----------------------------------------------------------------------
ARLS_STAAB      ----------------------------------------------------------------------
ARLS_STAA8      ----------------------------------------------------------------------
ARLS_STAA3      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
SP2AB_BACME     ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------------
ETR1_PELHO      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
PHOR_HAEIN      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
ETR1_ARATH      ----------------------------------------------------------------------
BCES_BACSU      ----------------------------------------------------------------------
QSEC_HAEIN      ----------------------------------------------------------------------
PFES_PSEAE      ----------------------------------------------------------------------
GRAS_STAHJ      ----------------------------------------------------------------------
RSTB_ECOLI      ----------------------------------------------------------------------
MPRB_MYCLE      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
YEDV_ECOLI      ----------------------------------------------------------------------
ETR1_BRAOL      ----------------------------------------------------------------------
GLNK_BACSU      ----------------------------------------------------------------------
DHAR_ECOLI      ALSLAAISGQAVKTMADQHFKQVLWNWAFCATPLFDSKGRLTGTIALACPVEQTTAADLPLTLAIAREVG
CZCS_RALME      ----------------------------------------------------------------------
YXDK_BACSU      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
MPRB_MYCSS      ----------------------------------------------------------------------
MPRB_MYCSK      ----------------------------------------------------------------------
MPRB_MYCSJ      ----------------------------------------------------------------------
MALK_BACSU      ----------------------------------------------------------------------
KDPD_MYCTU      ----------------------------------------------------------------------
CQSS_VIBHB      ----------------------------------------------------------------------
PCOS_ECOLX      ----------------------------------------------------------------------
KDPD_RATRA      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
GRAS_STAAN      ----------------------------------------------------------------------
GRAS_STAAM      ----------------------------------------------------------------------
GRAS_STAA9      ----------------------------------------------------------------------
GRAS_STAA2      ----------------------------------------------------------------------
GRAS_STAA1      ----------------------------------------------------------------------
NISK_LACLA      ----------------------------------------------------------------------
ETR1_PASED      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
MPRB_MYCUA      ----------------------------------------------------------------------
HSSS_STAHJ      ----------------------------------------------------------------------
GRAS_STAAW      ----------------------------------------------------------------------
GRAS_STAAT      ----------------------------------------------------------------------
GRAS_STAAS      ----------------------------------------------------------------------
GRAS_STAAE      ----------------------------------------------------------------------
GRAS_STAAC      ----------------------------------------------------------------------
GRAS_STAAB      ----------------------------------------------------------------------
GRAS_STAA8      ----------------------------------------------------------------------
GRAS_STAA3      ----------------------------------------------------------------------
CITA_KLEPN      ----------------------------------------------------------------------
DPIB_ECOLI      -------------------------------TPIFDDDGKVIGVVSIYLVSKIDSRAEFLLPMAGVFVVL
BPHY_PSEAE      ----------------------------------------------------------------------
MPRB_MYCBP      ----------------------------------------------------------------------
MPRB_MYCBO      ----------------------------------------------------------------------
HSSS_STAAT      ----------------------------------------------------------------------
HSSS_STAAE      ----------------------------------------------------------------------
HSSS_STAAC      ----------------------------------------------------------------------
HSSS_STAA8      ----------------------------------------------------------------------
HSSS_STAA3      ----------------------------------------------------------------------
DHKG_DICDI      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
SP2AB_THETN     ----------------------------------------------------------------------
MPRB_MYCTU      ----------------------------------------------------------------------
MPRB_MYCTA      ----------------------------------------------------------------------
BASS_ECOLI      ----------------------------------------------------------------------
SP2AB_THEPX     ----------------------------------------------------------------------
SP2AB_THEP3     ----------------------------------------------------------------------
PHOQ_SHIFL      ----------------------------------------------------------------------
PHOQ_ECOLI      ----------------------------------------------------------------------
PHOQ_ECOL6      ----------------------------------------------------------------------
SP2AB_GEOTN     ----------------------------------------------------------------------
SP2AB_GEOKA     ----------------------------------------------------------------------
SP2AB_CLOPE     ----------------------------------------------------------------------
SP2AB_CLOP1     ----------------------------------------------------------------------
HSSS_STAAW      ----------------------------------------------------------------------
HSSS_STAAS      ----------------------------------------------------------------------
SP2AB_BACST     ----------------------------------------------------------------------
HSSS_STAAN      ----------------------------------------------------------------------
HSSS_STAAM      ----------------------------------------------------------------------
HSSS_STAA9      ----------------------------------------------------------------------
HSSS_STAA2      ----------------------------------------------------------------------
HSSS_STAA1      ----------------------------------------------------------------------
BPHY_DEIRA      ----------------------------------------------------------------------
SPHS_SYNE7      ----------------------------------------------------------------------
CSEC_STRCO      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
SP2AB_BACLD     ----------------------------------------------------------------------
SP2AB_ANOFW     ----------------------------------------------------------------------
HSSS_STAAB      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
SP2AB_BACWK     ----------------------------------------------------------------------
SP2AB_BACHK     ----------------------------------------------------------------------
SP2AB_BACCZ     ----------------------------------------------------------------------
SP2AB_BACCQ     ----------------------------------------------------------------------
SP2AB_BACC7     ----------------------------------------------------------------------
SP2AB_BACC3     ----------------------------------------------------------------------
SP2AB_BACC1     ----------------------------------------------------------------------
SP2AB_BACC0     ----------------------------------------------------------------------
SP2AB_BACAN     ----------------------------------------------------------------------
SP2AB_BACAH     ----------------------------------------------------------------------
SP2AB_BACAC     ----------------------------------------------------------------------
SP2AB_BACAA     ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
ACOR_RALEH      AVGTALATGQALTVHQADHFDATHIPLTCTAAPLFDTHGNLHAILDI-----------------------
TCSA_EMENI      ----------------------------------------------------------------------
SP2AB_BACC4     ----------------------------------------------------------------------
SP2AB_BACC2     ----------------------------------------------------------------------
PHOQ_ECO57      ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
HSSS_STAAR      ----------------------------------------------------------------------
GRAS_STAES      ----------------------------------------------------------------------
GRAS_STAEQ      ----------------------------------------------------------------------
SP2AB_BACLI     ----------------------------------------------------------------------
CSEC_STRAW      ----------------------------------------------------------------------
LYTS_BACAN      ----------------------------------------------------------------------
DHKH_DICDI      ----------------------------------------------------------------------
LYTS_BACCR      ----------------------------------------------------------------------
SP2AB_BACCR     ----------------------------------------------------------------------
CSSS_BACSU      ----------------------------------------------------------------------
COPS_PSESM      ----------------------------------------------------------------------
SP2AB_CLOPS     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
REGB_RHOS4      ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
PHOQ_SALTY      ----------------------------------------------------------------------
PHOQ_SALTI      ----------------------------------------------------------------------
PHOQ_SALPA      ----------------------------------------------------------------------
PHOQ_SALCH      ----------------------------------------------------------------------
GRAS_STAS1      ----------------------------------------------------------------------
CNPD_PELLD      ----------------------------------------------------------------------
QSEC_ECO57      ----------------------------------------------------------------------
NREB_STAAR      ----------------------------------------------------------------------
CHEA_THEMA      ----------------------------------------------------------------------
YQIR_BACSU      ----------------------------------------------------------------------
NREB_STAAW      ----------------------------------------------------------------------
NREB_STAAT      ----------------------------------------------------------------------
NREB_STAAS      ----------------------------------------------------------------------
NREB_STAAN      ----------------------------------------------------------------------
NREB_STAAM      ----------------------------------------------------------------------
NREB_STAAE      ----------------------------------------------------------------------
NREB_STAAC      ----------------------------------------------------------------------
NREB_STAAB      ----------------------------------------------------------------------
NREB_STAA9      ----------------------------------------------------------------------
NREB_STAA8      ----------------------------------------------------------------------
NREB_STAA3      ----------------------------------------------------------------------
NREB_STAA2      ----------------------------------------------------------------------
NREB_STAA1      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
TOP6B_ARCFU     ----------------------------------------------------------------------
HPRK_STAES      ----------------------------------------------------------------------
HPRK_STAEQ      ----------------------------------------------------------------------
HPRK_STAAW      ----------------------------------------------------------------------
HPRK_STAAT      ----------------------------------------------------------------------
HPRK_STAAS      ----------------------------------------------------------------------
HPRK_STAAR      ----------------------------------------------------------------------
HPRK_STAAN      ----------------------------------------------------------------------
HPRK_STAAM      ----------------------------------------------------------------------
HPRK_STAAE      ----------------------------------------------------------------------
HPRK_STAAC      ----------------------------------------------------------------------
HPRK_STAAB      ----------------------------------------------------------------------
HPRK_STAA9      ----------------------------------------------------------------------
HPRK_STAA8      ----------------------------------------------------------------------
HPRK_STAA3      ----------------------------------------------------------------------
HPRK_STAA2      ----------------------------------------------------------------------
HPRK_STAA1      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AAIKQGQMEKQLQDTRKTLRNLMQQRNIIFNAMSQGVIILNHEGIVTFFNKAAEEIWHINADELVGRPFF
ATOS_ECOLI      ---EMGQISQSVNNLAQALRETRTLNDLIIENAADGVIAIDRQGDVTTMNPAAEVITGYQRHELVGQPYM
KINC_BACSU      ------QLVKKMKDNEWKYKQLSEEKNRIMDNLQEIVFQTNAKGEITYLNQAWASITGFSISECMGTMY-
KINE_BACSU      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
KINA_BACSU      ----------------------------------------------------------------------
KIND_BACSU      ----------------------------------------------------------------------
ZRAS_ECOLI      ----------------------------------------------------------------------
PILS_PSEAE      ALVRQEQTETLAEERAETVANLEELNALILQRMRTGILVVDSRQAILLANQAALGL--LRQDDVQG----
ZRAS_ECO57      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
ZRAS_KLEOX      ----------------------------------------------------------------------
DEGM_BACB2      ----------------------------------------------------------------------
NTRB_KLEOX      ----------------------------------------------------------------------
NTRB_SALTY      ----------------------------ILNSLINSVLVVDDALAIHYANPAAQQLLAQSSRKLFGTPLE
NTRB_SALTI      ----------------------------ILNSLINSVLVVDDALAIHYANPAAQQLLAQSSRKLFGTPLE
NTRB_VIBAL      ----------------------------ILNNMVTATLILDDGLAIRYANPAAELLFSQSAKRIVEQSLS
NTRB_SHIFL      ----------------------------------------------------------------------
NTRB_ECOLI      ----------------------------------------------------------------------
NTRB_ECO57      ----------------------------------------------------------------------
WALK_STAHJ      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRVRIVNDMAIKMLGMSKEDLIG--YY
FIXL_BRAJA      --------EKQVEGALRTRETHLRS---ILHTIPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVN
NTRB_AZOBR      --------------------------SVMLNALPDPVLVVDGSGDIRYVNLEAQEFFGLSAAMMEGMPLA
VIRA_AGRT9      ----------------------------------------------------------------------
WALK_STAAE      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMFGMAKEDIIG--YY
FIXL_AZOC5      ----------------------------ILDTVPDAMIVIDERGIMQSFSITAERLFGYSPSEVIGRNVS
VIRAW_RHIRD     ----------------------------------------------------------------------
WALK_STAAW      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
WALK_STAAU      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
WALK_STAAT      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
WALK_STAAS      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
WALK_STAAR      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
WALK_STAAN      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
WALK_STAAM      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
WALK_STAAC      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
WALK_STAAB      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
WALK_STAA9      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
WALK_STAA8      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
WALK_STAA3      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
WALK_STAA2      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
WALK_STAA1      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIG--YY
NTRB_RHOCA      ---------------------------IIWNSLPLPALMLDVNDRVIEINPAAELFLNLSARALKGQALG
NTRB_RHILP      ----------------------------------------------------------------------
NODV_BRAJA      ----------------------------------------------------------------------
DCTB_RHIME      ----------------------------------------------------------------------
WALK_STAES      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGILATDRRGRVRIANDMALKMLGLAKEDVIG--YY
WALK_STAEQ      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGILATDRRGRVRIANDMALKMLGLAKEDVIG--YY
NTRB_RHIME      ----------------------------VLNAIQNPVILVDENGFVAFANWEAESFFGASANHLARHDIS
Y3689_SHEFN     AEIQRKRIEVEISE-------LSQQFQSVLDGLPNGVTIVNQELQHLWSND--NNIHLLDSDEF----YY
WALK_STASR      LALSFNNLSKRVQEAQANTESEKRRLDSVITHMSDGVLATDRRGRVRIINEMALKMLGLECADVEAKHIL
VIRA_AGRT5      -----------------------------FNAESCALALVDHGAVESFAAKLPEPVW----EDLALREMV
WALK_STAS1      LALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRVRIVNDMALTMMGTMKEDIIGDHML
NTRB_BRASR      ----------------------------ILNALPNPVLLVAPDGRIVDANIAAESFFEISTQELV--PF-
PHOR_BACSU      ----------------------------VIENIGSGLIMIDGRGFINLVNRSYAKQFHINPNHMLRRLYH
YYCG_BACSU      -------LTRELEDAQAMTEGERRKLASVIAYMTDGVIATNRNGAIILLNSPALELLNVSRETALEMPIT
STC_CLOBE       NHLK-------VKKTQNELVKTYQYLNKITDSVNLGIFAVDTKGIIKAINKSACDMLHINEEDVINKN--
PDHS_OCHA4      -------------DEKQALADHVEELKTILDTATDGVVLIDPEGRIRSMNHSASALFGYERDETEGKFFF
DCTB_RHILE      ----------------------------------------------------------------------
NTRYL_RICBR     ----------------------------------------------------------------------
SASA_CYAP7      ----------------------------------------------------------------------
RESE_BACSU      LATAFNQMGRQLNFHINALNQEKEQLSNILSSMADGVITINIDGTILVTNPPAEQAWYYEQNMNI-----
DIVJ_CAUCR      ----------------------------------------------------------------------
SASA_SYNY3      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
FIXL_RHIME      ----------------------------------------------------------------------
SASA_CYAA5      ----------------------------------------------------------------------
PDHS_BRUSU      ---------------KQALEAHVEELKTILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFF
PDHS_BRUSI      ---------------KQALEAHVEELKTILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFF
PDHS_BRUME      ---------------KQALEAHVEELKTILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFF
PDHS_BRUAB      ---------------KQALEAHVEELKTILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFF
PDHS_BRUA2      ---------------KQALEAHVEELKTILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFF
PDHS_BRUA1      ---------------KQALEAHVEELKTILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFF
DCTS_RHOCA      ----------------------------------------------------------------------
PLEC_CAUCR      ----------------------------------------------------------------------
PDHS_BRUC2      ---------------KQALEAHVEELKTILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFF
NTRY_AZOBR      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
MTRB_MYCTU      ----------------------------------------------------------------------
MTRB_MYCBO      ----------------------------------------------------------------------
LOVHK_PSE14     ---------------------------------------------IIFSNRAFLEMTGYSSEEIIG----
SASA_SYNJA      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
NTRYL_RICPR     ----------------------------------------------------------------------
LUXQ_VIBHA      ---------EELEAQKKSFRDL-------FNFALSPIMVWSEESVLIQMNPAARKELVIEDDHEIMHPVF
SASA_PROMP      ----------------------------------------------------------------------
PDHS_BRUO2      ---------------KQALEAHVEELKTILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFF
VIRAL_RHIRD     ----------------------------------------------------------------------
LOVHK_PSESM     ---------------------------------------------IIFSNRAFLEMTGYTAEEILG----
SASA_SYNJB      ----------------------------------------------------------------------
SASA_NOSP7      ----------------------------------------------------------------------
SRRB_STAAR      GQLSQAQMSTEIEEHVDALSTSKNIRDSLINSMVEGVLGINESRQIILSNKMANDIMD-NIDE-------
SASA_PROMA      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------
SASA_THEEB      ----------------------------------------------------------------------
NTRYL_RICFE     ----------------------------------------------------------------------
LOVHK_PSEU2     ---------------------------------------------IIFANRAFLEMTGYASEEIIG----
SRRB_STAAW      GQLSQAQMSTEIEEHVDALSTSKNIRDSLINSMVEGVLGINESRQIILSNKMANDIMD-NIDE-------
SRRB_STAAU      GQLSQAQMSTEIEEHVDALSTSKNIRDSLINSMVEGVLGINESRQIILSNKMANDIMD-NIDE-------
SRRB_STAAS      GQLSQAQMSTEIEEHVDALSTSKNIRDSLINSMVEGVLGINESRQIILSNKMANDIMD-NIDE-------
SRRB_STAAC      GQLSQAQMSTEIEEHVDALSTSKNIRDSLINSMVEGVLGINESRQIILSNKMANDIMD-NIDE-------
SRRB_STAA8      GQLSQAQMSTEIEEHVDALSTSKNIRDSLINSMVEGVLGINESRQIILSNKMANDIMD-NIDE-------
SASA_SYNE7      ----------------------------------------------------------------------
SRRB_STAAN      GQLSQAQMSTEIEEHVDALSTSKNIRDSLINSMVEGVLGINESRQIILSNKMANDIMD-NIDE-------
SRRB_STAAM      GQLSQAQMSTEIEEHVDALSTSKNIRDSLINSMVEGVLGINESRQIILSNKMANDIMD-NIDE-------
MTRB_MYCLE      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------VLSGVGAGVIGLDSQERITILNRSAERLLGLSEVEALHR---
SASA_PROM0      ----------------------------------------------------------------------
SASA_SYNS3      ----------------------------------------------------------------------
MTRB_MYCPA      ----------------------------------------------------------------------
YCF26_PORYE     ------RLEKYEQQNVEKLTSEKAKLETLVSTIADGAILLDKDLRVILVNRTAIENFGWEGKDIAGSMII
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
NTRYL_RICCN     ----------------------------------------------------------------------
SASA_ANASP      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
SASA_ANAVT      ----------------------------------------------------------------------
NTRYL_RICTY     ----------------------------------------------------------------------
LUXQ_VIBPA      -----------LESTFEELEAQKRSFRDLFNFALSPIMVWSEAGVLIQINPAARKELVIENDIETMHPVF
PHOR_SHIDY      ------QMQLRNKKRRRELGNLIKRFRSGAESLPDAVVLTTEEGSIFWCNGLAQQILGLRWPEDNGQNIL
NTRB_PROVU      ----------------------LPDNTLILDSLIHSVLVINQEFIICYANHAALQVLAQSRRKLFETPFT
SASA_SYNS9      ----------------------------------------------------------------------
SASA_CYAP8      ----------------------------------------------------------------------
PHOR_KLEPN      ------QMQMRNKKRRRELGSLIKRFRSGAESLPDAVVLTTEEGAIFWCNGLAQQILNLRWPDDSGQNIL
YVRG_BACSU      ----------------------------------------------------------------------
PHOR_ECOLI      ------QMQLRNKKRRRELGNLIKRFRSGAESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPEDNGQNIL
ARCB_SHIFL      ----------------------------------------------------------------------
ARCB_ECOLI      ----------------------------------------------------------------------
ARCB_ECO57      ----------------------------------------------------------------------
YCF26_PORPU     ------RLEKYEQQNVEKLTSEKAKLETLVSTIADGAILLDKDLRVILVNRTAIENFGWEGKNIAGSIIV
SASA_MICAN      ----------------------------------------------------------------------
DSPA_SYNY3      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
PGTB_SALTY      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
CHVG_AGRT5      ----------------------------------------------------------------------
KDPD_ECOLI      ----------------------------------------------------------------------
DCTS_BACSU      ---------------------MYEERTATFHSMNEGVIAIDNRLVITIFNEKAKQIFEVQGD-LIGKVIW
LUXQ_VIBVU      -----------LENTFEQLESQRRSFQDLFNFALSPMMVWSESGLLIQMNPAAMKIEHASPQDF-SNPLF
RPRX_BACFR      ----------------------------------------------------------------------
LUXQ_VIBVY      -----------LENTFEQLESQRRSFQDLFNFALSPMMVWSESGLLIQMNPAAMKIEHASPQDF-SNPLF
DOKA_DICDI      ----------------------------------------------------------------------
BVGS_BORPE      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
SAES_STAAW      ----------------------------------------------------------------------
SAES_STAAS      ----------------------------------------------------------------------
SAES_STAAR      ----------------------------------------------------------------------
SAES_STAAN      ----------------------------------------------------------------------
SAES_STAAM      ----------------------------------------------------------------------
SAES_STAAE      ----------------------------------------------------------------------
SAES_STAAC      ----------------------------------------------------------------------
SAES_STAAB      ----------------------------------------------------------------------
SAES_STAA8      ----------------------------------------------------------------------
SAES_STAA3      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
CHVG_RHIME      ----------------------------------------------------------------------
DCTS_BACHD      ------------------LAHLLVERDASFNAIHEGVVAINKHEKITIMNEAARRMLGVK-EKAIGRNIH
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
CITS_BACHD      -----------------------QQKEAILQSIHEGVIAVNKEGKVTLFNQAAMKYVELDKEDVLGRHVT
VANS_ENTFC      ----------------------------------------------------------------------
RSSA_SERMA      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
NIFL_AZOVI      ----------------------------------------------------------------------
BAES_ECOLI      ----------------------------------------------------------------------
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
DCUS_SHIFL      ------------------ISTLFEQRQAMLQSIKEGVVAVDDRGEVTLINDAAQELLNYRKDEKLSTLSH
DCUS_ECOLI      ------------------ISTLFEQRQAMLQSIKEGVVAVDDRGEVTLINDAAQELLNYRKDEKLSTLSH
DCUS_ECOL6      ------------------ISTLFEQRQAMLQSIKEGVVAVDDRGEVTLINDAAQELLNYRKDEKLSTLSH
DCUS_ECO57      ------------------ISTLFEQRQAMLQSIKEGVVAVDDRGEVTLINDAAQELLNYRKDEKLSTLSH
GACS_PSESY      ----------------------------------------------------------------------
DLTS_STRA5      ----------------------------------------------------------------------
YKOH_BACSU      ----------------------------------------------------------------------
PHYB_ANASP      ----------------------------------------------------------------------
DLTS_STRA3      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
KDPD_CLOAB      ----------------------------------------------------------------------
MAK1_SCHPO      ----------------------------------------------------------------------
YCBM_BACSU      ----------------------------------------------------------------------
DIVL_CAUCR      ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
ENVZ_SALTI      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
ACOR_BACSU      ----------------------------------------------------------------------
TORS_ECOLI      ----------------------------------------------------------------------
ENVZ_SALTY      ----------------------------------------------------------------------
CITS_BACSU      ---------------------LYRERNAMLFAIREGIIATNREGVVTMMNVSAAEVIHLPIDDVMPGAG-
ARLS_STAS1      ----------------------------------------------------------------------
YCLK_BACSU      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
CUSS_ECOL6      ----------------------------------------------------------------------
ARLS_STAHJ      ----------------------------------------------------------------------
SILS_SALTY      ----------------------------------------------------------------------
PHOR_PSEAE      -------LQRRNQRARGRLQAVIDRIQESTAALRDAVIMLDSDGNLEWWNLAAENLLGLKTPQDGGQPVS
YFHK_ECOLI      ----------------------------------------------------------------------
MAK2_SCHPO      ----------------------------------------------------------------------
DHKL_DICDI      ------------------------------------VEIWDPSGHIQYLNLAFSEMTGFARWELLGKEFS
IRLS_BURPS      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
DHAR_CITFR      NSLLTDSL------LAESNRHLNQMYGLL-ESMDDGVMAWNEQGVLQFLNARAALLLHLDAQASQGKN--
CUSS_ECOLI      ----------------------------------------------------------------------
SPAK_BACSU      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
LUXN_VIBHB      ----------------------------------------------------------------------
LUXN_VIBHA      ----------------------------------------------------------------------
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
ARLS_STAES      ----------------------------------------------------------------------
ARLS_STAEQ      ----------------------------------------------------------------------
MPRB_MYCVP      ----------------------------------------------------------------------
CUSS_ECO57      ----------------------------------------------------------------------
AFSQ2_STRCO     ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
ENVZ_SHIFL      ----------------------------------------------------------------------
ENVZ_ECOLI      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
CQSS_VIBCH      ----------------------------------------------------------------------
YTH3_RHOER      SELR------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
BASS_SALTY      ----------------------------------------------------------------------
ARLS_STAAW      ----------------------------------------------------------------------
ARLS_STAAS      ----------------------------------------------------------------------
ARLS_STAAR      ----------------------------------------------------------------------
ARLS_STAAN      ----------------------------------------------------------------------
ARLS_STAAM      ----------------------------------------------------------------------
ARLS_STAAC      ----------------------------------------------------------------------
ARLS_STAAB      ----------------------------------------------------------------------
ARLS_STAA8      ----------------------------------------------------------------------
ARLS_STAA3      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
SP2AB_BACME     ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------------
ETR1_PELHO      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
PHOR_HAEIN      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
ETR1_ARATH      ----------------------------------------------------------------------
BCES_BACSU      ----------------------------------------------------------------------
QSEC_HAEIN      ----------------------------------------------------------------------
PFES_PSEAE      ----------------------------------------------------------------------
GRAS_STAHJ      ----------------------------------------------------------------------
RSTB_ECOLI      ----------------------------------------------------------------------
MPRB_MYCLE      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
YEDV_ECOLI      ----------------------------------------------------------------------
ETR1_BRAOL      ----------------------------------------------------------------------
GLNK_BACSU      ----------------------------------------------------------------------
DHAR_ECOLI      NLLLTDSL---LAETNRHLNQL----NALLESMDDGVISWDEQGNLQFINAQAARVLRLDATASQGR---
CZCS_RALME      ----------------------------------------------------------------------
YXDK_BACSU      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
MPRB_MYCSS      ----------------------------------------------------------------------
MPRB_MYCSK      ----------------------------------------------------------------------
MPRB_MYCSJ      ----------------------------------------------------------------------
MALK_BACSU      ------------------IATLLEERSAMLESTKEGILAVDEHGKIKLANAEAKRLFGINTNPID-----
KDPD_MYCTU      ----------------------------------------------------------------------
CQSS_VIBHB      ----------------------------------------------------------------------
PCOS_ECOLX      ----------------------------------------------------------------------
KDPD_RATRA      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
GRAS_STAAN      ----------------------------------------------------------------------
GRAS_STAAM      ----------------------------------------------------------------------
GRAS_STAA9      ----------------------------------------------------------------------
GRAS_STAA2      ----------------------------------------------------------------------
GRAS_STAA1      ----------------------------------------------------------------------
NISK_LACLA      ----------------------------------------------------------------------
ETR1_PASED      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
MPRB_MYCUA      ----------------------------------------------------------------------
HSSS_STAHJ      ----------------------------------------------------------------------
GRAS_STAAW      ----------------------------------------------------------------------
GRAS_STAAT      ----------------------------------------------------------------------
GRAS_STAAS      ----------------------------------------------------------------------
GRAS_STAAE      ----------------------------------------------------------------------
GRAS_STAAC      ----------------------------------------------------------------------
GRAS_STAAB      ----------------------------------------------------------------------
GRAS_STAA8      ----------------------------------------------------------------------
GRAS_STAA3      ----------------------------------------------------------------------
CITA_KLEPN      ----------------------------------------------------------------------
DPIB_ECOLI      LGILMAHIRRQMMGMEKQIARVVRQQEALFSSVYEGLIAVDPHGYITAINRNARKMLGLSSPQWLGKP--
BPHY_PSEAE      ----------------------------------------------------------------------
MPRB_MYCBP      ----------------------------------------------------------------------
MPRB_MYCBO      ----------------------------------------------------------------------
HSSS_STAAT      ----------------------------------------------------------------------
HSSS_STAAE      ----------------------------------------------------------------------
HSSS_STAAC      ----------------------------------------------------------------------
HSSS_STAA8      ----------------------------------------------------------------------
HSSS_STAA3      ----------------------------------------------------------------------
DHKG_DICDI      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
SP2AB_THETN     ----------------------------------------------------------------------
MPRB_MYCTU      ----------------------------------------------------------------------
MPRB_MYCTA      ----------------------------------------------------------------------
BASS_ECOLI      ----------------------------------------------------------------------
SP2AB_THEPX     ----------------------------------------------------------------------
SP2AB_THEP3     ----------------------------------------------------------------------
PHOQ_SHIFL      ----------------------------------------------------------------------
PHOQ_ECOLI      ----------------------------------------------------------------------
PHOQ_ECOL6      ----------------------------------------------------------------------
SP2AB_GEOTN     ----------------------------------------------------------------------
SP2AB_GEOKA     ----------------------------------------------------------------------
SP2AB_CLOPE     ----------------------------------------------------------------------
SP2AB_CLOP1     ----------------------------------------------------------------------
HSSS_STAAW      ----------------------------------------------------------------------
HSSS_STAAS      ----------------------------------------------------------------------
SP2AB_BACST     ----------------------------------------------------------------------
HSSS_STAAN      ----------------------------------------------------------------------
HSSS_STAAM      ----------------------------------------------------------------------
HSSS_STAA9      ----------------------------------------------------------------------
HSSS_STAA2      ----------------------------------------------------------------------
HSSS_STAA1      ----------------------------------------------------------------------
BPHY_DEIRA      ----------------------------------------------------------------------
SPHS_SYNE7      ----------------------------------------------------------------------
CSEC_STRCO      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
SP2AB_BACLD     ----------------------------------------------------------------------
SP2AB_ANOFW     ----------------------------------------------------------------------
HSSS_STAAB      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
SP2AB_BACWK     ----------------------------------------------------------------------
SP2AB_BACHK     ----------------------------------------------------------------------
SP2AB_BACCZ     ----------------------------------------------------------------------
SP2AB_BACCQ     ----------------------------------------------------------------------
SP2AB_BACC7     ----------------------------------------------------------------------
SP2AB_BACC3     ----------------------------------------------------------------------
SP2AB_BACC1     ----------------------------------------------------------------------
SP2AB_BACC0     ----------------------------------------------------------------------
SP2AB_BACAN     ----------------------------------------------------------------------
SP2AB_BACAH     ----------------------------------------------------------------------
SP2AB_BACAC     ----------------------------------------------------------------------
SP2AB_BACAA     ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
ACOR_RALEH      ----------------------------------------------------------------------
TCSA_EMENI      ----------------------------------------------------------------------
SP2AB_BACC4     ----------------------------------------------------------------------
SP2AB_BACC2     ----------------------------------------------------------------------
PHOQ_ECO57      ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
HSSS_STAAR      ----------------------------------------------------------------------
GRAS_STAES      ----------------------------------------------------------------------
GRAS_STAEQ      ----------------------------------------------------------------------
SP2AB_BACLI     ----------------------------------------------------------------------
CSEC_STRAW      ----------------------------------------------------------------------
LYTS_BACAN      ----------------------------------------------------------------------
DHKH_DICDI      ----------------------------------------------------------------------
LYTS_BACCR      ----------------------------------------------------------------------
SP2AB_BACCR     ----------------------------------------------------------------------
CSSS_BACSU      ----------------------------------------------------------------------
COPS_PSESM      ----------------------------------------------------------------------
SP2AB_CLOPS     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
REGB_RHOS4      ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
PHOQ_SALTY      ----------------------------------------------------------------------
PHOQ_SALTI      ----------------------------------------------------------------------
PHOQ_SALPA      ----------------------------------------------------------------------
PHOQ_SALCH      ----------------------------------------------------------------------
GRAS_STAS1      ----------------------------------------------------------------------
CNPD_PELLD      ---REAQLKKQLQDVRDTERKLQDQQKELDQAMTVGIRATELERIITEQNQRLESISNLQADE-------
QSEC_ECO57      ----------------------------------------------------------------------
NREB_STAAR      ----------------------------------------------------------------------
CHEA_THEMA      ----------------------------------------------------------------------
YQIR_BACSU      ------QLMEEKQHLIQMLKEQTYKYDRIFNSTHDGMIFIDINEEIILFNHMAEKMVGKKREEVIGRPIK
NREB_STAAW      ----------------------------------------------------------------------
NREB_STAAT      ----------------------------------------------------------------------
NREB_STAAS      ----------------------------------------------------------------------
NREB_STAAN      ----------------------------------------------------------------------
NREB_STAAM      ----------------------------------------------------------------------
NREB_STAAE      ----------------------------------------------------------------------
NREB_STAAC      ----------------------------------------------------------------------
NREB_STAAB      ----------------------------------------------------------------------
NREB_STAA9      ----------------------------------------------------------------------
NREB_STAA8      ----------------------------------------------------------------------
NREB_STAA3      ----------------------------------------------------------------------
NREB_STAA2      ----------------------------------------------------------------------
NREB_STAA1      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
TOP6B_ARCFU     ----------------------------------------------------------------------
HPRK_STAES      ------------------------------------------------------EIKEITKDELVGKP--
HPRK_STAEQ      ------------------------------------------------------EIKEITKDELVGKP--
HPRK_STAAW      ------------------------------------------------------EIRQINKDELIGKP--
HPRK_STAAT      ------------------------------------------------------EIRQINKDELIGKP--
HPRK_STAAS      ------------------------------------------------------EIRQINKDELIGKP--
HPRK_STAAR      ------------------------------------------------------EIRQINKDELIGKP--
HPRK_STAAN      ------------------------------------------------------EIRQINKDELIGKP--
HPRK_STAAM      ------------------------------------------------------EIRQINKDELIGKP--
HPRK_STAAE      ------------------------------------------------------EIRQINKDELIGKP--
HPRK_STAAC      ------------------------------------------------------EIRQINKDELIGKP--
HPRK_STAAB      ------------------------------------------------------EIRQINKDELIGKP--
HPRK_STAA9      ------------------------------------------------------EIRQINKDELIGKP--
HPRK_STAA8      ------------------------------------------------------EIRQINKDELIGKP--
HPRK_STAA3      ------------------------------------------------------EIRQINKDELIGKP--
HPRK_STAA2      ------------------------------------------------------EIRQINKDELIGKP--
HPRK_STAA1      ------------------------------------------------------EIRQINKDELIGKP--


                         .         *         .         .         .         .         +:350
query           CFSRCRRAEPLLIRSLKEANSFTNIECKCSNLLHEKYILVNISLLRDEKNAVSGAIGIYTDVTELRRQEA
ATOS_ECOLI      LFDNTQFYSPVL-DTLEHGTEHVALEISFPGRDRTIELSVTTSRIHNTHGEMIGALVIFSDLTARKETQR
KINC_BACSU      --------NDYFIKEKHVADHITQIQNKASSMFTAKYVTVHYKLYYDRDDQFTGSLGTMSDITERKEAED
KINE_BACSU      -------------------------------------------------------LAIFKDVTXXXXXXX
ZRAS_SALTI      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
KINA_BACSU      ---------------------------------------------------------ILRDISERKQTEE
KIND_BACSU      --------------------------------------------------------------TQLERSE-
ZRAS_ECOLI      ----------------------------------------------------------------------
PILS_PSEAE      --ASLGRHSPMLMHCMKQWRLNPSLRPPTLKVVPDGPTVQPISLNREDDQHV---LIFLEDISQIAQQA-
ZRAS_ECO57      ----------------------------------------------------------------------
KINB_BACSU      ------------------------------------------------------SIYIIESIAENIALRS
ZRAS_KLEOX      -------------------------------------------------------------------QEA
DEGM_BACB2      ---------------------------------------------------------------------A
NTRB_KLEOX      ----------------------------------------------------------------------
NTRB_SALTY      LLSYFSLNIDLMRESLAAGQGFTDNEVTLVIDSRSHILSLTAQRLPDDF--------ILLEMAPMDNQ--
NTRB_SALTI      LLSYFSLNIDLMRESLAAGQGFTDNEVTLVIDSRSHILSLTAQRLPDDF--------ILLEMAPMDNQ--
NTRB_VIBAL      QLIQHASLDALLTQPLQSGQSITDSDVTFVVDGRPLMLEVTVSPITWQKQLM--LLVEMRKIDQQRRLSQ
NTRB_SHIFL      ----------------------------------------------------------------------
NTRB_ECOLI      ----------------------------------------------------------------------
NTRB_ECO57      ----------------------------------------------------------------------
WALK_STAHJ      MLSVLNLEDEFSLDEIQENNDSFLLDINEDEGIIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
FIXL_BRAJA      ILDRSRHDSYISYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQA
NTRB_AZOBR      ELLPPNSPVSQLIEQVQQGRHRASQEGVVIDTIGPHHVTVRVTALGEPADHVLLTVN---ERTLARKIDN
VIRA_AGRT9      ----------------------------------------------------------YIDVRRKQTQAR
WALK_STAAE      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
FIXL_AZOC5      MLMPNPHRDQ---HDLYLSRYLTTGERRIIGIERKDGATFPMELAVGEMHSVSGRFGFIRDLTERQNTEA
VIRAW_RHIRD     ----------------------------------------------------------YIDVTECDVLAR
WALK_STAAW      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAAU      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAAT      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAAS      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAAR      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAAN      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAAM      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAAC      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAAB      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAA9      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAA8      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAA3      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAA2      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAA1      MLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
NTRB_RHOCA      IFARVRKNRSALFVNDVDLTTGERAPVQCN---------LQAAPIADDPETVLLLISP-REIADRLGRAS
NTRB_RHILP      -----------------------------------------------------GVVIVFQERSMADKIDR
NODV_BRAJA      -----------------------------------------------------GYRGVSTDITELRKAQA
DCTB_RHIME      --------------------------------------------LRMARDRLETEIADHRQTTELQAVQQ
WALK_STAES      MLGVLNLENEFSLEEIQE-----NSDSFLLDINEEEGIIVNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
WALK_STAEQ      MLGVLNLENEFSLEEIQE-----NSDSFLLDINEEEGIIVNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
NTRB_RHIME      AFIPFGSPLLTLIEQVRERRAAVNVDLSSPRLGADKLVDLYVAPVLSQPGSV---VIVFQERSMADKIDR
Y3689_SHEFN     VDNNVFKLKAAVLEVLSTQKSFT-----ADMRYQQQFWQLQIHPIANNQVVI-----LLEESTEQHRLRQ
WALK_STASR      DILNID--DDYSLDDLQENNDSFIIDINSEEGIIAR---VNFSTIIQDTGFINGYIAVLHDVTEQHILEN
VIRA_AGRT5      SLARAERASVFRIMSTRKAHKSTDQLIAICSLGYQGYRLKSVQLLELATACLCHYIDVRRKQTECDILER
WALK_STAS1      KVLKLE--EDFSLDEIQENNDSFLLDINENEGIIAR---VNFSTIVQETGFVTGYIAVLHDVTXXXXXXX
NTRB_BRASR      -------GSPLLIEQVRTSGSPVNVDLGTPRIGGDRQVDLHVAPLTERPGHIVVMLQERTIADKMDRQ--
PHOR_BACSU      DAFEHEE----VIQLVEDIFMTETKKCKLLRLIERRYFEVDGVPIMGPDDEWKGIVLVFHDMTETKKLEQ
YYCG_BACSU      --SLLGLQENYTFEDLVEQQDSMLLEIERDDEL--TVLRVNFSVIQREHGKIDGLIAVIYDVTEQEKMDQ
STC_CLOBE       -VDTVLDSWKHILQRLRNGQSYEDEEIMYSD--KKKRFNINVYPIKDKNSNITGMVGIFKDI--------
PDHS_OCHA4      AIESQRAAMDYLLSVLNDGREVIGREAKGGFIP----LFMTIGKLPHTR----GFCAVLRDITQWKRTEE
DCTB_RHILE      ---------------------------------------LDLSQARDRLQAE--IIGHKSTEQKLQAVQQ
NTRYL_RICBR     -------------------------------------------------------------IKQLSRQQR
SASA_CYAP7      ----------------------------------------------------------------------
RESE_BACSU      --KEGDNLPPEAKELFQNAVSTEKEQMIEMTLQGRSWVLLMSPLYAE--SHVRGAVAVLRDMTEERRLD-
DIVJ_CAUCR      -------------------------------------------------------VGVLRDITVERHREA
SASA_SYNY3      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
FIXL_RHIME      --------------------------------------------------------GFIRDLTEREESAA
SASA_CYAA5      ------------------------------------------SLLEKSSNVYSGELMRLSDIFRLKKDKE
PDHS_BRUSU      AIESQRAAMDYLLSVLNDGREVIGREAKGGFIP----LFMTIGKLPHTR----GFCAVLRDITQWKRTEE
PDHS_BRUSI      AIESQRAAMDYLLSVLNDGREVIGREAKGGFIP----LFMTIGKLPHTR----GFCAVLRDITQWKRTEE
PDHS_BRUME      AIESQRAAMDYLLSVLNDGREVIGREAKGGFIP----LFMTIGKLPHTR----GFCAVLRDITQWKRTEE
PDHS_BRUAB      AIESQRAAMDYLLSVLNDGREVIGREAKGGFIP----LFMTIGKLPHTR----GFCAVLRDITQWKRTEE
PDHS_BRUA2      AIESQRAAMDYLLSVLNDGREVIGREAKGGFIP----LFMTIGKLPHTR----GFCAVLRDITQWKRTEE
PDHS_BRUA1      AIESQRAAMDYLLSVLNDGREVIGREAKGGFIP----LFMTIGKLPHTR----GFCAVLRDITQWKRTEE
DCTS_RHOCA      ----------------------------------------------------------------------
PLEC_CAUCR      ------------------------------------------------QNAVAGLERSQEQLAELARETE
PDHS_BRUC2      AIESQRAAMDYLLSVLNDGREVIGREAKGGFIP----LFMTIGKLPHTR----GFCAVLRDITQWKRTEE
NTRY_AZOBR      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
MTRB_MYCTU      --------------------------------------------VRGEDDMARLAVSFNDMAESLSRQIA
MTRB_MYCBO      --------------------------------------------VRGEDDMARLAVSFNDMAESLSRQIA
LOVHK_PSE14     --TNCRETDRAVVQSIREADERVDISTEILNYRKDGSTFWNALFISPVYNDAGDLIYFFADISRRRDAED
SASA_SYNJA      ------------------------------------------------------------EVFSLRQERA
SASA_PROM2      ----------------------------------------------------------------------
NTRYL_RICPR     -------------------------------------------------------------IKQLSRQQR
LUXQ_VIBHA      QGFKEKLTPHLKMAA--QGATLTGVNVPIGNKIYRW----NLSPIRVDGD-ISGIIVQGQDITTLIEAEK
SASA_PROMP      ----------------------------------------------------------------------
PDHS_BRUO2      AIESQRAAMDYLLSVLNDGREVIGREAKGGFIP----LFMTIGKLPHTR----GFCAVLRDITQWKRTEE
VIRAL_RHIRD     -----------------------------------------VQLMELAAGCVSHYVVIRCKQTQRDILER
LOVHK_PSESM     --TNCRDTDPAVVQSIRDAIAQRNISAEIINYRKDGSSFWNALFISPVYNDAGDLIYFFADISRRKDAEE
SASA_SYNJB      ------------------------------------------------------------EVFLLRQERA
SASA_NOSP7      -----------------------------------------------------------------RLKQE
SRRB_STAAR      ------DAKAFLLRQIEDTFKSKQTEMRDLEMNTRFFVVTTSYIDKIEQGGKSGVVVTVRDMTN----EH
SASA_PROMA      ----------------------------------------------------------------------
KINB_PSEAE      -----------------------------------------------------GAVLVVRDVTEQRAFE-
SASA_THEEB      ------------------------------------------------------------ELFQLRQERD
NTRYL_RICFE     -------------------------------------------------------------IKQLSRQQR
LOVHK_PSEU2     --SNCRDTDRTAVQSIRDADQRVDISTEILNYRKDGSSFWNALFISPVYNDAGELIYFFADISRRRDAEE
SRRB_STAAW      ------DAKAFLLRQIEDTFKSKQTEMRDLEMNARFFVVTTSYIDKIEQGGKSGVVVTVRDMTN----EH
SRRB_STAAU      ------DAKAFLLRQIEDTFKSKQTEMRDLEMNTRFFVVTTSYIDKIEQGGKSGVVVTVRDMTN----EH
SRRB_STAAS      ------DAKAFLLRQIEDTFKSKQTEMRDLEMNARFFVVTTSYIDKIEQGGKSGVVVTVRDMTN----EH
SRRB_STAAC      ------DAKAFLLRQIEDTFKSKQTEMRDLEMNARFFVVTTSYIDKIEQGGKSGVVVTVRDMTN----EH
SRRB_STAA8      ------DAKAFLLRQIEDTFKSKQTEMRDLEMNARFFVVTTSYIDKIEQGGKSGVVVTVRDMTN----EH
SASA_SYNE7      ----------------------------------------------------------------------
SRRB_STAAN      ------DAKAFLLRQIEDTFKSKQTEMRDLEMNARFFVVTTSYIDKIEQGGKSGVVVTVRDMTN----EH
SRRB_STAAM      ------DAKAFLLRQIEDTFKSKQTEMRDLEMNARFFVVTTSYIDKIEQGGKSGVVVTVRDMTN----EH
MTRB_MYCLE      --------------------------------------------VRGEDDMARLAVSFNDMAESLSRQIT
NTRY_AZOC5      ---HLAEVVPETAGLLEEAEH-----------ARQRSVQGNITLTRDGRERVHGWVVTLDDITELI----
SASA_PROM0      ----------------------------------------------------------------------
SASA_SYNS3      -------------------------------------------LPRWQQDEVVSGLGLSLKPTELSRTQR
MTRB_MYCPA      ----------------------------------------------------------FNDMAELSRQIT
YCF26_PORYE     DYLPEDINQQLFLNDIVRKNFLEQSLCETQEICYKKTFRVLLTTVLDYKYSILKGIAI---TIQDRTEEV
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
NTRYL_RICCN     -------------------------------------------------------------IKQLSRQQR
SASA_ANASP      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
SASA_ANAVT      ----------------------------------------------------------------------
NTRYL_RICTY     -------------------------------------------------------------IKQLSRQQR
LUXQ_VIBPA      KGFKDKLVPHL--RMAAQGATLTGVNVP----IGDKVFRWNLSPIRVDGD-ISGIIVQGQDITTLIEAEK
PHOR_SHIDY      NLLRYPETQYLKTRDFSRPNTVRHLEIRVMPYTHKQLLMVA------------------RDVTQMHQLEG
NTRB_PROVU      LFSYHSFDAELMQETLANGQSFTDNEVIL--VIHNQSHTMSLSAQPISEQHILLELA---PMDXXXXXXX
SASA_SYNS9      ----------------------------------------------------------------------
SASA_CYAP8      ----------------------------------------------------------------------
PHOR_KLEPN      NLLRY----PEFANYLKQRDFSKPLNLVLNNARH---LEIRVMPYTDKQWLM-----VARDVTQMHQLEG
YVRG_BACSU      -------------------------------------------------------------LTETLRRDK
PHOR_ECOLI      NLLRYPETQYLKTRDFSRPNTGRHLEIRVMPYTHKQLLMVA------------------RDVTQMHQLEG
ARCB_SHIFL      -----------------------------------------------------GLMGFGRDITERKRYQD
ARCB_ECOLI      -----------------------------------------------------GLMGFGRDITERKRYQD
ARCB_ECO57      -----------------------------------------------------GLMGFGRDITERKRYQD
YCF26_PORPU     DYLPEDINQQLILNDIIRKNFLEQSICETQEICYKKTFRVLLTTVLDHKYSILKGIAM---TIQDRTQEV
SASA_MICAN      ----------------------------------------------------------------------
DSPA_SYNY3      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
PGTB_SALTY      ---------------------------------------------------------------DLRAMQD
BVGS_BORBR      ----------------------------------------------DSLGELKGIIGGWIDITERAELLR
BVGS_BORPA      ----------------------------------------------DSLGELKGIIGGWIDITERAELLR
CHVG_AGRT5      ----------------------------------------------------------------------
KDPD_ECOLI      -------------------------------------------------------------------EQA
DCTS_BACSU      EVLKDSRLPEIVERNKAVYNEEIRVSGK---------VIMSSRIPIVMKKKVIGAVAIFQDRTEAAKMA-
LUXQ_VIBVU      QLFKLKLSPHLKMAAQGATLTGINVP------IGEKIFRWNLSPIVVE-NGISGIIVQGQDITTLIDAEA
RPRX_BACFR      ----------------------------------------------------------------------
LUXQ_VIBVY      QLFKLKLSPHLKMAAQGATLTGINVP------IGEKIFRWNLSPIVVE-NGISGIIVQGQDITTLIDAEA
DOKA_DICDI      ------------------------------------------------------------DLSRYRQAEM
BVGS_BORPE      ----------------------------------------------DSLGELKGIIGGWIDITERAELLR
LUXQ_VIBCH      ----------------------------------------------------------------------
SAES_STAAW      --------------------------------------------------------------SEITQQMN
SAES_STAAS      --------------------------------------------------------------SEITQQMN
SAES_STAAR      --------------------------------------------------------------SEITQQMN
SAES_STAAN      --------------------------------------------------------------SEITQQMN
SAES_STAAM      --------------------------------------------------------------SEITQQMN
SAES_STAAE      --------------------------------------------------------------SEITQQMN
SAES_STAAC      --------------------------------------------------------------SEITQQMN
SAES_STAAB      --------------------------------------------------------------SEITQQMN
SAES_STAA8      --------------------------------------------------------------SEITQQMN
SAES_STAA3      --------------------------------------------------------------SEITQQMN
DHKD_DICDI      -----------------------------------------------------GELEIERKNNELRSLYE
CHVG_RHIME      ----------------------------------------------------------------------
DCTS_BACHD      --------EVIPDTKLPEILSIGKPLYQREFYIQGRLVFSNRIPIQIDGETV-GAIAIFQDKSDVDRLAE
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
CITS_BACHD      DLVKHTRLPEVLQVGKGQYDQELRI--------GDKQAVVNVPIYYDHE--IVGAVATFRDRNEIKKLSE
VANS_ENTFC      ---------------------------------------------------------------EKREQDA
RSSA_SERMA      -------------------------------------------------------------VMEVNKLMA
PHYA_ANASP      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
NIFL_AZOVI      ------------------------------------------------------------DISELRQQDS
BAES_ECOLI      ----------------------------------------------------------------------
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
DCUS_SHIFL      SWSQVVDVSEVLRDGTPRRDEEITIK--------DRLLLINTVPVRSN-GVIIGAISTFRDKTEVRKLMQ
DCUS_ECOLI      SWSQVVDVSEVLRDGTPRRDEEITIK--------DRLLLINTVPVRSN-GVIIGAISTFRDKTEVRKLMQ
DCUS_ECOL6      SWSQVVDVSEVLRDGTPRRDEEITIK--------DRLLLINTVPVRSN-GVIIGAISTFRDKTEVRKLMQ
DCUS_ECO57      SWSQVVDVSEVLRDGTPRRDEEITIK--------DRLLLINTVPVRSN-GVIIGAISTFRDKTEVRKLMQ
GACS_PSESY      ------RLPPLGSRELDEASGINRMAATLQNAQEE--LQLSIDQATEDVRQNLETIEIQNIELDLARKEA
DLTS_STRA5      ----------------------------------------------------------------------
YKOH_BACSU      ----------------------------------------------------------------------
PHYB_ANASP      ----------------------------------------------------------------------
DLTS_STRA3      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
KDPD_CLOAB      --------------------------------------------LRPQKKAVTGQIAIALD------REI
MAK1_SCHPO      -------------------------------------------------------LGTCTDILEEKLQES
YCBM_BACSU      -----------------------------------KDLLVNINLIVENRQQISA-------------QFA
DIVL_CAUCR      ----------------------------------------------------------------------
BARA_SHIFL      ---------------------------------------------------------------------A
BARA_ECOLI      ---------------------------------------------------------------------A
BARA_ECOL6      ---------------------------------------------------------------------A
BARA_ECO57      ---------------------------------------------------------------------A
ENVZ_SALTI      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
ACOR_BACSU      ----------------------------------------------------------------------
TORS_ECOLI      ----------------------------------------------------------------------
ENVZ_SALTY      ----------------------------------------------------------------------
CITS_BACSU      -----------LMSVLEKGEMLPNQEVS----VNDQVFIINTKVMNQGGQAY-GIVVSFREKTELKKLID
ARLS_STAS1      -----------------------------------------------------------TDNLIVTFNEM
YCLK_BACSU      ---------------------------------------------------------------EIERLEK
SENX3_MYCS2     -----------------------------------------VRLLTDDDRRF--AVVYIDDQSEHARMEA
CUSS_ECOL6      ----------------------------------------------------------------------
ARLS_STAHJ      ----------------------------------------------------------------------
SILS_SALTY      ----------------------------------------------------------------------
PHOR_PSEAE      NLIRHPRFKEYFDQ--EDYREPLEIPSPINERLRLQF---HITLYGNREHLM-----LVRDVTRVHQLEQ
YFHK_ECOLI      ----------------------------------------------------------------------
MAK2_SCHPO      -------------------------------------------------------------------KEA
DHKL_DICDI      NLIDNTEIIPNMWATLKTWNGFIRTRHNNNTLI---YFEASISPVLDQFQQILYYNCTKRDVTQKRDEES
IRLS_BURPS      ----------------------------------------------------------------------
ETR1_CUCSA      ---------------------------------------------------------------DLARREA
DHAR_CITFR      -INDLLNLPMLLRRAIKHARGLNHVE--------------------------------------------
CUSS_ECOLI      ----------------------------------------------------------------------
SPAK_BACSU      ----------------------------------------------------------------------
RPFC_XANCP      -------------------------------------------------------------------REA
RPFC_XANC8      -------------------------------------------------------------------REA
LUXN_VIBHB      --------------------------------------------------------------TLLTRVQS
LUXN_VIBHA      --------------------------------------------------------------TLLTRVQS
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
ARLS_STAES      ----------------------------------------------------------------------
ARLS_STAEQ      ----------------------------------------------------------------------
MPRB_MYCVP      ----------------------------------------------------------------------
CUSS_ECO57      ----------------------------------------------------------------------
AFSQ2_STRCO     ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
ENVZ_SHIFL      ----------------------------------------------------------------------
ENVZ_ECOLI      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
CQSS_VIBCH      ----------------------------------------------------------------------
YTH3_RHOER      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
BASS_SALTY      ----------------------------------------------------------------------
ARLS_STAAW      ----------------------------------------------------------------------
ARLS_STAAS      ----------------------------------------------------------------------
ARLS_STAAR      ----------------------------------------------------------------------
ARLS_STAAN      ----------------------------------------------------------------------
ARLS_STAAM      ----------------------------------------------------------------------
ARLS_STAAC      ----------------------------------------------------------------------
ARLS_STAAB      ----------------------------------------------------------------------
ARLS_STAA8      ----------------------------------------------------------------------
ARLS_STAA3      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
SP2AB_BACME     ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------LAHKDK
ETR1_PELHO      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
PHOR_HAEIN      ----------------------------------------------------------------------
GTCS_ANEMI      -------------------------------------------------------------VAHLEKTEA
ETR1_ARATH      ----------------------------------------------------------------------
BCES_BACSU      ----------------------------------------------------------------------
QSEC_HAEIN      ----------------------------------------------------------------------
PFES_PSEAE      ----------------------------------------------------------------------
GRAS_STAHJ      ---------------------------------------------------------------KLTSQKE
RSTB_ECOLI      ----------------------------------------------------------------------
MPRB_MYCLE      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
YEDV_ECOLI      ---------PLLIRTLREIKKLSGVEALNYNDSREP---VEVSALPRELKPLGQALN--------KMHHA
ETR1_BRAOL      ----------------------------------------------------------------------
GLNK_BACSU      ----------------------------------------------------------------------
DHAR_ECOLI      AITELLTLPAVLQQAIKQAHPLKHVE--------------------------------------------
CZCS_RALME      ----------------------------------------------------------------------
YXDK_BACSU      ----------------------------------------------------------------IRLQHQ
SENX3_MYCTU     ------------------------------------------------------AVVFVHDQSDYARMEA
SENX3_MYCBO     ------------------------------------------------------AVVFVHDQSDYARMEA
MPRB_MYCSS      -------------------------------------------------------------LTESRERQA
MPRB_MYCSK      -------------------------------------------------------------LTESRERQA
MPRB_MYCSJ      -------------------------------------------------------------LTESRERQA
MALK_BACSU      -----QDVDDILPKSLKKV-----IETK--KPLQDRDVRINLELVFNEKGQTVGAIATFRDKTEVKHLAE
KDPD_MYCTU      ----------------------------------------------------------------------
CQSS_VIBHB      ----------------------------------------------------------------------
PCOS_ECOLX      ----------------------------------------------------------------------
KDPD_RATRA      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
GRAS_STAAN      -------------------------------------------------------------------KEK
GRAS_STAAM      -------------------------------------------------------------------KEK
GRAS_STAA9      -------------------------------------------------------------------KEK
GRAS_STAA2      -------------------------------------------------------------------KEK
GRAS_STAA1      -------------------------------------------------------------------KEK
NISK_LACLA      --------------------------------------------------------------------EA
ETR1_PASED      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
MPRB_MYCUA      ----------------------------------------------------------------------
HSSS_STAHJ      ----------------------------------------------------------------------
GRAS_STAAW      -------------------------------------------------------------------KEK
GRAS_STAAT      -------------------------------------------------------------------KEK
GRAS_STAAS      -------------------------------------------------------------------KEK
GRAS_STAAE      -------------------------------------------------------------------KEK
GRAS_STAAC      -------------------------------------------------------------------KEK
GRAS_STAAB      -------------------------------------------------------------------KEK
GRAS_STAA8      -------------------------------------------------------------------KEK
GRAS_STAA3      -------------------------------------------------------------------KEK
CITA_KLEPN      ----------------------------------------------------------------------
DPIB_ECOLI      -----------IVEVVRPADFFTEIDEKRQDVVNGLSVIANREAIRSGDDLL-GAIISFRSKDEISTLNA
BPHY_PSEAE      ----------------------------------------------------------------------
MPRB_MYCBP      ----------------------------------------------------------------------
MPRB_MYCBO      ----------------------------------------------------------------------
HSSS_STAAT      ----------------------------------------------------------------------
HSSS_STAAE      ----------------------------------------------------------------------
HSSS_STAAC      ----------------------------------------------------------------------
HSSS_STAA8      ----------------------------------------------------------------------
HSSS_STAA3      ----------------------------------------------------------------------
DHKG_DICDI      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
SP2AB_THETN     ----------------------------------------------------------------------
MPRB_MYCTU      ----------------------------------------------------------------------
MPRB_MYCTA      ----------------------------------------------------------------------
BASS_ECOLI      ----------------------------------------------------------------------
SP2AB_THEPX     ----------------------------------------------------------------------
SP2AB_THEP3     ----------------------------------------------------------------------
PHOQ_SHIFL      ------------------------------------------------------------ELTSLVRNLN
PHOQ_ECOLI      ------------------------------------------------------------ELTSLVRNLN
PHOQ_ECOL6      ------------------------------------------------------------ELTSLVRNLN
SP2AB_GEOTN     ----------------------------------------------------------------------
SP2AB_GEOKA     ----------------------------------------------------------------------
SP2AB_CLOPE     ----------------------------------------------------------------------
SP2AB_CLOP1     ----------------------------------------------------------------------
HSSS_STAAW      ----------------------------------------------------------------------
HSSS_STAAS      ----------------------------------------------------------------------
SP2AB_BACST     ----------------------------------------------------------------------
HSSS_STAAN      ----------------------------------------------------------------------
HSSS_STAAM      ----------------------------------------------------------------------
HSSS_STAA9      ----------------------------------------------------------------------
HSSS_STAA2      ----------------------------------------------------------------------
HSSS_STAA1      ----------------------------------------------------------------------
BPHY_DEIRA      ---------------------------------------------QDLRDTLTGALGERLSVIDLNRALT
SPHS_SYNE7      ----------------------------------------------------------------------
CSEC_STRCO      ------------------------------------------------RDAIGGVVRDETXXXXXXXXXX
TCSB_EMENI      ----------------------------------------------------------------------
SP2AB_BACLD     ----------------------------------------------------------------------
SP2AB_ANOFW     ----------------------------------------------------------------------
HSSS_STAAB      ----------------------------------------------------------------------
DHKI_DICDI      -----------------------------------------------------GAFVALHDITERKRNEV
SP2AB_BACWK     ----------------------------------------------------------------------
SP2AB_BACHK     ----------------------------------------------------------------------
SP2AB_BACCZ     ----------------------------------------------------------------------
SP2AB_BACCQ     ----------------------------------------------------------------------
SP2AB_BACC7     ----------------------------------------------------------------------
SP2AB_BACC3     ----------------------------------------------------------------------
SP2AB_BACC1     ----------------------------------------------------------------------
SP2AB_BACC0     ----------------------------------------------------------------------
SP2AB_BACAN     ----------------------------------------------------------------------
SP2AB_BACAH     ----------------------------------------------------------------------
SP2AB_BACAC     ----------------------------------------------------------------------
SP2AB_BACAA     ----------------------------------------------------------------------
DHKJ_DICDI      --------------------------------------------------------------TTLKNTLA
ACOR_RALEH      ----------------------------------------------------------------------
TCSA_EMENI      -----------------------------------------------------GFVKVTRDLTERKEAEA
SP2AB_BACC4     ----------------------------------------------------------------------
SP2AB_BACC2     ----------------------------------------------------------------------
PHOQ_ECO57      ------------------------------------------------------------ELTSLVRNLN
SLN1_YEAST      ----------------------------------------------------------------------
HSSS_STAAR      ----------------------------------------------------------------------
GRAS_STAES      ------------------------------------------------------------------QKEK
GRAS_STAEQ      ------------------------------------------------------------------QKEK
SP2AB_BACLI     ----------------------------------------------------------------------
CSEC_STRAW      -------------------------------------------VVRDETDDLARAVDAMADALQQRIEAE
LYTS_BACAN      ----------------------------------------------------------------------
DHKH_DICDI      -------------------------------------------------------IGTCTDVNDQKTAQD
LYTS_BACCR      ----------------------------------------------------------------------
SP2AB_BACCR     ----------------------------------------------------------------------
CSSS_BACSU      ----------------------------------------------------------------------
COPS_PSESM      ----------------------------------------------------------------------
SP2AB_CLOPS     ----------------------------------------------------------------------
SEX3_MYCLE      ------------------------------------------------------AVVFVHDQSDYVRMEA
REGB_RHOS4      ----------------------------------------------------------------LATQMA
QSEC_SALTY      ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
PHOQ_SALTY      ----------------------------------------------------------------------
PHOQ_SALTI      ----------------------------------------------------------------------
PHOQ_SALPA      ----------------------------------------------------------------------
PHOQ_SALCH      ----------------------------------------------------------------------
GRAS_STAS1      ---------------------------------------------------------------QITNQKA
CNPD_PELLD      ----------------------------------------------------------------------
QSEC_ECO57      ----------------------------------------------------------------------
NREB_STAAR      ----------------------------------------------------------------------
CHEA_THEMA      ----------------------------------------------------------------------
YQIR_BACSU      EVIPSTKMPRILKTRVPEYNQ--------KQLLGDHLQIVTTRLIIDEGGRLLGALCVFKDITELAEEVT
NREB_STAAW      ----------------------------------------------------------------------
NREB_STAAT      ----------------------------------------------------------------------
NREB_STAAS      ----------------------------------------------------------------------
NREB_STAAN      ----------------------------------------------------------------------
NREB_STAAM      ----------------------------------------------------------------------
NREB_STAAE      ----------------------------------------------------------------------
NREB_STAAC      ----------------------------------------------------------------------
NREB_STAAB      ----------------------------------------------------------------------
NREB_STAA9      ----------------------------------------------------------------------
NREB_STAA8      ----------------------------------------------------------------------
NREB_STAA3      ----------------------------------------------------------------------
NREB_STAA2      ----------------------------------------------------------------------
NREB_STAA1      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
TOP6B_ARCFU     ----------------------------------------------------------------------
HPRK_STAES      ---------PKLIEHLLEIRGLGIINVMAGSILTEKQIRLNINLENWNKNKLYDRVGLNEETTEITKKTI
HPRK_STAEQ      ---------PKLIEHLLEIRGLGIINVMAGSILTEKQIRLNINLENWNKNKLYDRVGLNEETTEITKKTI
HPRK_STAAW      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI
HPRK_STAAT      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI
HPRK_STAAS      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI
HPRK_STAAR      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI
HPRK_STAAN      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI
HPRK_STAAM      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI
HPRK_STAAE      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI
HPRK_STAAC      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI
HPRK_STAAB      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI
HPRK_STAA9      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI
HPRK_STAA8      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI
HPRK_STAA3      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI
HPRK_STAA2      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI
HPRK_STAA1      ---------PKLIEHLLEIRGLGIINVMAGSILTEKRIRLNINLENWNKQKLYDRVGLNEETTEITKKTI


                         .         .         .         .         *         .         .:420
query           RIREQEKLAVVGQMAAGMAHEIRNPLTSVRGFAQLMSEKMAEEQNPYKEFMEIMIQEIDQADSFINNFLQ
ATOS_ECOLI      RMAQAERLATLGELMAGVAHEVRNPLTAIRGYVQILRQQTSDP--IHQEYLSVVLKEIDSINKVIQQLLE
KINC_BACSU      ELRESQKLSITSELAAGIAHEVRNPLTSVSGFLQIMKTQYPDR----KDYFDIIFSEIKRIDLVLSELLL
KINE_BACSU      XXXXSDTLHVVGELAAGIAHEIRNPMTALKGFIQLLKGSV---EGDYALYFNVITSELKRIESIITEFLI
ZRAS_SALTI      -MKRKEKLVAMGHLAAGVAHEIRNPLSSIKGLAKYFAERTPAGGESH-ELAQVMAKEADRLNRVVSELLE
ZRAS_SALTY      -MKRKEKLVAMGHLAAGVAHEIRNPLSSIKGLAKYFAERTPAGGESH-ELAQVMAKEADRLNRVVSELLE
KINA_BACSU      LMLKSEKLSIAGQLAAGIAHEIRNPLTAIKGFLQLMKPTMEGNEH----YFDIVFXXXXXXXXXXXXXXX
KIND_BACSU      --NEAQKLELIGTLAASTAHEIRNPLTGISGFIQLLQKKYKGEEDQL--YFSIIEQEIKRINQIVSEFLV
ZRAS_ECOLI      -MKRKEKXXXXXXXXXXXXXEIRNPLSSIKGLAKYFAER-APAGGEAHQLAQVMAKEADRLNRVVSELLE
PILS_PSEAE      ---QQMKLAGLGRLTAGIAHEIRNPLGAISHAAQLLQES-EELDAPDRRLTQIIQDQSKRMNLVIENVLQ
ZRAS_ECO57      -MKRKEKXXXXXXXXXXXXXEIRNPLSSIKGLAKYFAER-APAGGEAHQLAQVMAKEADRLNRVVSELLE
KINB_BACSU      QLIHSEKMTIVSELAASVAHEVRNPLTVVRGFVQLLFNDETLQNKSSADYKKLVLSELDRAQGIITNYLD
ZRAS_KLEOX      TARK-EKXXXXXXXXXXXXXEIRNPLSSIKGLAKYFAERTPADGEAHQLAL-VMAREADRLNRVVSELLE
DEGM_BACB2      ELVATEKDFTKGELAASIAHEVRNPLTVVKGFVQLLSE-----DKQHAEYHKLILSELDRAESIIYEFLN
NTRB_KLEOX      ----QEQLQHAQQIAAGLAHEIKNPLGGLRGAAQLLSKAL-----PDPALMEYTKVIIEQADRLRNLVDR
NTRB_SALTY      RRLSQEQLQHAQQIAAGLAHEIKNPLGGLRGAAQLLSKALPDPA--LTEYTKVIIEQADRLRNLVDRLLG
NTRB_SALTI      RRLSQEQLQHAQQIAAGLAHEIKNPLGGLRGAAQLLSKALPDPA--LTEYTKVIIEQADRLRNLVDRLLG
NTRB_VIBAL      ELNQHAQQQAAKLLVRGLAHEIKNPLGGLRGAAQLL-EKMLPDPS-LTEYTHIIIEQXXXXXXXXXXXX-
NTRB_SHIFL      ----QEQLQHAQQVAAGLAHEIKNPLGGLRGAAQLLSKAL-----PDPSLLEYTKVIIEQADRLRNLVDR
NTRB_ECOLI      ----QEQLQHAQQVAAGLAHEIKNPLGGLRGAAQLLSKAL-----PDPSLLEYTKVIIEQADRLRNLVDR
NTRB_ECO57      ----QEQLQHAQQVAAGLAHEIKNPLGGLRGAAQLLSKAL-----PDPSLLEYTKVIIEQADRLRNLVDR
WALK_STAHJ      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGVWKDDNLAPSFLSVTREETERMIRLVNDLLQ
FIXL_BRAJA      RLQELQRLSAMGEMASALAHELNQPLAAISNYMKGSRRLLAGSSDPNTPKVESALEQALRAGQIIRRLRD
NTRB_AZOBR      SLTHRNAARSVTAMASMLGHEVKNPLSGIRGAAQLLEENCSESD---RVLTRLICDEADRIVALVNRMEV
VIRA_AGRT9      RLEHAQRLEAVGTLAGGIAHEFNNILGSILGHAEL-AQNSVSRTSVTRRYIDYIISSGDRAMLIIDQILT
WALK_STAAE      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
FIXL_AZOC5      RLQELQRLTALGEMASTLAHELNQPLSAIANYIK-GSRRLLDDGDPKRIPMDKAAEQALRAGQIIRRLRD
VIRAW_RHIRD     RLEHAQRLEAVGTLAGGIAHEFNNILGSILGHAEL-AQNSVSRTSVTRRYIDYIISSGDRAMLIIDQILT
WALK_STAAW      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
WALK_STAAU      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
WALK_STAAT      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
WALK_STAAS      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
WALK_STAAR      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
WALK_STAAN      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
WALK_STAAM      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
WALK_STAAC      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
WALK_STAAB      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
WALK_STAA9      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
WALK_STAA8      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
WALK_STAA3      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
WALK_STAA2      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
WALK_STAA1      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQ
NTRB_RHOCA      MVKSAARSAGIG-MAEMLAHEIKNPLAGIAGAAQLLSMGLSGED---LELTDLIVDETRRIVKLLEQVEQ
NTRB_RHILP      QLTHRAAARSVTGLASSLAHEIKNPLSGNRGAAQLLEQSVIDDD---RALTRLICDETDRIVSLVDRMEV
NODV_BRAJA      ELAHVTRVTTLGEMTTSIAHEITQPLAAILSNADACLGWMARDVPNLRSSVEWIIEDAIRASEVIRSIRA
DCTB_RHIME      DLVQANRLAILGQVAAGVAHEINQPVATIRAYADNARTFLHRGQTTAAENMESIAELTERVGAITDELRR
WALK_STAES      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWQDKELAPSFLSVTREETERMIRLVNDLLQ
WALK_STAEQ      XXXX---------FVANVSHELRTPLTSMNSYIEALEEGAWQDKELAPSFLSVTREETERMIRLVNDLLQ
NTRB_RHIME      QLTHRAAARSVTGLASMLAHEIKNPLSGIRGAAQLLETSVNDED---RSLTRLICDETDRIVSLVDRMEV
Y3689_SHEFN     ANEEASRLASLGELSAGIAHEINNPVHAVSLFTAAMKDKHYQKQNPFWLIADIAIEELQYSSRIVNDLKR
WALK_STASR      ERRE---------FVANVSHELRTPLTSMRSYIEALEEGAWRDPEVAPTFLNVTREETDRMIRLVNDLLQ
VIRA_AGRT5      RLEHAERLQAVGTLAGGIAHEFNNILGAILGYAE-MAQNMLRRSSVTRRHIDQIISSGDRARLIIDQILT
WALK_STAS1      XXXX---------FVANVSHELRTPLTSMNSYIEALESGAWKDGELAPQFLSVTREETERMIRLVNDLLQ
NTRB_BRASR      -LTHRSAARSVIALAAMLAHEIKNPLSGIRGAAQLLEQQASSED---RLLTRLICDEADRIVTLVDRMEV
PHOR_BACSU      MRKD---------FVANVSHELKTPITSIKGFTETLLDGAMEDKEALSEFLSIILKESERXXXXXNFTLS
YYCG_BACSU      ERRE---------FVANVSHELRTPLTTMRSYLEALAEGAWENKDIAPRFLMVTQNETERMIRLVNDLLQ
STC_CLOBE       ----------------------------------------------------------------------
PDHS_OCHA4      ELTNARKEAERAEFLARISHEIRTPLNAIIGFSELMAEKFGSIGNDYRDYLRDINRSGNHVLALVNDLLD
DCTB_RHILE      DLVQANRLAILGQVAAGVAHEINQPVATIRAYADNARTFLDRGQTPAGENLESIAALTERIGSITEELKT
NTRYL_RICBR     DLVIAQRALAWSDVAKKVAHEIKNPLTPILLASERLLKKFSKERAEFENYLKMIIRHTNDIKNIVSEFVL
SASA_CYAP7      ------------QVLAMLAHDLRSPLTAASIAVETLEEQLYQQTRKQFRIMNRLITDILQASKSINAXXX
RESE_BACSU      KLRE--------DFIANVSHELRTPISMLQGYSEAIVDDIASSEEDRKEIAQIIYDESLRMGRLVNDLLD
DIVJ_CAUCR      RIDAEALAAGRARFLANMSHELRTPLNAIMGFSDIMRARMGPLSDRYAEYAELIHESGGHLLDLINDVLD
SASA_SYNY3      ------------QILAMLAHDLRSPLTAASDTLELLQHKPIEEQKPAKQFMDRLIEDILQASKNLNSQFQ
SASA_PROMM      -----------------VAHELRTPLTAA--VLALQSQQLG--QINIEHFQDVVKRRLDEIELLSKDLLE
FIXL_RHIME      RLEQIQRLNEMGEMASTLAHELNQPLSAIHGCTRLLRDMDDAVATRIREALEEVASQSLRAGQIIKHLRE
SASA_CYAA5      NLQEQLKFK--DQVLAMLAHDLRSPLTAASIAVETL--ELAKNQDPTEKQQKLTAQLFNQTNRLITDILQ
PDHS_BRUSU      ELTNARKEAERAEFLARISHEIRTPLNAIIGFSELMAEKFGPIGNDYRDYLRDINRSGNHVLALVNDLLD
PDHS_BRUSI      ELTNARKEAERAEFLARISHEIRTPLNAIIGFSELMAEKFGPIGNDYRDYLRDINRSGNHVLALVNDLLD
PDHS_BRUME      ELTNARKEAERAEFLARISHEIRTPLNAIIGFSELMAEKFGPIGNDYRDYLRDINRSGNHVLALVNDLLD
PDHS_BRUAB      ELTNARKEAERAEFLARISHEIRTPLNAIIGFSELMAEKFGPIGNDYRDYLRDINRSGNHVLALVNDLLD
PDHS_BRUA2      ELTNARKEAERAEFLARISHEIRTPLNAIIGFSELMAEKFGPIGNDYRDYLRDINRSGNHVLALVNDLLD
PDHS_BRUA1      ELTNARKEAERAEFLARISHEIRTPLNAIIGFSELMAEKFGPIGNDYRDYLRDINRSGNHVLALVNDLLD
DCTS_RHOCA      ------RLVTLGEMASTLAHELNQPLAAIASYAANLFDQPEPNLTMLRQAFEKMGAQARRAGLVIRRVQD
PLEC_CAUCR      KVKAESANKAKSEFLANMSHELRTPLNAINGFSEIMMNEMFGPDQRYKGYSQDIHSSGQHLLALINDILD
PDHS_BRUC2      ELTNARKEAERAEFLARISHEIRTPLNAIIGFSELMAEKFGPIGNDYRDYLRDINRSGNYVLALVNDLLD
NTRY_AZOBR      ---------------------VKNPLTPIQLSAEPCAASTLKEITSDTEVFDTIVRQVDDIRRMVDEFSA
SASA_PROM3      -----------------VAHELRTPLTAA--VLALQSQQLG--QINIEHFQDVVKRRLDEIELLSKDLLE
MTRB_MYCTU      QLEEFGNLQ--RRFTSDVSHELRTPLTTVRMAADLIYDHSADLDPTLRRSTELMVSELDRFETLLNDLLE
MTRB_MYCBO      QLEEFGNLQ--RRFTSDVSHELRTPLTTVRMAADLIYDHSADLDPTLRRSTELMVSELDRFETLLNDLLE
LOVHK_PSE14     ALRQAQKMEALGQLTGGIAHDFNNLLQVMGGYIDLIAEKPTIDVQRVQRSVHHAKSAVERASTLTKQLLA
SASA_SYNJA      QLREQ--LDFKDRVLAMLVHDLRSPLTATALAVETLQQEGSLDKAVERQLFEHARQQLRKMDSMITDILE
SASA_PROM2      RIESQERLLRM------VAHELRTPLTAAT--LAIQSQKLG--QIDISKLQEVIKRRLEEIELLSQDLLE
NTRYL_RICPR     DLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERLLKKFSSEINEKSEFLKMIIRHTNDIKNIVSEFVL
LUXQ_VIBHA      QSREAEKSAQAADFLAKMSHEIRTPINGILGVAQLLKDSVDTQEQ--KNQIDVLCHSGEHLLAVLNDILD
SASA_PROMP      RIESQERLLRM------VAHELRTPLTAAT--LAIQSQKLG--QIDIKKLQDVIKRRLEEIELLSQDLLE
PDHS_BRUO2      ELTNARKEAERAEFLARISHEIRTPLNAIIGFSELMAEKFGPIGNDYRDYLRDINRSGNHVLALVNDLLD
VIRAL_RHIRD     RLKHAERLEAVGTLAGGIAHEFNNILGVILGYA--MAQNILHRRTYARHYIDRINAESNRARLIIDQILA
LOVHK_PSESM     ALRQAQKMEALGQLTGGIAHDFNNLLQVMGGYIDLIAEKPVIDVQRVQRSVYHAKSAVERASTLTKQLLA
SASA_SYNJB      QLREQ--LDFKDRVLAMLVHDLRSPLTATALAVETLQQEGSLDKALERQLFDHARQQLRKMDSMITDILE
SASA_NOSP7      KDNLQEQLQFKDRVIAMLAHDLRNPLTAAAIAIETLQSNYNLETGEFQRLKPSMTAHLKQADRMITDLLQ
SRRB_STAAR      NLDQMKK-----DFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAIVLDESKXXXXXXXXXXX
SASA_PROMA      ------------------------------------------------KLQEVVKRRLEEIESLSKDLLE
KINB_PSEAE      RVRSEFVLRA--------SHELRTPVTGMQMAFSLLRERLDPAESREADLIQTVDEEMSRLVLLINDLLN
SASA_THEEB      RLAEQ--LQFKDRIISLLAHELRNPLTAGGIALETLESNLQEEQLPIEDIQRLFHHARSQTQTMITDLLL
NTRYL_RICFE     DLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERLLKKFSKEKEEFENYLKMIIRHTNDIKNIVSEFVL
LOVHK_PSEU2     ALRQAQKMEALGQLTGGIAHDFNNLLQVMGGYIDLIAEKPVIDVQRVQRSVHHAKSAVERASTLTKQLLA
SRRB_STAAW      NLDQMKK-----DFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAIVLDESKXXXXXXXXXXX
SRRB_STAAU      NLDQMKK-----DFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAIVLDESKXXXXXXXXXXX
SRRB_STAAS      NLDQMKK-----DFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAIVLDESKXXXXXXXXXXX
SRRB_STAAC      NLDQMKK-----DFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAIVLDESKXXXXXXXXXXX
SRRB_STAA8      NLDQMKK-----DFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAIVLDESKXXXXXXXXXXX
SASA_SYNE7      -----ERTKFLEQVIALVAHDLRNPLTAIQIRSQSFSVATAKEMQGLCSLFDQARSQLREIERMIAEILE
SRRB_STAAN      NLDQMKK-----DFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAVVLDESKXXXXXXXXXXX
SRRB_STAAM      NLDQMKK-----DFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAVVLDESKXXXXXXXXXXX
MTRB_MYCLE      QLEEFGNLQ--RRFTSDVSHELRTPLTTVRMAADLIYDHSSDLDPTLRRSTELMVSELDRFETLLNDLLE
NTRY_AZOC5      ---SAQRTSAWADVARRIAHEIKNPLTPIQLSAERLKRKVTQDREIFDQCTDTIIRQVGDIGRMVDEFSS
SASA_PROM0      RIESQERLLRM------VAHELRTPLTAATLAVQ--SQKLG--QIDISKLQEVIKRRLEEIELLSQDLLE
SASA_SYNS3      ELQLEDQLLVLRQLLRMVAHELRTPLTA----ATLAVQSQELGQIDIHRFRDVLKRRLEEIALLSKDLLE
MTRB_MYCPA      QLEEFGNLQ--RRFTSDVSHELRTPLTTVRMAADLIYDHSADLDPTLARSTELMVNELDRFESLLNDLLE
YCF26_PORYE     ELNE-----VKNQFISNVSHELRTPLFNIRSFLETLYEYHDSLDNRQKEFLAIANKETERLTRLVNDVLD
SASA_PROMS      RIESQERLLRM------VAHELRTPLTAATLAVQ--SQKLG--QIDISKLQEVIKRRLEEIELLSQDLLE
SASA_PROM9      RIESQERLLRM------VAHELRTPLTAATLAVQ--SQKLG--QIDIAKLQEVIKRRLEEIELLSQDLLE
NTRYL_RICCN     DLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERLLKKFSKERVEFENYLKMIIRHTNDIKNIVSEFVL
SASA_ANASP      ------------RVIAMLVHDLRNPLTA----AAIAIETLQSNYNPIGQFQRLVVNLLRQADKMIADLLQ
SASA_SYNPX      -------------------------------------------------FQDVITRRLEEMEALSKDLLE
SASA_ANAVT      ------------RVIAMLVHDLRNPLTA----AAIAIETLQSNYNPIGQFQRLVVNLLRQADKMIADLLQ
NTRYL_RICTY     DLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERLLKKFSAEKSEFESYLKMIIRHTNDIKNIVSEFVL
LUXQ_VIBPA      QSREAEKSAQAADFLAKMSHEIRTPINGILGVAQLLKDSVAEEQ---KNQIDVLRHSGEHLLAVLNDILD
PHOR_SHIDY      ARRN---------FFANVSHELRMPLTVLQGYLEMMDEQPLEGAVREKA-LHTMREQTQRMEGLVKQLLT
NTRB_PROVU      XXXXXXXXXXXXXXVRGLAHEIKNPXXXXXXXXXXXXKSLPDPA--LTEYTQVIIEQADRLRTLVDRLLG
SASA_SYNS9      -------------------------------------------------FQDVVTRRLEEMEALSKDLLE
SASA_CYAP8      ---------------AMLAHDLRSPLTAASIAVETL--ELTQKQEDTERRAQLREQLYHQANRLITDILQ
PHOR_KLEPN      ARRN---------FFANVSHELRTPLTVLQGYLEMMQEQVLEGATREKA-LHTMREQTQRMEGLVKQLLT
YVRG_BACSU      RNREKIQ-ATREEWIAGLSHDLKTPLSSIYGYSMMLESKQYDSPEEVKEMGQVVREKSEYMSKLIEDLNL
PHOR_ECOLI      ARRN---------FFANVSHELRTPLTVLQGYLEMMNEQPLEGAVREKA-LHTMREQTQRMEGLVKQLLT
ARCB_SHIFL      ALERASRDKTT--FISTISHELRTPLNGIVGLSRLLDTELTAEQEKYLKTIHVSAVTLG---NIFNDIID
ARCB_ECOLI      ALERASRDKTT--FISTISHELRTPLNGIVGLSRLLDTELTAEQEKYLKTIHVSAVTLG---NIFNDIID
ARCB_ECO57      ALERASRDKTT--FISTISHELRTPLNGIVGLSRLLDTELTAEQEKYLKTIHVSAVTLG---NIFNDIID
YCF26_PORPU     ELNE-----IKNQFISNVSHELRTPLFNIRSFLETLYEYHDSLDDSQKEFLAIANKETGRLTRLVNDVLD
SASA_MICAN      ------------QILAMLAHDLRSPLTAASIAVETLEEQLHQQARKQFRIMNRLITDILQASKSMAAQFT
DSPA_SYNY3      --REVELNEAKSQFISNVSHELRTPLFNIKSFIETLSEDLSEVER--KEFLETANHETDRLSRLVNDVLD
Y1002_RHIME     ---------------AAVSHELRTPLNAILGFSDVLAGEYFGENDRQREYVSLIHQSGTHLLSVVNTMLD
PGTB_SALTY      ELIQTAKLAVVGQTMTTLAHEINQPLNALSMYLFTAGRAIEQGQSGQARNTEGLINRIDAIIRSLRQFTR
BVGS_BORBR      ELHDAKESADAANRAATMSHEIRTPMNAIIGMLELALLRPAD-QEPDRQSIQVAYDSARSLLELIGDILD
BVGS_BORPA      ELHDAKESADAANRAATMSHEIRTPMNAIIGMLELALLRPAD-QEPDRQSIQVAYDSARSLLELIGDILD
CHVG_AGRT5      -----DRIDAIESFAADVSHELKNPLTSLRSAVETLPRAKTEESK--QRLTEIIFHDVRRLDRLISDISD
KDPD_ECOLI      RMAS-EREQIRNALLAALSHDLRTPLTVLFGQAEILTLDLASEGSPHARQASEIRQHXXXXXXXXXXXXD
DCTS_BACSU      -----EELTGVRNFVEALRHEHMNKLHTIAGLIQLGKSEKA---------LQLAFQASTEQEN-VTEFLH
LUXQ_VIBVU      RREAEQSAKTRADFLAKMSHEIRTPLNGILGIAQLLKRSVNDAENLKQ--VDVLCNSGEHLLAVLNDILD
RPRX_BACFR      --RQKKLTEMKNDFINNMTHEFKTPISTISLAAQMLKDPVGKSPQMFQHISGVINDETKRLRFQVEKVLQ
LUXQ_VIBVY      RREAEQSAKTRADFLAKMSHEIRTPLNGILGIAQLLKRSVNDAENLKQ--VDVLCNSGEHLLAVLNDILD
DOKA_DICDI      AAIEATRLKT--QFITNISHELRTPCHGIVGMSQLLLD--SQLTNTQRDNIDSIKRSTDSLISLINDILD
BVGS_BORPE      KLHDAKESADAANRAATMSHEIRTPMNAIIGMLELALLRPTD-QEPDRQSIQVAYDSARSLLELIGDILD
LUXQ_VIBCH      ---------------AKMSHELRTPLNGVLGVSQLLKRTPLNDEQ--REHVAVLCSSGEHLLAVLNDILD
SAES_STAAW      QIKSEQQEKT--ELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDMLN
SAES_STAAS      QIKSEQQEKT--ELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDMLN
SAES_STAAR      QIKSEQQEKT--ELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDMLN
SAES_STAAN      QIKSEQQEKT--ELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDMLN
SAES_STAAM      QIKSEQQEKT--ELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDMLN
SAES_STAAE      QIKSEQQEKT--ELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDMLN
SAES_STAAC      QIKSEQQEKT--ELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDMLN
SAES_STAAB      QIKSEQQEKT--ELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDMLN
SAES_STAA8      QIKSEQQEKT--ELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDMLN
SAES_STAA3      QIKSEQQEKT--ELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDMLN
DHKD_DICDI      KIKELDELKT--QFFANVSHELRTPLALIVG----PTDKLLKDENVVRKDLEIVARNARGLLKIVNNLLD
CHVG_RHIME      -----DRIAAIENFAADVSHELKNPLTSLRSAVETLP--LARNEESKKRLMDVIQHDVRRLDRLISDIAE
DCTS_BACHD      ELTGVQ--AFVDALRV-QNHEYSNKLHTIAGLIQLDEGKKALQEEEQEEFSGVVMQKIHN-DSLAGLLLK
CPXA_ECOLI      ------------RLLSDISHELRTPLTRLQLGTALLRRRSGESKE-----LERIETEAQRLDSMINDLLV
CPXA_ECOL6      ------------RLLSDISHELRTPLTRLQLGTALLRRRSGESKE-----LERIETEAQRLDSMINDLLV
CPXA_ECO57      ------------RLLSDISHELRTPLTRLQLGTALLRRRSGESKE-----LERIETEAQRLDSMINDLLV
CITS_BACHD      ELTNVKNYA---DALRAQTHEFSNKLNTISGFLQL---------GKIDEAVDFIQKERKIQQEWIHFFIE
VANS_ENTFC      KLAEQRKNDVVMYLA----HDIKTPLTSIIGYLSLLDEAPDMPVDQKAKYVHITLDKAYRLEQLIDEFFE
RSSA_SERMA      RINQREK-----RFMADAAHELRTPIAAV--LAQLHLLTQVTEQQERREIIGDMQQGLDRAASLSRQLIN
PHYA_ANASP      ---------------AQLAHDLERSNAELKKFAYVASHDLQEPLNQVANYVQLLMRYQDQLDADANEFIT
DHKA_DICDI      ---------------ATVSHEVRTPLSGVIGVSDLLLENLSEEQRDYVQ----TIQKSSQALTIINDILD
NIFL_AZOVI      RLNXXXXXXXXXXXXXGMRHRLQGPVNLISAAMRMLERRLGDKNDPVLSAMEASTAGMEALENLSGSIVR
BAES_ECOLI      ---------------ADISHELRTPLAVLRGELEAIQDGVRKFT---PETVASLQAEVGTLTKLVDDLHQ
SAES_STAES      ---QQEKTEII----QNLAHDLKTPLAGIRSYSEGLRDGVISDPQEVHEAYEILIKQANRLSILITHVIN
SAES_STAEQ      ---QQEKTEII----QNLAHDLKTPLAGIRSYSEGLRDGVISDPQEVHEAYEILIKQANRLSILITHVIN
PHY1_SYNY3      ------------------SHDLQEPLNQVSNYVQLLEMRYSEADEDAKDFIDFAVTGVSLMQTLIDDILT
DCUS_SHIFL      RL---DGLVNYADALRERSHEFMNKLHVILGLLHLKSYKQLEDYNNYQEEIGSLLGKIKSP--VIAGFLI
DCUS_ECOLI      RL---DGLVNYADALRERSHEFMNKLHVILGLLHLKSYKQLEDYNNYQEEIGSLLGKIKSP--VIAGFLI
DCUS_ECOL6      RL---DGLVNYADALRERSHEFMNKLHVILGLLHLKSYKQLEDYNNYQEEIGSLLGKIKSP--VIAGFLI
DCUS_ECO57      RL---DGLVNYADALRERSHEFMNKLHVILGLLHLKSYKQLEDYNNYQEEIGSLLGKIKSP--VIAGFLI
GACS_PSESY      L----EASRIKSEFLANMSHEIRTPLNGILGFTHLLQKS---ELTPRQDYLGTIEKSADNLLSIINEILD
DLTS_STRA5      ------------QFVSDASHELKTPIAAIRANVQVL-----EQQIPGNRYLDHVVSETKRMEFLIEDLLN
YKOH_BACSU      ------------QFVQDASHELKTPLTIIESYSSLMKRWGAKKPEVLEESIEAIHSEAVHMKKLTNQLLA
PHYB_ANASP      ------------------SHDLKEPLRGIHNYSNFLMEDYGEIIDPGKEKLLTLIRLTQRMEDLIDSLLH
DLTS_STRA3      ------------QFVSDASHELKTPIAAIRANVQVL-----EQQIPGNRYLDHVVSETKRMEFLIEDLLN
TORS_ECO57      ---------------AAMSHEIRTPLYGILGTAQLLADNPA--LNAQRDDLRAITDSGESLLTILNDILD
KDPD_CLOAB      LSKEQEKSKVXXXXXXXXXHDLRSPLAGIKGAASTILEELIDEKRK-QELINGIYEDTEWLIRLIENLLS
MAK1_SCHPO      NIEAQRIVRSKMQYLSNMSHEIRTPLIGITGMVSLLETQMSAEQLSYARIIQ---QSAKSLLTVINDILD
YCBM_BACSU      KTEQSMK-----RMLTNMSHDLKTPLTVILGYIEAIQSDPNMPDEERERLLGKLRQKTNELIQMINSFFD
DIVL_CAUCR      -----------------VSYELRTPLTTIIGYSELLADGISERGRNHXXXXXXXXTQLARSIDDVLDMAQ
BARA_SHIFL      KKRAQEAARIKSEFLANMSHELRTPLNGVIGFTRLTLK--TELTPTQRDHLNTIERSANNLLAIINDVLD
BARA_ECOLI      KKRAQEAARIKSEFLANMSHELRTPLNGVIGFTRLTLK--TELTPTQRDHLNTIERSANNLLAIINDVLD
BARA_ECOL6      KKRAQEAARIKSEFLANMSHELRTPLNGVIGFTRLTLK--TELTPTQRDHLNTIERSANNLLAIINDVLD
BARA_ECO57      KKRAQEAARIKSEFLANMSHELRTPLNGVIGFTRLTLK--TELTPTQRDHLNTIERSANNLLAIINDVLD
ENVZ_SALTI      -------------LMAGVSHDLRTPLTRIR----LATEMMGEEDGYLAESIN---KDIEECNAIIEQFID
DHKB_DICDI      -----------------VSHELRTPINGVLASADILERTTLDSTQ--KEFLNCIKLSGXXXXXXXXXXXX
ACOR_BACSU      ----------------------------------------------------------------------
TORS_ECOLI      ---------------AAMSHEIRTPLYGILGTAQLLADNPA--LNAQRDDLRAITDSGESLLTILNDILD
ENVZ_SALTY      -------------LMAGVSHDLRTPLTRIR----LATEMMGEEDGYLAESIN---KDIEECNAIIEQFID
CITS_BACSU      TLTEVRKYS---EDLRAQTHEFSNKLYAILGLLEL---------GEYDEAIDLIKEEYEQHDLLFHNI--
ARLS_STAS1      MLQLEESFNQQRQFVEDASHELRTPLQIIQGHLNLINKDAAXXXXXXXXXXXXMTRIXXXXXXXXXXXXD
YCLK_BACSU      RRR---------QFIADVSHELKTPLTTINGLVEGLNSHTIPEDKKDKCF-SLISEETKRMLRLVKENLD
SENX3_MYCS2     TRRD---------FVANVSHELKTPVGAMSVLAEALLAS-ADDPDTVRRFAEKMVAESHRLADMIGELIE
CUSS_ECOL6      --------------SADIAHEIRTPITNLITQTEIALSQ-SRSQKELEDVLYSNLEELTRMAKMVSDMLF
ARLS_STAHJ      ------------QFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISLEEMNRIXXXXXXXXX
SILS_SALTY      --------------SADIAHEIRTPITNL----VTQTEIALSQDRTQKELEDVLLEEYNRMTKMVSDMLF
PHOR_PSEAE      MRKD---------FVANVSHELRTPLTVIAGYLETLLDNV-EDVNPXXXXXXXXXXXXNXXXXXXXXXXX
YFHK_ECOLI      ------------QFLRHLSHELKTPLASMREGTELLADQVVGPLTPQKEVVSILDSSSRNLQKLIEQLLD
MAK2_SCHPO      REAAMHAVNLKTNFLANMSHELRTPFSSFYGMLSLLSDKLNEEQSTAKQSCTSLVQIIDDLLNF--SELK
DHKL_DICDI      KTLEQNKIIEKSRLRLSMSHDIRTPMSNIIGMADLLLDSLSQHQHHYLEIIKNSXXXXXXXXXXXXXXXK
IRLS_BURPS      --RLDESFVRLSQFSSNLAHDMRTPLTNLLAEAQVALSK-PRTADEYRDVIESSIDEYQRLSRMIEDMLF
ETR1_CUCSA      ETANHAR----NDFLAVMNHEMRTPMHAIIALSSLLQET---ELTPEQRLMETILKSSNLLATLINDVLD
DHAR_CITFR      ----------------------------------------------------------------------
CUSS_ECOLI      --------------SADIAHEIRTPITNLITQTEIALSQ-SRSQKELEDVLYSNLEELTRMAKMVSDMLF
SPAK_BACSU      ------------EQIGALAHEIKIPITIIKGNAELLSLSMQNEEQ--AEYTKYILGAGNQIEQYIYQLIH
RPFC_XANCP      RHANQAK----SRFLANMSHEFRTPLNGLSGMTEVLATTRLDAEQ--KECLNTIQASARSLLSLVEEVLD
RPFC_XANC8      RHANQAK----SRFLANMSHEFRTPLNGLSGMTEVLATTRLDAEQ--KECLNTIQASARSLLSLVEEVLD
LUXN_VIBHB      TIEADRRIRQSRALANSIAHEMRNPLAQV----QLQFEALKQHIENHAPVEQITL-DIENGQAAIQRGRQ
LUXN_VIBHA      TIEADRRIRQSRALANSIAHEMRNPLAQV----QLQFEALKQHIENHAPVEQITL-DIENGQAAIQRGRQ
ETR1_PRUPE      ---------------AVMNHEMRTPMHAIIALSSLLQET---ELTPEQRLMETILKSSHLLATLINDVLD
ETR1_CUCMR      ---------------AVMNHEMRTPMHAIIALSSLLQET---ELTPEQRLMETILKSSNLLATLINDVLD
ARLS_STAES      ------------QFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEVNRIXXXXXXXXX
ARLS_STAEQ      ------------QFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEVNRIXXXXXXXXX
MPRB_MYCVP      ------------RLVTDAGHELRTPLTSLRTNVELLMESMGAPRIPEEDMAELVIAQIEEMSTLVGDLVD
CUSS_ECO57      --------------SADIAHEIRTPITNLITQTEIALSQ-SRSQKELEDVLYSNLEELTRMAKMVSDMLF
AFSQ2_STRCO     ----------------------------------------------------------------------
ETR1_SOLLC      ---------------AVMNHEMRTPMHAIIALSSLLQET---DLTPEQRLMETILKSSNLLATLINDVLD
ENVZ_SHIFL      -------------LMAGVSHDLRTPLTRIRLATEMMSE-----QDGY--LAESINKDIEECNAIIEQFID
ENVZ_ECOLI      -------------LMAGVSHDLRTPLTRIRLATEMMSE-----QDGY--LAESINKDIEECNAIIEQFID
MPRB_MYCPA      ------------RLVTDAGHELRTPLTSLRTNVELLMASMGAPRLPEQEMVELVLAQIEELSTLVGDLVD
ETR2_SOLLC      -----------------MNHEMRTPMHAVVALSSLLQES---ELIPEQRLMETILKSSNLLATLINDVLD
CIAH_STRR6      ------------------SHELRTPLAVLQNRLETLFRKPEATIMDVSESIASSLEEVRNMRFLTTSLLN
CIAH_STRPN      ------------------SHELRTPLAVLQNRLETLFRKPEATIMDVSESIASSLEEVRNMRFLTTSLLN
RCSC_ECOLI      ----------------------------------------------------------------------
DHKK_DICDI      ------------EFLATMSHEIRTPLNGLIGMATLLRD--SHNLPPEEKTMAKAVKSCDILLRLVNDILD
CQSS_VIBCH      QISHETKVSIAKTFGAGIAHEMRNPLSALKTSIDVVRTMIPKPQTAAHTDYSLDAQELDEADDVINNAID
YTH3_RHOER      ----------------------------------------------------------------------
MPRB_MYCA1      ------------RLVTDAGHELRTPLTSLRTNVELLMASMGAPRLPEQEMVELVLAQIEELSTLVGDLVD
HSSS_STAS1      -----------------VSHEIKTPLTHIHHLLDLL--KFAKTDNAREQYIEEIYEVTTQXXXXIDNGAH
ETR1_TOBAC      ---------------AVMNHEMRTPMHAIIALSSLLQET---ELTPEQRLMETILKSSNLLATLINDVLD
DHKC_DICDI      -------------MISHLSHELRTPIHSVIASIQLFSTILTVTQN---EYLSIIDTSANTLLELVSNVLD
BASS_SALTY      ---------------ADVAHELRTPLSGVRLHLELLSKTHNVDVAP-------LIARLDQMMDSVSQLLQ
ARLS_STAAW      ------------QFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLE
ARLS_STAAS      ------------QFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLE
ARLS_STAAR      ------------QFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLE
ARLS_STAAN      ------------QFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLE
ARLS_STAAM      ------------QFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLE
ARLS_STAAC      ------------QFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLE
ARLS_STAAB      ------------QFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLE
ARLS_STAA8      ------------QFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLE
ARLS_STAA3      ------------QFVEDASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLE
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
SP2AB_BACME     ----------------------------------------------------------------------
GRAS_STAAR      VVDQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEENQERKQALLFEWSRINSMLDTQLY
ETR1_PELHO      ---------------AVMNHEMRTPMHAIIALSSLLQETLTSEQ---RLMVETILKSSNLLATLINDVLD
ETR1_MALDO      ---------------AVMNHEMRTPMHAIIALSSLLQEELTAEQ---RLMVETILRSSNLLATLINDVLD
CREC_ECOLI      ----------IEQYVYALTHELKSPLAAIRGAAEILREGPPPE--VVARFTDNILTQNARMQALVETLLR
PHOR_HAEIN      -------------------HELRTPLTVLQGYLEILADNNI--QNPLKKAIXAMQEQSQRMEHLLQQFNF
GTCS_ANEMI      ---EKNKLEQSKQMLLDLSHDFKTPITTIQGYAMALQMGVVDSPEKQRRYLEMIYNKSIIVTALVEDMFQ
ETR1_ARATH      ---------------AVMNHEMRTPMHAIIALSSLLQET---ELTPEQRLMETILKSSNLLATLMNDVLD
BCES_BACSU      -------------------HEVKTPLTAMHLIIDRMEEKALKSQLSY-EWLRIHLQQLHQKRSFIENDL-
QSEC_HAEIN      ------------------AHELRSPLAALREVAQLAGDDVALREQALLH----LTQGIDRASQLIEQLLT
PFES_PSEAE      -------------------HELRTPLARLR--------IAHDSELPPEQLRQRLDREIGDMQRLLEDTLD
GRAS_STAHJ      RVVEQQHIQSTEQSLTEFVHDIKTPVTAM---------KLLIDQEEEGKRKKSLLYEWARINELLDKQLY
RSTB_ECOLI      ------------QLIDGIAHELRTPLVRLRYRLEMSDNLSAAES-------QALNRDISQLEALIEELLT
MPRB_MYCLE      ------------RLVTDAGHELRTPLTSLRTNVELLIASMAPERLPDQEMADLVLAQIEELSTLVGDLVD
ETR2_PELHO      ---------------AVMNHEMRTPMHAIIALSSLLQET---ELTPEQRLMETVLKSSNLLATLINDVLD
YEDV_ECOLI      LVKDFERLS---QFADDLAHELRTPINALLGQNQVQTRSIAE----YQKTIAGNIEELENISRLTENILF
ETR1_BRAOL      ---------------AVMNHEMRTPMHAIIALSSLLQET---ELTPEQRLMETVLKSSSLLATLMNDVLD
GLNK_BACSU      ----------------------------------------------------------------------
DHAR_ECOLI      ----------------------------------------------------------------------
CZCS_RALME      ----------LSRFSADLAHDLRTPLNNLIGHAEVALSR--DRTGPYVALVEESLVEYQRLARMIDAMLF
YXDK_BACSU      KLHETEKLDARVTYMNQWVHQVKTPLSVINLIIQ-------EEDEPVFEQIK---KEVRQIEFGLETLLY
SENX3_MYCTU     ARRD---------FVANVSHELKTPVGAMXXXXXXXXXXXXXXXT-VRRFAEKVLIEANRLGDMVAELIE
SENX3_MYCBO     ARRD---------FVANVSHELKTPVGAMXXXXXXXXXXXXXXXT-VRRFAEKVLIEANRLGDMVAELIE
MPRB_MYCSS      RL------------VSDAGHELRTPLTSLRTNVELLSQAPGAPRLPEEEMAGLVIAQIEELSTLVGDLVD
MPRB_MYCSK      RL------------VSDAGHELRTPLTSLRTNVELLSQAPGAPRLPEEEMAGLVIAQIEELSTLVGDLVD
MPRB_MYCSJ      RL------------VSDAGHELRTPLTSLRTNVELLSQAPGAPRLPEEEMAGLVIAQIEELSTLVGDLVD
MALK_BACSU      QLSGVKMYA---NALRAQSHEFMNKLHVILGLVQL---KEYDDLGDY--IKDIAIQQKSETSEIINDVK-
KDPD_MYCTU      -------------LLSAVSHDLRTPLAAAKAVSSLRTEDVAFSPEDTAELLATIEESIDQLTALVANLLD
CQSS_VIBHB      QVEHEAKVSIAKSFGAGIAHEMRNPLSGLLTSIDVIQSVLPNPKEGKKEQYTLSDEDVTLLREVSSDAMK
PCOS_ECOLX      ----------LSDFSSDIAHELRTPVSNLMMQTQFALAKERDVSH-YREILFANLEELKRLSRMTSDMLF
KDPD_RATRA      ----------------------------------------------------------------------
MPRB_MYCS2      ------------RLVSDAGHELRTPLTSLRTNVELLMAAQEPGAPPLPELRADVIAQIEELSTLVGDLVD
GRAS_STAAN      VVEQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEKNQERKQALLYEWSRINSMLDTQLY
GRAS_STAAM      VVEQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEKNQERKQALLYEWSRINSMLDTQLY
GRAS_STAA9      VVEQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEKNQERKQALLYEWSRINSMLDTQLY
GRAS_STAA2      VVEQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEKNQERKQALLYEWSRINSMLDTQLY
GRAS_STAA1      VVEQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEKNQERKQALLYEWSRINSMLDTQLY
NISK_LACLA      ERHEKHDLSF---QVAALSHDVKTPLTVLKGNIELL--EMTEVNEQQADFIESMKNSLTVFDKYFNSYTK
ETR1_PASED      ---------------AVMNHEMRTPMHAVIALSSLLQET---ELTPEQRLMETILKSSNLLATLINDVLD
BCES_BACHD      -------------------HEIKTPLTAMHLIIDRLEDRTIKGQLTY-EWMRIHLQQLHQKRPFMENDLY
MPRB_MYCUA      ------------RLVSDAGHELRTPLTSLRTNVELLMASMGAPRLPEQEMVEDVVAQIEELSTLVGDLVD
HSSS_STAHJ      ----------------------------------------------------------------------
GRAS_STAAW      VVEQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEKNQERKQALLYEWSRINSMLDTQLY
GRAS_STAAT      VVEQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEKNQERKQALLYEWSRINSMLDTQLY
GRAS_STAAS      VVEQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEKNQERKQALLYEWSRINSMLDTQLY
GRAS_STAAE      VVEQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEKNQERKQALLYEWSRINSMLDTQLY
GRAS_STAAC      VVEQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEKNQERKQALLYEWSRINSMLDTQLY
GRAS_STAAB      VVEQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEKNQERKQALLYEWSRINSMLDTQLY
GRAS_STAA8      VVEQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEKNQERKQALLYEWSRINSMLDTQLY
GRAS_STAA3      VVEQQLQLNMHEQTITEFVHDIKTPVTAM---------KLLIDQEKNQERKQALLYEWSRINSMLDTQLY
CITA_KLEPN      ----------------------------------------------------------------------
DPIB_ECOLI      QLTQIKQYV---ESLRTLRHEHLNWMSTLNGLLQM------------KEYDRVMVQGESQAQQQLIDSLR
BPHY_PSEAE      ----------------------------------------------------------------------
MPRB_MYCBP      ------------RLVTDAGHELRTPLTSLRTNVELLMASMAPPRLPKQEMVDLVLAQIEELSTLVGDLVD
MPRB_MYCBO      ------------RLVTDAGHELRTPLTSLRTNVELLMASMAPPRLPKQEMVDLVLAQIEELSTLVGDLVD
HSSS_STAAT      ----RESLGQVDQMVQNVSHEIKTPLTHIHHLLQQTSDKTLRQQY-INDIYTIXXXXXXXXXXXXXXXXX
HSSS_STAAE      ----RESLGQVDQMVQNVSHEIKTPLTHIHHLLQQTSDKTLRQQY-INDIYTIXXXXXXXXXXXXXXXXX
HSSS_STAAC      ----RESLGQVDQMVQNVSHEIKTPLTHIHHLLQQTSDKTLRQQY-INDIYTIXXXXXXXXXXXXXXXXX
HSSS_STAA8      ----RESLGQVDQMVQNVSHEIKTPLTHIHHLLQQTSDKTLRQQY-INDIYTIXXXXXXXXXXXXXXXXX
HSSS_STAA3      ----RESLGQVDQMVQNVSHEIKTPLTHIHHLLQQTSDKTLRQQY-INDIYTIXXXXXXXXXXXXXXXXX
DHKG_DICDI      ---------------SNMSHEMRTPLNHIIGSIELLKSYNHLFNSDQKELLDISAKSSESLLFMVNNILD
YVCQ_BACSU      -------------------HHMKTPVSVI---SLMIQEGKNGTSSSFPTFLEELEDENERFRHGLDMMLQ
SP2AB_THETN     ----------------------------------------------------------------------
MPRB_MYCTU      ------------RLVTDAGHELRTPLTSLRTNVELLMASMAPPRLPKQEMVDLVLAQIEELSTLVGDLVD
MPRB_MYCTA      ------------RLVTDAGHELRTPLTSLRTNVELLMASMAPPRLPKQEMVDLVLAQIEELSTLVGDLVD
BASS_ECOLI      ---------------ADVAHELRTPLAGVRLHLELLAKTHHIDVAP-------LVARLDQMMESVSQLLQ
SP2AB_THEPX     ----------------------------------------------------------------------
SP2AB_THEP3     ----------------------------------------------------------------------
PHOQ_SHIFL      RLSERERYDKYRTTLTDLTHSLKTPLAVLQSLRSLRSEKMS-----VSDAEPVMLEQISRISQQIGYYLH
PHOQ_ECOLI      RLSERERYDKYRTTLTDLTHSLKTPLAVLQSLRSLRSEKMS-----VSDAEPVMLEQISRISQQIGYYLH
PHOQ_ECOL6      RLSERERYDKYRTTLTDLTHSLKTPLAVLQSLRSLRSEKMS-----VSDAEPVMLEQISRISQQIGYYLH
SP2AB_GEOTN     ----------------------------------------------------------------------
SP2AB_GEOKA     ----------------------------------------------------------------------
SP2AB_CLOPE     ----------------------------------------------------------------------
SP2AB_CLOP1     ----------------------------------------------------------------------
HSSS_STAAW      ----RESLGQVDQMVQNVSHEIKTPLTHIH---HLLSELQQTSDNTLRQQYINDIYTIXXXXXXXXXXXX
HSSS_STAAS      ----RESLGQVDQMVQNVSHEIKTPLTHIH---HLLSELQQTSDNTLRQQYINDIYTIXXXXXXXXXXXX
SP2AB_BACST     ----------------------------------------------------------------------
HSSS_STAAN      ----RESLGQVDQMVQNVSHEIKTPLTHIHHLLQQTSDKTLRQQY-INDIYTIXXXXXXXXXXXXXXXXX
HSSS_STAAM      ----RESLGQVDQMVQNVSHEIKTPLTHIHHLLQQTSDKTLRQQY-INDIYTIXXXXXXXXXXXXXXXXX
HSSS_STAA9      ----RESLGQVDQMVQNVSHEIKTPLTHIHHLLQQTSDKTLRQQY-INDIYTIXXXXXXXXXXXXXXXXX
HSSS_STAA2      ----RESLGQVDQMVQNVSHEIKTPLTHIHHLLQQTSDKTLRQQY-INDIYTIXXXXXXXXXXXXXXXXX
HSSS_STAA1      ----RESLGQVDQMVQNVSHEIKTPLTHIHHLLQQTSDKTLRQQY-INDIYTIXXXXXXXXXXXXXXXXX
BPHY_DEIRA      QSNAEWR-----QYGFVISHHMQEPVRLISQFAELLTRQPRAQDSPQTEFXXXXXXXXXXXXQDLHTYTA
SPHS_SYNE7      -IEDRQELVDLAQQVSDVAHELKTPLTSIRLLAEALRDRLQDEP---QVWVDRLLGETQRLGQLVQDLLE
CSEC_STRCO      XXXLQQRIEAERRVTADIAHELRTPVTGLLTAAELL---------PPGRPTELVLDRAKAMRTLVEDVLE
TCSB_EMENI      ----------------------------------------------------------------------
SP2AB_BACLD     ----------------------------------------------------------------------
SP2AB_ANOFW     ----------------------------------------------------------------------
HSSS_STAAB      ----RESLGQVDQMVQNVSHEIKTPLTHIHHLLQQTSDKTLRQQY-INDIYTIXXXXXXXXXXXXXXXXX
DHKI_DICDI      ILKNATEEALKGEFLANISHELLSPMNSIIGMVGLCLDNLKEMLNDVVESSKILLDLLHQILDFTSNSLA
SP2AB_BACWK     ----------------------------------------------------------------------
SP2AB_BACHK     ----------------------------------------------------------------------
SP2AB_BACCZ     ----------------------------------------------------------------------
SP2AB_BACCQ     ----------------------------------------------------------------------
SP2AB_BACC7     ----------------------------------------------------------------------
SP2AB_BACC3     ----------------------------------------------------------------------
SP2AB_BACC1     ----------------------------------------------------------------------
SP2AB_BACC0     ----------------------------------------------------------------------
SP2AB_BACAN     ----------------------------------------------------------------------
SP2AB_BACAH     ----------------------------------------------------------------------
SP2AB_BACAC     ----------------------------------------------------------------------
SP2AB_BACAA     ----------------------------------------------------------------------
DHKJ_DICDI      KETAEAASRAKSDFMANMSHEIRTPMNGIIGMXXXXXXXXXXAEQ--REYLSMVQSSAGSLLTIINDILD
ACOR_RALEH      ----------------------------------------------------------------------
TCSA_EMENI      CMIAEESSRLKTDFLANISHEIRTPMNGMQIALTMLSEEQREHANIVQDSMSLLLQ-------IVNDVLD
SP2AB_BACC4     ----------------------------------------------------------------------
SP2AB_BACC2     ----------------------------------------------------------------------
PHOQ_ECO57      RLSERERYDKYRTTLTDLTHSLKTPLAVLQSLRSLRSEKMS-----VSDAEPVMLEQISRISQQIGYYLH
SLN1_YEAST      ---------------ANISHELRTPLNGILGMTAISMEET--DVNKIRNSLKLIFRSXXXXXXFSKNVLQ
HSSS_STAAR      ----RESLGQVDQMVQNVSHEIKTPLTHIHHLLQQTSDKTLRQQY-INDIYTIXXXXXXXXXXXXXXXXX
GRAS_STAES      VVEQQLQIKNHEQTITEFVHDIKTPVTAMK----LLIDQENDDQRK-----RALLFEWSRINEMLDKQLY
GRAS_STAEQ      VVEQQLQIKNHEQTITEFVHDIKTPVTAMK----LLIDQENDDQRK-----RALLFEWSRINEMLDKQLY
SP2AB_BACLI     ----------------------------------------------------------------------
CSEC_STRAW      R-----------RVTADIAHELRTPVTGLLTAAELL---------PPGRPTELVRDRAQAMRTLVEDVLE
LYTS_BACAN      ----------------------------------------------------------------------
DHKH_DICDI      RIENAEKSKAL--FLQTMSHEMRTPLAGIMGINSWLSTSSPQLTSEQLDGCHTIDMCAEALLVLINNILD
LYTS_BACCR      ----------------------------------------------------------------------
SP2AB_BACCR     ----------------------------------------------------------------------
CSSS_BACSU      ----------------------------------------------------------------------
COPS_PSESM      ----------LSNFSADIAHELRTPISNLRTHTEILAKKRAPE--VYXXXXXXXXXXXXXXXGIIDGMLF
SP2AB_CLOPS     ----------------------------------------------------------------------
SEX3_MYCLE      ARRD---------FVANVSHELKTPV-GXXXXXXXXXXXXXXXXXTVSRFAEKVLIEANRLGYMVAELIE
REGB_RHOS4      LDREQ-KLTDLGGVVAAAAHELGTPLATIK-XXXXXXXXXXXXQPALRDDAELIREQADRCRDILRS-MG
QSEC_SALTY      ------------------AHELRSPLAALKVQTEV-AQLSGDDPLSRDKALTQLHAGIDRATRLVDQLLT
QSEC_SALTI      ------------------AHELRSPLAALKVQTEV-AQLSGDDPLSRDKALTQLHAGIDRATRLVDQLLT
DHKE_DICDI      ----------------------------------------------------------------------
PHOQ_SALTY      ---ERERYNKYRTTLTDLTHSLKTPLAVLQSLRSLRNEKMSVSKAE-----PVMLEQISRISQQIGYYLH
PHOQ_SALTI      ---ERERYNKYRTTLTDLTHSLKTPLAVLQSLRSLRNEKMSVSKAE-----PVMLEQISRISQQIGYYLH
PHOQ_SALPA      ---ERERYNKYRTTLTDLTHSLKTPLAVLQSLRSLRNEKMSVSKAE-----PVMLEQISRISQQIGYYLH
PHOQ_SALCH      ---ERERYNKYRTTLTDLTHSLKTPLAVLQSLRSLRNEKMSVSKAE-----PVMLEQISRISQQIGYYLH
GRAS_STAS1      LVTHQKQQIQSTEAATDFVHDIKTPVTAMK----LLIEK---EQDLSRK--HALLYEWSRINDMLDRQLF
CNPD_PELLD      ----------------------------------------------------------------------
QSEC_ECO57      ------------------AHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLH-SGIDRATRLVDQLLT
NREB_STAAR      ----------------------------------------------YQEDTAKLLEDAENIEYIVAKLID
CHEA_THEMA      ----------------------------------------------------------------------
YQIR_BACSU      NLKQDEAISVVDENGIGLL--INKAYTKMTGLSE--KEVIGKPAN----------TDISEGESMHLKVLE
NREB_STAAW      ----------------------------------------------YQEDTTKLLEDAENIEYIVAKLID
NREB_STAAT      ----------------------------------------------YQEDTTKLLEDAENIEYIVAKLID
NREB_STAAS      ----------------------------------------------YQEDTTKLLEDAENIEYIVAKLID
NREB_STAAN      ----------------------------------------------YQEDTTKLLEDAENIEYIVAKLID
NREB_STAAM      ----------------------------------------------YQEDTTKLLEDAENIEYIVAKLID
NREB_STAAE      ----------------------------------------------YQEDTTKLLEDAENIEYIVAKLID
NREB_STAAC      ----------------------------------------------YQEDTTKLLEDAENIEYIVAKLID
NREB_STAAB      ----------------------------------------------YQEDTTKLLEDAENIEYIVAKLID
NREB_STAA9      ----------------------------------------------YQEDTTKLLEDAENIEYIVAKLID
NREB_STAA8      ----------------------------------------------YQEDTTKLLEDAENIEYIVAKLID
NREB_STAA3      ----------------------------------------------YQEDTTKLLEDAENIEYIVAKLID
NREB_STAA2      ----------------------------------------------YQEDTTKLLEDAENIEYIVAKLID
NREB_STAA1      ----------------------------------------------YQEDTTKLLEDAENIEYIVAKLID
QSEC_ECOLI      ------------------AHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLH-SGIDRATRLVDQLLT
TOP6B_ARCFU     ----------------------------------------------------------------------
HPRK_STAES      PVRPGRNVAVIIEVAA------------------------------------------------------
HPRK_STAEQ      PVRPGRNVAVIIEVAA------------------------------------------------------
HPRK_STAAW      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------
HPRK_STAAT      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------
HPRK_STAAS      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------
HPRK_STAAR      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------
HPRK_STAAN      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------
HPRK_STAAM      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------
HPRK_STAAE      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------
HPRK_STAAC      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------
HPRK_STAAB      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------
HPRK_STAA9      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------
HPRK_STAA8      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------
HPRK_STAA3      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------
HPRK_STAA2      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------
HPRK_STAA1      PVRPGRNVAVIIEVAA------MNYRLNIMGIAEEFSERLNEE---------------------------


                         .         .         +         .         .         .         .:490
query           LARPKPPKMQACSLNQLILNFIKIFESQAFLQGVKIGIDLGEIPTIVIDKDQIKQVLLNLCQNALQAMNM
ATOS_ECOLI      FSRPRHSQWQQVSLNALVEETLVLVQT----AGVQARVDFNELSPINADRELLKQVLLNILINAVQAISA
KINC_BACSU      LAKPQAITFKTHQLNEILKQVTTLLDTNAILSNIVIEKNFKETDGCMIDENQLKQVFINIIKNGIEAMPK
KINE_BACSU      LAKPQAIMYEEKHVTQIMRDTIDLLNAQANLSNVQMQLDLDDIPPIYCEPNQLKQVFINILKNAIEVMPD
ZRAS_SALTI      LVKPAHLTLQAVNLNDIITHSLNLVSQDAQSREIQLRFTANELKRIQADPDRLTQVLLNLYLNAIHAIGR
ZRAS_SALTY      LVKPAHLTLQTVNLNDIITHSLNLVSQDAQSREIQLRFTANELKRIQADPDRLTQVLLNLYLNAIHAIGR
KINA_BACSU      XAKPQQNAVKELNLKKLIGEVSALLETQANLNGIFIRTSY-EKDSIYIDQNQLKQVFINLIKNAVESMPD
KIND_BACSU      LGKPTAEKWELNSLQDIIGEIMPIIYSEGNLYNVEVELQLTEQPLLVCTKDHIKQVILNVAKNGLESMPE
ZRAS_ECOLI      LVKPTHLALQAVDLNTLINHSLQLVSQDANSREIQLRFTANDLPEIQADPDRLTQVLLNLYLNAIQAIGQ
PILS_PSEAE      LSRRRQAEPQQLDLKEWLQRFVDEYDSQLHLQ-----LGAGDIQTRM-DPHQLNQVLSNLVQNGLRQAHG
ZRAS_ECO57      LVKPTHLALQAVDLNTLINHSLQLVSQDANCREIQLRFTANDLPEIQADPDRLTQVLLNLYLNAIQAIGQ
KINB_BACSU      MAKQQLYEKEVFDLSALIKETSSLMVSYANYKSVTVEAETEPDLLIYGDATKLKQAVINLMKNSIEAVHG
ZRAS_KLEOX      LVRPAHLKYQSVDLNEVITHSLQLVSQDAASRAISLTFTAQPLCRIQADPDRLKQVLLNLYLNAVHAIGR
DEGM_BACB2      TTRPQTNA--TFHLNETAREVVALLTPYAQERSIQLTIGTCEQAIVNGNENKVKQALMNFVKNGIEASNE
NTRB_KLEOX      LLGPQHPGMHVTSIHKVAERVVKLV-SMELPDNVKLVRDYDSLPELPHDPDQIEQVLLNIVRNALQALGP
NTRB_SALTY      ---PQHPGMHITESIHKVAERVVALVSMELPDNVRLIRDYDSLPELPHDPEQIEQVLLNIVRNALQALGP
NTRB_SALTI      ---PQHPGMHITESIHKVAERVVALVSMELPDNVRLIRDYDSLPELPHDPEQIEQVLLNIVRNALQALGP
NTRB_VIBAL      -GPQKPGKKTQENLHQILEKVRQLVELES-QRSIVIERDYDSLPEILMDADQIEQAMLNIVSNAAQILSH
NTRB_SHIFL      LLGPQLPGTRVTESIHKVAERVVTLVSMELPDNVRLIRDYDSLPELAHDPDQIEQVLLNIVRNALQALGP
NTRB_ECOLI      LLGPQLPGTRVTESIHKVAERVVTLVSMELPDNVRLIRDYDSLPELAHDPDQIEQVLLNIVRNALQALGP
NTRB_ECO57      LLGPQLPGTRVTESIHKVAERVVTLVSMELPDNVRLIRDYDSLPELAHDPDQIEQVLLNIVRNALQALGP
WALK_STAHJ      LSKMDNESEQIVDFNMFINKIINRHEMAA-----KDTTFVREIPSTEIDPDKMTQVFDNVITNAMKYSRG
FIXL_BRAJA      FVARGESEKRVESLSKLIEEXXXXXXXXXREQNVQLRFSLDPGADLVLDRVQIQQVLVNLFRNALEAMQS
NTRB_AZOBR      FSDQRPLERDAVNIHTVLEHVRKVAQS-GFARNIRF-IERYDLPPVYGNRDQLIQIFLNLIKNAAEAAES
VIRA_AGRT9      LSRKQERMIKPFSVSELVTEIAPLLR-MALPPNIELSFRFDQMQSVIEGSPELQQVLINICKNASQAMTA
WALK_STAAE      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
FIXL_AZOC5      FVSRGETERRVESLSKLIEEASALALVGAKEHGIQVRYQIDTSCDLVLDKVQVQQVLLNLMRNALEAMMD
VIRAW_RHIRD     LSRKQERMIKPFSVSELVTEIAPLLR-MALPPNIELSFRFDQMQSVIEGSPELQQVLINICKNASQAMTA
WALK_STAAW      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
WALK_STAAU      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
WALK_STAAT      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
WALK_STAAS      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
WALK_STAAR      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSTKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
WALK_STAAN      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
WALK_STAAM      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
WALK_STAAC      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
WALK_STAAB      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
WALK_STAA9      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
WALK_STAA8      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
WALK_STAA3      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
WALK_STAA2      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
WALK_STAA1      LSKMDNESDQ---INKEIIDFNMFINKNRHEMSAKDTTFIRDIPKKTIDPDKMTQVFDNVITNAMKYSRG
NTRB_RHOCA      FGNVRPPEMKPVNIHD-VLDRARKSAGVGFGAHMLIVEDYDSVPPTLGDADQLTQVFLNLLKNASEAAKG
NTRB_RHILP      FSDERPVRRMPVNIHS-VLDHVKRLAQSGFARNIRITESYDSLPAVYANRDQLVQVFLNLVKNAAEAVGD
NODV_BRAJA      LAKKGEIEMVPLDINQVVRDVSALVTRELVSHQVTLRSELASLPRVLGDRIQLQQVIINLVMNGIEAMDA
DCTB_RHIME      FARKGHFAAGPTAMKEVVEGALMLLRSRFAGRMDAIRLDLPPDGLQALNRIRLEQVLINLLQNALEAIGD
WALK_STAES      LSKMDNESDQITKFNMFINKIINRHEMAA-----KDTTFVREIPTIFIDPDKMTQVFDNVITNAMKYSRG
WALK_STAEQ      LSKMDNESDQITKFNMFINKIINRHEMAA-----KDTTFVREIPTIFIDPDKMTQVFDNVITNAMKYSRG
NTRB_RHIME      FSDERPVDRLPLNIHA-VLDHVKAIAKAGFARRIKISEHYDSLPPVFANRDQLVQVFLNLIKNAAEAIGA
Y3689_SHEFN     YAMPHADQYTLVSLNDVVQVAQRLTANQTKSHQISTML-CDPSPCITGDAQQLHQVLINLIQNACNACST
WALK_STASR      LSKMDSSSDQMNSLXXXXXXXXXXXXRHEMSQGKNVTF-IRDIPVVEIDPDKMTQVFDNVITNAIKSQES
VIRA_AGRT5      LSRKLERVTKPFSVSELVMEIAPLLR-VALQRNIELKFKFDDKKSVVEGSPEVQQMLMNLCKNASQAFTA
WALK_STAS1      LSKMDNESEQITKFNMFINKIINRHEMSA-----KDTTFVREVPTETIDPDKMTQVFDNVITNAMKYSRG
NTRB_BRASR      FGDDRPVARGPVNIHS-VLDHVKRLAQSGFARNVRFIEDYDSLPPVLANQDQLIQVFLNLVKNAAEAVAD
PHOR_BACSU      IETFEPAKM--------LGEIETLLKHKADEKGISLHLNVPKDPQYVSDPYRLKQVFLNLVNNALTYTPE
YYCG_BACSU      LSKFDSKDYQFNREWIQIVRFMSLIIDRFEMTKEQHVEFIRNLPDVEIDQDKITQVLDNIISNALKYSPE
STC_CLOBE       ----------------------------------------------------------------------
PDHS_OCHA4      ISKIEDMQFEAVSLNDAIAEAIALMQPQANRERVIIRSSFSNLPDIVADTRSIKQVALNLLSNAVRFTAP
DCTB_RHILE      FARKGRGSAEPTGLKDVIEGAVMLLRSRFAGRMDTLDIDLPPDELQVMNRIRLEQVLINLLQNALEAVAP
NTRYL_RICBR     FARLPAPKFTNCDLIYVINNIVEARKNNNILYSFETNIDQFDF---TCDTTQINQVMINLLKNAEESLEG
SASA_CYAP7      XXXXXXXXXXXC------LEILKQMGDQFQEKSLKIEKDIPQLPPVYADEELIRQVIVNLLDNAIKYTPE
RESE_BACSU      LARMESGHYEKINVNEFLEKIIRKFSGVAKEKNIALDHDISTXXXXXXXXXXXXQVFTNLIDNALRHTSA
DIVJ_CAUCR      MSKIEAERFEVFDAREAVQAAMRLLRVQSDTAGVQLRLPPGELE-VDADRRALKQIVLNLVSNALKFTPR
SASA_SYNY3      VGRP-------LAIADLCQEVLELYQAKFSKKNLTITYDIPDLPNVFADEELIRQVIANLLDNAIKYTPA
SASA_PROMM      VKSTKWEDLQNLDLGNIAAEAILELEKLWLDRNIEIRTDISDLPKVFADQRRMRQVLLNLLENALKFTED
FIXL_RHIME      FVTKGETEKAPEDIRKLVEESAALALVGSREQGVRTVFELPGAEMVLVDRIQVQQVLINLMRNAIEAMRH
SASA_CYAA5      ASKSMNAQLQVHQLPRLSKEIVEQYNDLLTEKSLKLIQDVPQVPGVYADEELIRQVIVNLIDNAIKYTSE
PDHS_BRUSU      ISKIEAGALEAVSLNDAIGEAIALMQPQANRERVIIRSSFSNLPDIVADSRSIKQVALNLLSNAVRFTAP
PDHS_BRUSI      ISKIEAGALEAVSLNDAIGEAIALMQPQANRERVIIRSSFSNLPDIVADSRSIKQVALNLLSNAVRFTAP
PDHS_BRUME      ISKIEAGALEAVSLNDAIGEAIALMQPQANRERVIIRSSFSNLPDIVADSRSIKQVALNLLSNAVRFTAP
PDHS_BRUAB      ISKIEAGALEAVSLNDAIGEAIALMQPQANRERVIIRSSFSNLPDIVADSRSIKQVALNLLSNAVRFTAP
PDHS_BRUA2      ISKIEAGALEAVSLNDAIGEAIALMQPQANRERVIIRSSFSNLPDIVADSRSIKQVALNLLSNAVRFTAP
PDHS_BRUA1      ISKIEAGALEAVSLNDAIGEAIALMQPQANRERVIIRSSFSNLPDIVADSRSIKQVALNLLSNAVRFTAP
DCTS_RHOCA      FVKKRTPQLAALDLSEVLAEALSITAPVAREHRVKLASLIGRIPGVQADRILIEQVLVNLIRNGVEAM-A
PLEC_CAUCR      MSKIEAGKMESMHLEDVAEDAVRLVRNRAEAAGLKLDIDFPQLPEIEADYRAVKQVLLNLLSNAIKFTPR
PDHS_BRUC2      ISKIEAGALEAVSLNDAIGEAIALMQPQANRERVIIRSSFSNLPDIVADSRSIKQVALNLLSNAVRFTAP
NTRY_AZOBR      FARMPQPVMKPCNLNDLVRQAV-FLQSSAHAGKIKFDMALPQGPTVPCDSRQISQALTNLLQNAADAIEA
SASA_PROM3      VKSTRWEDLQNLDLGNIAAEAILELEKLWLDRNIEIHTDISDLPKVFADQRRMRQVLLNLLENALKFTED
MTRB_MYCTU      ISRHDAGSVEAVDLRTTVNNALGNVGHLAEEAGIELLVDLPAEQVIAVDARRVERILRNLIANAIDHAEH
MTRB_MYCBO      ISRHDAGSVEAVDLRTTVNNALGNVGHLAEEAGIELLVDLPAEQVIAVDARRVERILRNLIANAIDHAEH
LOVHK_PSE14     FARKQKLQGRVLNLNGLVSSTEPLIE-RTFGPHVTIETDLDPLKNCRIDPTQAEVALLNIFINARDALRP
SASA_SYNJA      SARGSASELQLASLCQPVIEELRIQAKQLQFQA-DIPVDL---PTVHVDPDKIRQVIFNLLDNAIKYTPA
SASA_PROM2      VGTTKWEALQKIDLGNISAEVILELEKFWRLRNIEIDTDISDLPSVFADQRRMRQVLLNLIENAIKFSED
NTRYL_RICPR     FARLPAPKFTKSELVYLVKHIIEARKNDNIVYTYDSNVDQFDF---MCDATQINQVMINVLKNAEESIEG
LUXQ_VIBHA      FSKIEQGKFNIFSFTDTMRTLENIYRPICTNKGVELVIENELDPNVEIFTDQVRQILFNLVSNAVKFTPI
SASA_PROMP      VGTTKWEALQKIDLGNISAEAILELEKFWRLRKIEIDTDISDLPSVYADQRRMRQVFLNLIENALKFSEN
PDHS_BRUO2      ISKIEAGALEAVSLNDAIGEAIALMQPQANRERVIIRSSFSNLPDIVADSRSIKQVALNLLSNAVR-FTA
VIRAL_RHIRD     LSRRRERTARPFNLSALVREIAPSLRV-ALPSEVEVDFNIQSAQMIVEGNPEIEQILMNLCKNAAEACIG
LOVHK_PSESM     FARKQKLQGRVLNLNGLV-SIVEPLIERTFGPEVAIETDLEPLKNCRIDPTQAEVALLNIFINARDALRE
SASA_SYNJB      SARGAASELRIRAVETQLPGLCQIEELWPRIQGKRLQFQADDLPSVHVDPDKIRQVLFNLLDNAIKYTPA
SASA_NOSP7      VGRGKPLSPQKVQLGKVFLDVLEELCDRYTAKSQEVETDISDLPYVYADPERIRQVLVNLLDNAIKYTPE
SRRB_STAAR      XARMDA---EGLSVNKALLDKMKIYRQQADDLGLNMTFNYCKKRVWTYDMDRMDQVLTNLIDNASRYTKP
SASA_PROMA      VGTTRWEALQEANLANIAAEVILELEKFWLSRGIGINTDIADLPNVFADQSRMKQVLLNLIENALKFSND
KINB_PSEAE      FSRYQTGELASCDLVDLLTQAQQRFIPKGEARRVSLQLELGELPRLQLDRLQIERVIDNLLENALRHSSE
SASA_THEEB      AARGPQDKLQIMALRQLCLNFER--KKQHFTTDIPL-----DLPLVYGDGDRIRQVLVNLLDNACKYTPE
NTRYL_RICFE     FARLPAPKFTKSELVYLVKHIVEARKNDNILYKFESNVDQFDF---MCDATQINQVMINLLKNAEESIEG
LOVHK_PSEU2     FARKQKLQGRVLNLNGLVSTTEPLIE-RTFGPEVIIETDLDPLKNCRIDPTQAEVALLNIFINARDALRL
SRRB_STAAW      XARMDA---EGLSVNKALLDKMKIYRQQADDLGLNMTFNYCKKRVWSYDMDRMDQVLTNLIDNASRYTKP
SRRB_STAAU      XARMDA---EGLSVNKALLDKMKIYRQQADDLGLNMTFNYCKKRVWSYDMDRMDQVLTNLIDNASRYTKP
SRRB_STAAS      XARMDA---EGLSVNKALLDKMKIYRQQADDLGLNMTFNYCKKRVWSYDMDRMDQVLTNLIDNASRYTKP
SRRB_STAAC      XARMDA---EGLSVNKALLDKMKIYRQQADDLGLNMTFNYCKKRVWSYDMDRMDQVLTNLIDNASRYTKP
SRRB_STAA8      XARMDA---EGLSVNKALLDKMKIYRQQADDLGLNMTFNYCKKRVWSYDMDRMDQVLTNLIDNASRYTKP
SASA_SYNE7      ATRHSPREVVFEPLLQQVLE--QLHERWRSKQQQLITDVPGDLPTLYADPDRLRQVLVNLLDNAIKYTPP
SRRB_STAAN      XARMDA---EGLSVNKALLDKMKIYRQQADDLGLNMTFNYCKKRVWSYDMDRMDQVLTNLIDNASRYTKP
SRRB_STAAM      XARMDA---EGLSVNKALLDKMKIYRQQADDLGLNMTFNYCKKRVWSYDMDRMDQVLTNLIDNASRYTKP
MTRB_MYCLE      ISRHDAGSVEAVDLRVMVNNALGNVGHLAEEAGIELLVDMPVDEVIAVDARRVERILRNLIANAIDHSEH
NTRY_AZOC5      FARMPKPVVDSQDMSEIIRQTV-------FLMRVEVVFD-SEVPPAMFDRRLVSQALTNILKNAAEAIDV
SASA_PROM0      VGTTKWEALQKIDLGNISAEVILELEKFWRLRNIEIDTDISDLPSVFADQRRMRQVFLNLIENAIKFSRD
SASA_SYNS3      VGSTRWEALQRLDLTSVAAEAILELEKLWLGRDVTIHTDIADLPKVFADQRRMRQVLLNLLENALKYTPN
MTRB_MYCPA      ISRHDAGSVEAVDLRSTVQSALSNVGHLAEDAGIELQVELPAEEVIAVDTRRVERILRNLIANAIDHAEH
YCF26_PORYE     LSRLESDQLQSMDLVSAIEQTVRTYQLSAKDKKIDLHIDIEELPCILGNYSLVLQILANLIGNSLKFTHS
SASA_PROMS      VGTTKWEALQKIDLGNISAEVILELEKFWRIRNIEIDTDISDLPSVFADQRRMRQVFLNLIENAIKFSKD
SASA_PROM9      VGTTKWEALQKIDLGNISAEAILELEKFWRLRDIEIDTDISDLPSVFADQRRMRQVFLNLIENAIKFSKD
NTRYL_RICCN     FARLPAPKFTKSELVYLVKHIVEARKNDHILYKFESNVEQFDF---MCDATQINQVMINLLKNAEESIEG
SASA_ANASP      VGRGTDTELQKTEIGLLCLEVLGELRDRYTTKAQKVETDIPQLPCVYADPERIRQVLINLLDNAIKYTPE
SASA_SYNPX      VGTTRPQRLDLASVSEVILELEKLWLGR----NVEIRTDISDLPKVFADQRRMRQVLLNLLENALKYTGN
SASA_ANAVT      VGRGTDTELQKTEIGLLCLEVLGELRDRYTTKAQKVETDIPQLPCVYADPERIRQVLINLLDNAIKYTPE
NTRYL_RICTY     FARLPAPKFTKSELVYLVKHIIEARKNDNIVYTCDSNVDQFDF---MCDATQINQVMINVLKNAEESIEG
LUXQ_VIBPA      FSKIEQGKFNIFSFADTMRTLENIYRPICENKGVELVIENQLDGNVEIFTDQVRQILFNLVSNAVK-FTP
PHOR_SHIDY      LSKIEAAPTQLLNEKVDVPMMLRVVEREAQTLSQKFTFEIDNALKVSGNEDQLRSAISNLVYNAVNH-TP
NTRB_PROVU      PQHPGKKTHQ--SIHHVVERVAQLISLEC-PENVTLLKDYDSLPELSHYPDQIEQVLLNITRNALQAVEK
SASA_SYNS9      VGTTRPQRLDLASVSEVILELEKLWLGR----NVEIRTDISDLPKVFADQRRMRQVLLNLLENALKYTGN
SASA_CYAP8      ASKTMTAQLSVYYLCQDILDYREIFKEKSLTLVKDIPQD---IPTVYADEELIRQVIVNLLDNAIKYTPS
PHOR_KLEPN      LSRIEAAPALAMNDRIDVPMMLRVVEREAQTLSQELIFTVDEQLKVLGNEEQLRSAISNLVYNAVNH-TP
YVRG_BACSU      TYRLKPIERKLTSLIPFFKNVIEDFKKNPFSEGYDISVSKEEHIEFALDEAWFRRILENLLGNAVKH-NG
PHOR_ECOLI      LSKIEAAPTHLLNEKVDVPMMLRVVEREAQTLSQKKQTFTFEIDNVSGNEDQLRSAISNLVYNAVNH-TP
ARCB_SHIFL      MDKMERRKVQLDNQPVDFTSFLADLENLSALQAQQKGLRFNLEPTVITDGTRLRQILWNLISNAVK-FTQ
ARCB_ECOLI      MDKMERRKVQLDNQPVDFTSFLADLENLSALQAQQKGLRFNLEPTVITDGTRLRQILWNLISNAVK-FTQ
ARCB_ECO57      MDKMERRKVQLDNQPVDFTSFLADLENLSALQAQQKGLRFNLEPTVITDGTRLRQILWNLISNAVK-FTQ
YCF26_PORPU     LSRLESDQLQPTDLVSAVEQTIRTYQLSAKDKRIDLHIDIEQLQCVLGNYNLILQILANLVVNSLKFTHP
SASA_MICAN      LHQSKFYLQSLCQ--EILSQFTDTFQEKTLIFQSDIPQDL---PPVYADEELIRQVIINLLENGIKYTPA
DSPA_SYNY3      LSKLESSKLDAVDLYQLIEQSLRSYQLNAKDKQLQLEKILDDLPFALGNYDLLLQVMTNLIGNSFKFTKA
Y1002_RHIME     MSKIEAGRYELLLEPFRVAEAIAACEAMLSHQAREKGVRLTSRVTINADQRAFQQILINLIGNAIKFTDR
PGTB_SALTY      RAELETP-LYPVDLRQ---TFVAAWELLAMRHQSRQGALSLPTDTVWVSGDEVRQVLVNVLANALDACSH
BVGS_BORBR      IAKIEAGKFDLAALRALPEGAIRVFDGLARQKGIELVLDIVGVDDVLIDPLRMKQVLSNLVGNAIKTTEG
BVGS_BORPA      IAKIEAGKFDLAALRALPEGAIRLFDGLARQKGIELVLDIVGVDDVLIDPLRMKQVLSNLVGNAIKTTEG
CHVG_AGRT5      ASRLDAELARALDLDVLMKGLVDI-SRQISTKKKSVAIDYGAKTSFVVNGHDLRQIVTNLIENARSFVSE
KDPD_ECOLI      MARIQSGKKEWLTLEEVVGSALQMLEPGL---SSPINLSLPEPLTLIVDGPLFERVLINLLENAVKYAGA
DCTS_BACSU      RS------IQNDAAAGLLLSKIRRGRELGIAVHIDENSSLQQFPEHV-DQHDIVVLLGNLIENAFGSFEQ
LUXQ_VIBVU      FSKIEQGKF---NIKKRDFNFYNIYRPICREKGVSFEIH-NQIPLLHTDQVRLNQIMFNLISNAVK-FTP
RPRX_BACFR      MSRQKATKMKELDANELITGVINTFALKVERYNGKITSNLEATPVIFADEMHITNVIFNLMDNAVKYKKP
LUXQ_VIBVY      FSKIEQGKF---NIKKRDFNFYNIYRPICREKGVSFEIH-NQIPLLHTDQVRLNQIMFNLISNAVK-FTP
DOKA_DICDI      FSKLEYGKVTLENESFELLPMIEVLDSQATAANRK-GIDLIFVPVIFGDRNSLKKVLLNLVGNAVKFTET
BVGS_BORPE      IAKIEAGKFDLAALRVLPEGAIRVFDGLARQKGIELVLDIVGVDDVLIDPLRMKQVLSNLVGNAIKTTEG
LUXQ_VIBCH      FSRLEQGKFRIQKLKELVCAIDRIYRPLCNEKGLELVVNSNITTAAIVRSDQIRQILFNLLNNAIKFTH-
SAES_STAAW      TGKTYPPEL--IQLDQLLVSILQPYEQRIKHENRTLEVNFSEIDAFYQYRTPLERILTNLLDNALKFSNV
SAES_STAAS      TGKTYPPEL--IQLDQLLVSILQPYEQRIKHENRTLEVNFSEIDAFYQYRTPLERILTNLLDNALKFSNV
SAES_STAAR      TGKTYPPEL--IQLDQLLVSILQPYEQRIKHENRTLEVNFSEIDAFYQYRTPLERILTNLLDNALKFSNV
SAES_STAAN      TGKTYPPEL--IQLDQLLVSILQPYEQRIKHENRTLEVNFSEIDAFYQYRTPLERILTNLLDNALKFSNV
SAES_STAAM      TGKTYPPEL--IQLDQLLVSILQPYEQRIKHENRTLEVNFSEIDAFYQYRTPLERILTNLLDNALKFSNV
SAES_STAAE      TGKTYPPEL--IQLDQLLVSILQPYEQRIKHENRTLEVNFNEIDAFYQYRTPLERILTNLLDNALKFSNV
SAES_STAAC      TGKTYPPEL--IQLDQLLVSILQPYEQRIKHENRTLEVNFNEIDAFYQYRTPLERILTNLLDNALKFSNV
SAES_STAAB      TGKTYPPEL--IQLDQLLVSILQPYEQRIKHENRTLEVNFSEIDAFYQYRTPLERILTNLLDNALKFSNV
SAES_STAA8      TGKTYPPEL--IQLDQLLVSILQPYEQRIKHENRTLEVNFNEIDAFYQYRTPLERILTNLLDNALKFSNV
SAES_STAA3      TGKTYPPEL--IQLDQLLVSILQPYEQRIKHENRTLEVNFNEIDAFYQYRTPLERILTNLLDNALKFSNV
DHKD_DICDI      ISRLEAGKMNLVNLGQTVHLIASCFEILAREKSLDFSIITPSEPMMAIDADKMQRVITNLISNAFKFTPS
CHVG_RHIME      LARADAKKVD---LEKLLGDLVEISRQ---IRGSKKPVLLD----FVVDRKRIGQIITNLIENARSFVPE
DCTS_BACHD      VSRGKELGVQV------------IIEKDSEFIDHPEGVTTHDLVVIVG----------NLIDNSLDAFSS
CPXA_ECOLI      MSRNQQKNAETIKANQLWSEVLDAFEAEQMGKSLTVNFPPGPWP-LYGNPNALESALENIVRNALRYSHT
CPXA_ECOL6      MSRNQQKNAETIKANQLWSEVLDAFEAEQMGKSLTVNFPPGPWP-LYGNPNALESALENIVRNALRYSHT
CPXA_ECO57      MSRNQQKNAETIKANQLWSEVLDAFEAEQMGKSLTVNFPPGPWP-LYGNPNALESALENIVRNALRYSHT
CITS_BACHD      --RVNDPTVSAVLLGKI---------SQAQELGIDVDIDSSQLLTPLQERQQLVTMIGNLLENAFDALLA
VANS_ENTFC      ITR---YNLQTITLTKMLVQMTDEFYPQLSAHGKQAVIHAPEDLTVSGDPDKLARVFNNILKNAAAYSED
RSSA_SERMA      LAKLEPLKIEAVDIYAEIGKCIAQHVPYALEKDVELSLDGSEDVVVSTDRRALIAIFTNLLDNALKYAPP
PHYA_ANASP      FAVEGVSLMQ--TLIDDVLAYSKV-DTQAILTEVEKALDLGNLPTVMAGSTQLMQLFQNLIANAIKFRSE
DHKA_DICDI      YS-----KLESRQLKMETLPFSIIETCQAVIHMLSVAVDIPNVPRIIFDAMRMRQVLLNLLSNAIKFTSR
NIFL_AZOVI      MAESKMP----VNLNQLIREVITLCTDQLLAQGIVVDWQPARLPWVMGGESSQRSMIKHLVDNAIESMS-
BAES_ECOLI      LSMSDEGALAYQKAPVDLIPLLEVFRERFASRGLKLQFSLPDSITVFGDRDRLMQLFNNLLENSLRYTDS
SAES_STAES      LNTGRSYPLELIQLDQLLVNILQPYEQHIKQENRTLEVNFTDIDAFYQYRPPIERILTNLLDNALKFSNS
SAES_STAEQ      LNTGRSYPLELIQLDQLLVNILQPYEQHIKQENRTLEVNFTDIDAFYQYRPPIERILTNLLDNALKFSNS
PHY1_SYNY3      YAKVDTQYAQLTDVQEVVDKALANLKQRIEESGAEI--EVGSMPAVMADQIQLMQVFQNLIANGIKFAGD
DCUS_SHIFL      SKINRATDLG----HTLILNS----ESQLPDSGSE-----DQVATLIT-------TLGNLIENALEALGP
DCUS_ECOLI      SKINRATDLG----HTLILNS----ESQLPDSGSE-----DQVATLIT-------TLGNLIENALEALGP
DCUS_ECOL6      SKINRATDLG----HTLILNS----ESQLPDSGSE-----DQVATLIT-------TLGNLIENALEALGP
DCUS_ECO57      SKINRATDLG----HTLILNS----ESQLPDSGSE-----DQVATLIT-------TLGNLIENALEALGP
GACS_PSESY      FSKIEAGKLVLFNLRDLLQDTLTILAPAAHAKQLELVSLVYRDTPLALSGDRLRQILTNLVSNAIK-FTR
DLTS_STRA5      LSREKRSKVNFKKLNLSVLEVLLTYESLAYEEEKCLNDTIEDDVWIVGEESQIKQILIILLDNAIRHSLS
YKOH_BACSU      LAKSH----QGLEVDLKTIDLIKAARASVYQRDILLETDKESL-LVKADEERIKQLLTILLDNAIKYSEK
PHYB_ANASP      FSRRVDLSMQDTDLNEIVHRILDMLSGRIEETGVEIRI-LQLLPVVYCDRIQIGEVFSNLIANSIKYNDK
DLTS_STRA3      LSREKRSKVNFKKLNLSVLEVLLTYESLAYEEEKCLNDTIEDDVWIVGEESQIKQILIILLDNAIRHSLS
TORS_ECO57      YSAIEAGGKNVSVSDELLESTLQLMSGRVKGRPIRLATAIADVPTALMDPRRIRQVITNLLSNALRFTD-
KDPD_CLOAB      MTKEGNTKIKKDXXXXXXXXXXXXQRSSKYFKNHKIKVSVPEVIMVSMDGSLIEQVIINLLDNASKFSPK
MAK1_SCHPO      LSKVRAGMMQRFSVRAMMEDANETLGTLAFSKGIELNVDI-DVPDIVFDNMRMRQVALNVIGNAIKFTNV
YCBM_BACSU      LAKDKEIPITKVHMNDICKRNILHYYDAVQSKGFQAAIDIPDTPVYAANEEALDRILQNLLSNAIQYGAA
DIVL_CAUCR      IAGEMALEIEDIRVSDLLLNAQERALKDAQLGGVTLAVECEEVGLIRGDGKRLAQTLDHLVENALRQTPP
BARA_SHIFL      FSKLEAGKLILESLRSTLDEVVTLLAHSSHDKGLELTLNISDVPDNVIDPLRLQQIITNLVGNAIK-FTE
BARA_ECOLI      FSKLEAGKLILESLRSTLDEVVTLLAHSSHDKGLELTLNISDVPDNVIDPLRLQQIITNLVGNAIK-FTE
BARA_ECOL6      FSKLEAGKLILESLRSTLDEVVTLLAHSSHDKGLELTLNISDVPDNVIDPLRLQQIITNLVGNAIK-FTE
BARA_ECO57      FSKLEAGKLILESLRSTLDEVVTLLAHSSHDKGLELTLNISDVPDNVIDPLRLQQIITNLVGNAIK-FTE
ENVZ_SALTI      YLRTQEMPMEMADLNSVLGEVIAA--ESGYEREINTALQAGSIQ-VKMHPLSIKRXXXXXXXXXXRYGNC
DHKB_DICDI      XSKIEAGKMEIISILKMLDNSIRIVSKNIYEKGLDLCIFIDPNVPVIVNGDQIKQILLNFLSNSIKFTN-
ACOR_BACSU      ----------------------------------------------------------------------
TORS_ECOLI      YSAIEAGGKNVSVSDELLESTLQLMSGRVKGRPIRLATAIADMPCALMDPRRIRQVITNLLSNALRFTD-
ENVZ_SALTY      YLRTQEMPMEMADLNSVLGEVIAA--ESGYEREINTALQAGSIQ-VKMHPLSIKRXXXXXXXXXXRYGNG
CITS_BACSU      ----HSQQVQAILLGKI---------SKASEKKVKLVIDLAPLPAH-IGLSHLITIIGNLIDNAFEAVAE
ARLS_STAS1      NNNSRDGEIENVEINQEIASRIKTFEFDAFPKPLNIKID----------RYQFEQMLIIFIDNAMKYDQI
YCLK_BACSU      YEKIRS---QQITLNKLDVPLIEVFEQQAEEKQNKLMIQVEDHVIVHADYDRFIQILVNITKNSIQ-FTQ
SENX3_MYCS2     LSRERLPDLDAVDVDSIVSEAVSRHKVAADNSQISITTDAPTGYRVLGDEGLLVTAIANLVSNAI-AYSP
CUSS_ECOL6      LAQADNPEKKMLNLADEVGKVFDFFEALAEDRGVELRF-VGDECQVAGDPLMLRRALSNLLSNALRYTPT
ARLS_STAHJ      XXXXQALEFEEVNINEEIRSRIKSLKQ--LHPDYQFKTHLSKKPTLQINRHQFEQLLLIFIDNAMKYDKD
SILS_SALTY      LAQADPDRVRFDLQSQNSLKVFRVFEALGPKETPILLLKFNGMPCLVEDPQMFRRAINNLLSNALRYTPE
PHOR_PSEAE      EATDYPGDNKPVAVDALLASIRN--DAQALSAGRNHRISLDAAPAVQLSEAELRSAFSNLVFNAVKYTPD
YFHK_ECOLI      YNRKQADELENVELAPLVETVVSAHSLPARAKMMHTDVDL-KATACLAEPMLLMSVLDNLYSNAVHYGAE
MAK2_SCHPO      SGKMKLEPDKVFDVEENIADCIELVYPSLSSKPVQISYDIPNVPALLADSAKLRQVITNLLGNSVK-FTT
DHKL_DICDI      IEAGKDIDYESFDFNATVSQVVESMAQRVQSKGLELYVD-PKIPNILIPSSRLNQILTNLLGNSLKFTD-
IRLS_BURPS      LARSDNAQLDAAAQAERVAGYYEPMAEDADVRIVVRGK-----AEVRADALLYHRALSNLISNALNHAPR
ETR1_CUCSA      LSRLEDGSLQTFNLHAVFKEVLNLIKPVTLVKKLSLTLHLGDLPVFAVDEKRLMQAILNVVGNAVK-FSK
DHAR_CITFR      ----------------------------------------------------------------------
CUSS_ECOLI      LAQADNPEKKMLNLADEVGKVFDFFEALAEDRGVELRF-VGDKCQVAGDPLMLRRALSNLLSNALRYTPT
SPAK_BACSU      LSKTEDAHLEKASVDELTETLVKDISAYKGNKNINISFKKENLKEAKIDWQLLHRALLNILTNAVDYTPE
RPFC_XANCP      ISAIEAGKIRIFSLREMIGSVNLILQPQARGRRLEYGTQVADVPDLLKDTAHLRQVLLNLVGNAVKFTEH
RPFC_XANC8      ISAIEAGKIRIFSLREMIGSVNLILQPQARGRRLEYGTQVADVPDLLKDTAHLRQVLLNLVGNAVKFTEH
LUXN_VIBHB      LSSPEHEPIAMTSIHKAVDQAVSHFENEKIIERIRLPQHTDFVAKL--NETLFNFVIFNLIRNAIYYFDS
LUXN_VIBHA      LSSPEHEPIAMTSIHKAVDQAVSHFENEKIIERIRLPQHTDFVAKL--NETLFNFVIFNLIRNAIYYFDS
ETR1_PRUPE      LSRLEDGSLQTFNLHSVFREVHNLIKPVASVKKLSVSLNLADLPVQAVDEKRLMQIVLNVVGNAVK-FSK
ETR1_CUCMR      LSRLEDGSLQTFNLHAVFKEVLNLIKPVTLVKKLSLTLHLGDLPVFAVDEKRLMQAILNVVGNAVK-FSK
ARLS_STAES      XXXDRVNECENVDVNSEIQSRVKSL--QHLHPDYTFETHLATKPILKINRHQFEQLLLIFIDNAMKYDTE
ARLS_STAEQ      XXXDRVNECENVDINSEIQSRVKSL--QHLHPDYTFETHLATKPILKINRHQFEQLLLIFIDNAMKYDTE
MPRB_MYCVP      LTRDDAGNAETVEITEVIDRSLERVRRRRN----DIQFDVAVTPWQVYDAAGLGRAVLNLLDNAAKWSPP
CUSS_ECO57      LAQADNPEKKMLNLADEVGKVFDFFEALAEDRGVELQF-VGDECQVAGDPLMLRRALSNLLSNALRYTPP
AFSQ2_STRCO     -------------------------DARAWLDAVDLDAERGVHARL--DPRRLDVILANLIGNALKHGGS
ETR1_SOLLC      LSRLEDGSLQTFNLHALFREVHSLIKPIASVKKLFVTLSLSDLPEYVIDEKRLMQILLNVVGNAVK-FSK
ENVZ_SHIFL      YLRTQEMPMEMADLNAVLGEVIAA--ESGYEREIETALYPGSIE-VKMHPLSIKRXXXXXXXXXXRYGNG
ENVZ_ECOLI      YLRTQEMPMEMADLNAVLGEVIAA--ESGYEREIETALYPGSIE-VKMHPLSIKRXXXXXXXXXXRYGNG
MPRB_MYCPA      LTRDDAGQVEPVDMSDVIDRSLERVRRRRN----DIHFDVDVTPWQMYDAAGLSRAVLNLLDNAAKWSPP
ETR2_SOLLC      LSRLEDGSLQTFNLHALFREVLNLIKPVAAVKKLFVTLSLSDFPEVAIDEKRLMQILLNVVGNAVK-FSK
CIAH_STRR6      LARPELAEVPTSFFNTTFTNYEMIASENNRVFRFENRIHR----TIVTDQLLLKQLMTILFDNAVKYTEE
CIAH_STRPN      LARPELAEVPTSFFNTTFTNYEMIASENNRVFRFENRIHR----TIVTDQLLLKQLMTILFDNAVKYTEE
RCSC_ECOLI      ------------------------------------------------DPMRLQQVISNLLSNAIKFTDT
DHKK_DICDI      LSKLEANQMGPFRMRELTQQICHVLSGQANEKNIHLSCEVSDIPSILLDSGRILQILMNLTGNALK-FTQ
CQSS_VIBCH      LLRVSPASFKKHSVVDVIEKAVKTFPYKNAADQHSVELEVHQPFDFFGSDTLLTYALFNLLKNAFYYQKE
YTH3_RHOER      ----------------------------------------------------------------------
MPRB_MYCA1      LTRDDAGQVEPVDMSDVIDRSLERVRRRRN----DIHFDVDVTPWQMYDAAGLSRAVLNLLDNAAKWSPP
HSSS_STAS1      LDFDDD-----IQLNQLIK---KIIRHEQFSANEKDLIIMSDLETISMNGNELHQAFQNLITNAIKYSTT
ETR1_TOBAC      LSRLEDGSLQTFNLHVLFRKVLNLIKPIASVKNCLSRLTCLQIPEFAIDEKRLMQILLNVVGNAVK-FSK
DHKC_DICDI      YKRIRSGKL---TLNNVDFNLCHVIEDVCAMVSPQAQAKSLQIASFIFDPIRLRQVLLNLIGNGLKYTN-
BASS_SALTY      LARSSGNYQEVKLLEDVILPSYD--ELNTMLETRQQTLLLPESAADVVDATLLRMLLRNLVENA-HRYSP
ARLS_STAAW      LTKGDSSEAQTVHINDEIRS--RIHSLKQLHPDYQFDTDLSKNLEIKMKPHQFEQLFLIFIDNAXXXXXX
ARLS_STAAS      LTKGDSSEAQTVHINDEIRS--RIHSLKQLHPDYQFDTDLSKNLEIKMKPHQFEQLFLIFIDNAXXXXXX
ARLS_STAAR      LTKGDSSEAQTVHINDEIRS--RIHSLKQLHPDYQFDTDLSKNLEIKMKPHQFEQLFLIFIDNAXXXXXX
ARLS_STAAN      LTKGDSSEAQTVHINDEIRS--RIHSLKQLHPDYQFDTDLSKNLEIKMKPHQFEQLFLIFIDNAXXXXXX
ARLS_STAAM      LTKGDSSEAQTVHINDEIRS--RIHSLKQLHPDYQFDTDLSKNLEIKMKPHQFEQLFLIFIDNAXXXXXX
ARLS_STAAC      LTKGDSSEAQTVHINDEIRS--RIHSLKQLHPDYQFDTDLSKNLEIKMKPHQFEQLFLIFIDNAXXXXXX
ARLS_STAAB      LTKGDSSEAQTVHINDEIRS--RIHSLKQLHPDYQFDTDLSKNLEIKMKPHQFEQLFLIFIDNAXXXXXX
ARLS_STAA8      LTKGDSSEAQTVHINDEIRS--RIHSLKQLHPDYQFDTDLSKNLEIKMKPHQFEQLFLIFIDNAXXXXXX
ARLS_STAA3      LTKGDSSEAQTVHINDEIRS--RIHSLKQLHPDYQFDTDLSKNLEIKMKPHQFEQLFLIFIDNAXXXXXX
RCSC_SALTY      ------------------------------------------------DPMRLQQVISNLLSNAIKFTDI
RCSC_SALTI      ------------------------------------------------DPMRLQQVISNLLSNAIKFTDI
CUTS_STRLI      ----------------------------------------------------LERIALNLVQNAVRYVAG
CUTS_STRCO      ----------------------------------------------------LERIALNLVQNAVRYVAG
SP2AB_BACME     --------------NQMNLQFSALSQNESFAR-VTVASFITQLDPTMDELTEIKTVVSEAVTNAIYESNS
GRAS_STAAR      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGFDIDFKVDNHVYTDIKWCRMIIRQILSNALK-YSE
ETR1_PELHO      LSRLEDGSLQTFNLHAVFRQVFNLIKPIASVKKLFITLNVSDLPEYVIDEKRLVQIMLNVVGNAVK-FSK
ETR1_MALDO      LSRLEDGSLQTFNLHSVFREVHNMIKPVASIKRLSVTLNIADLPMYAIDEKRLMQTILNVVGNAVK-FSK
CREC_ECOLI      QARLENRQEVVLTAVDVAALFRRVSEART-VQLAEKKITLHVTPTVAAEPALLEQALGNLLDNAIDFTPE
PHOR_HAEIN      LA-----KIETTSDKDF-----RKFDMSAMINSLRKDTDIXXXXXXFGNESQLRSAVSNLIYNAIKHSGK
GTCS_ANEMI      LATLDSPDLPSATGSEIAIAYFDQFEQN------KFSLDL-KIPTIRMNRNLLYRALSNLLSNTLK-HNP
ETR1_ARATH      LSRLEDGSLQTFNLHTLFREVLNLIKPIAVVKKLPITLNLADLPEFVVDEKRLMQIILNIVGNAVK-FSK
BCES_BACSU      -------SVEFIQLQPLIFKEIKDLQSWCIQKGIGFDIQL-EAKEVLSDAKWLAFIIRQLLTNAVKYSEA
QSEC_HAEIN      LSRLD--NLQALETLQLLEAIVQSLISERYFVAEKRKI------TLVFEKESVSLMLRNLLDNAIKYCPE
PFES_PSEAE      LAWMDTERPQLPTEPVLALSVWEALRDDACFESARLPCRLGVDCRVEVHLDSLAQAMENLLRNAIRHSPE
GRAS_STAHJ      LTRLESKNFEETSLKRLVIDEVQLTRHISQAKGIGYDLDLETNLDVYTDVKWCRMMIRQILSNSLKYSQG
RSTB_ECOLI      YARLDRPQ------NELHLSELWLSTHLADIQAVTPDKTV-RIKTLVLDMRLMERVLDNLLNNALRYCHS
MPRB_MYCLE      LTRDDAGQVVHEPIDMSXXXXXXXXXXXXXXNDIHFDVQIGW--QIYGDAAGLSRAVLNLMDNAAKWSPS
ETR2_PELHO      LSRLEDGSLQTFNLHALLREVHNLIKPIASVKKLCISLNVADLPEYAVDEKRLVQIILNVVGNAVK-FSK
YEDV_ECOLI      LARADKVKLDSLSLNKEVENLLDYLEYLSDEKEICFKVECNQ--QIFADKILLQRMLSNLIVNAIRYSPE
ETR1_BRAOL      LSRLEDGSLQTFNLHTLFREVLNLIKPIAVVKKLPITLNLADLPEFVVDEKRLMQIILNIVGNAVK-FSK
GLNK_BACSU      ----------------------------------------------------VLSIINNLTANAVEAMDE
DHAR_ECOLI      ----------------------------------------------------------------------
CZCS_RALME      LARADSANV-ALELTELQLN-AELRKLSAYFSVLSVVIRVSGDATLVADAILFQRAINNVLSNAVRHAWP
YXDK_BACSU      SSRERDFKIEAVSLSELLQSVIQSYKRFFIQYRVYPKMNVCDDHQIYTDAKWLKFAIGQVVTNAVK-YSA
SENX3_MYCTU     LSRERLPNMTDVDVDTIVSEAISRHKVAADNADIEVRTDAPSNLRVLGDQTLLVTALANLVSNAIAYSPR
SENX3_MYCBO     LSRERLPNMTDVDVDTIVSEAISRHKVAADNADIEVRTDAPSNLRVLGDQTLLVTALANLVSNAIAYSPR
MPRB_MYCSS      LTRDEAGGVVYETVDMAEXXXXXXXXXXXXXNDIEFDVNVVGWQ-VYGDAAGLARAVLNLLDNAAKWSPP
MPRB_MYCSK      LTRDEAGGVVYETVDMAEXXXXXXXXXXXXXNDIEFDVNVVGWQ-VYGDAAGLARAVLNLLDNAAKWSPP
MPRB_MYCSJ      LTRDEAGGVVYETVDMAEXXXXXXXXXXXXXNDIEFDVNVVGWQ-VYGDAAGLARAVLNLLDNAAKWSPP
MALK_BACSU      --------------SSVLAGFLLGKQSFIREQGANLDIECNGVPSVIHEXXXXXXXXXXXXXDAVADMPK
KDPD_MYCTU      SSRLAAPQLRRAYLEEAVQRALVSIGKGAYRSGIDRXXXXXXXXXXXXXXGLLERVLANLIDNALR---Y
CQSS_VIBHB      IIRVSRSTFKKHSAQSVVESAIESFSYKRSTDRFAISLDVRSEFDFLGSDTLLKYVMYNLFKNAFHHRSS
PCOS_ECOLX      LARSEHGLLRAAELNELR----ELFEPLADETGKTITVE-GE-GVVAGDSDMLRRAFSNLLSNAIK-YSP
KDPD_RATRA      ---------------------------------------------VLADPGLLQRVLVNLLANALRFSPE
MPRB_MYCS2      LTREDPEPVDMADVIDRSLERVRRRRND-------IEFDVDVIGWQVFDAQGLGRAVLNLLDNAAKWSPP
GRAS_STAAN      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGXXXXXXXXXXXXXXXKWCRMIIRQILSNALK-YSE
GRAS_STAAM      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGXXXXXXXXXXXXXXXKWCRMIIRQILSNALK-YSE
GRAS_STAA9      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGXXXXXXXXXXXXXXXKWCRMIIRQILSNALK-YSE
GRAS_STAA2      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGXXXXXXXXXXXXXXXKWCRMIIRQILSNALK-YSE
GRAS_STAA1      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGXXXXXXXXXXXXXXXKWCRMIIRQILSNALK-YSE
NISK_LACLA      LLNDENDYKATISLEDFLIDLVELEELSTTYQVDYQLVKKTDLTTFYGNTLALSRALINIFVNACQYAK-
ETR1_PASED      LSKLEDGSLQLDSVFREVLNLIKPIASKKXXXXXXXAPDLPEYA--VGDEKRLIQIILNIVGNAMK-FSK
BCES_BACHD      VEK--------VNLESVLHQEIKTLQSWCIQKGIGFDLQL-EVTDVLTDAKWLSFILRQLLSNAVKYSEA
MPRB_MYCUA      LTRGDAGVVVHEPVDMAEXXXXXXXXXXXXXNDIHFDVDVVGWQ-VYGDAAGLSRAALNLMDNAAKWSPP
HSSS_STAHJ      ----------------------------------------------------LHQACSNLIQNAIKYSNP
GRAS_STAAW      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGXXXXXXXXXXXXXXIKWCRMIIRQILSNALK-YSE
GRAS_STAAT      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGXXXXXXXXXXXXXXIKWCRMIIRQILSNALK-YSE
GRAS_STAAS      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGXXXXXXXXXXXXXXIKWCRMIIRQILSNALK-YSE
GRAS_STAAE      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGXXXXXXXXXXXXXXIKWCRMIIRQILSNALK-YSE
GRAS_STAAC      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGXXXXXXXXXXXXXXIKWCRMIIRQILSNALK-YSE
GRAS_STAAB      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGXXXXXXXXXXXXXXIKWCRMIIRQILSNALK-YSE
GRAS_STAA8      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGXXXXXXXXXXXXXXIKWCRMIIRQILSNALK-YSE
GRAS_STAA3      ITRLESQRKDMVSLKRMVIDEIQLTRHISQVKGIGXXXXXXXXXXXXXXIKWCRMIIRQILSNALK-YSE
CITA_KLEPN      ------------------------------------------LPTALSHNEWIS-IVGNLLDNAYNASQP
DPIB_ECOLI      ---------EAFADRQVALLFGKVQRAREL--GLKMGSQLSQLPP-GLDSTEFAAIVGNLLDNAFEASSD
BPHY_PSEAE      -----------------------VCETDVAYPGLVIEIAIDPQVRAVVDPDRYAQVAANLLSNA-RHHGL
MPRB_MYCBP      LSRGDAGEVVHEPVDMAXXXXXXXXXXXXXXXXIHFDVEVIGWQ-VYGDTAGLSRMALNLMDNAAKWSPP
MPRB_MYCBO      LSRGDAGEVVHEPVDMAXXXXXXXXXXXXXXXXIHFDVEVIGWQ-VYGDTAGLSRMALNLMDNAAKWSPP
HSSS_STAAT      XXXXXXXFDDKIQVNQLIKDIIRHEQFAADEKSLIILADLESI-NFLGNQRLLHQALSNLLINAIKYTDV
HSSS_STAAE      XXXXXXXFDDKIQVNQLIKDIIRHEQFAADEKSLIILADLESI-NFLGNQRLLHQALSNLLINAIKYTDV
HSSS_STAAC      XXXXXXXFDDKIQVNQLIKDIIRHEQFAADEKSLIILADLESI-NFLGNQRLLHQALSNLLINAIKYTDV
HSSS_STAA8      XXXXXXXFDDKIQVNQLIKDIIRHEQFAADEKSLIILADLESI-NFLGNQRLLHQALSNLLINAIKYTDV
HSSS_STAA3      XXXXXXXFDDKIQVNQLIKDIIRHEQFAADEKSLIILADLESI-NFLGNQRLLHQALSNLLINAIKYTDV
DHKG_DICDI      LSKVEQGKTKLNLTNFNLVSFLEAISPNAHLKGVYIALCLSKIP-VIGDINILRQVIVNLLTNAIK----
YVCQ_BACSU      TARLEEVKPQTFDLAEMVRSLINQ-EKRQFIKR-RLFPTLHVPPNAVISSDQVEQILFNALKYSKQGVGD
SP2AB_THETN     --------------NMMELKFLSKSQNESFARTVVAAFAAQLDPTIIADKTAVSEAVTNCIIHAYE--NK
MPRB_MYCTU      LSRGDAGEVVHEPVDMAXXXXXXXXXXXXXXXXILFDVEVIGWQ-VYGDTAGLSRMALNLMDNAAKWSPP
MPRB_MYCTA      LSRGDAGEVVHEPVDMAXXXXXXXXXXXXXXXXILFDVEVIGWQ-VYGDTAGLSRMALNLMDNAAKWSPP
BASS_ECOLI      LARAGQ------SFSSGNYQHVKLLEDVILPSYDELSTMLDQLPTVQGDATLLRMLLRNLVENAHRYSPQ
SP2AB_THEPX     --------------NMMELNFLSKSQNESFARTVVAAFAAQLDPTIIADKTAVSEAVTNCIIHGYE--NK
SP2AB_THEP3     --------------NMMELNFLSKSQNESFARTVVAAFAAQLDPTIIADKTAVSEAVTNCIIHGYE--NK
PHOQ_SHIFL      RASMRGGTLLSRELHPLLDNLTSALNKVYQRKGVNISLDISPEISFVGEQNDFVEVMGNVLDNACKYC--
PHOQ_ECOLI      RASMRGGTLLSRELHPLLDNLTSALNKVYQRKGVNISLDISPEISFVGEQNDFVEVMGNVLDNACKYC--
PHOQ_ECOL6      RASMRGGTLLSRELHPLLDNLTSALNKVYQRKGVNISLDISPEISFVGEQNDFVEVMGNVLDNACKYC--
SP2AB_GEOTN     --------------NEMHLQFSARSENESFAR-VTVAAFVAQLDPTIDELTEIKTVVSEAVTNAIHGYNN
SP2AB_GEOKA     --------------NEMHLQFSARSENESFAR-VTVAAFVAQLDPTMDELTEIKTVVSEAVTNAIHGYNN
SP2AB_CLOPE     --------------NKMRLEFLAKSENEGFAR-VSVSAFIAQLDPTIEELTDIKTAVSEAVTNAIHGYEC
SP2AB_CLOP1     --------------NKMRLEFLAKSENEGFAR-VSVSAFIAQLDPTIEELTDIKTAVSEAVTNAIHGYEC
HSSS_STAAW      XXXXXXXXXDKIQVDQLIKDIIRHEQFAADEKSLIILADLESI-NFLGNQRLLHQALSNLLINAIKYTDV
HSSS_STAAS      XXXXXXXXXDKIQVDQLIKDIIRHEQFAADEKSLIILADLESI-NFLGNQRLLHQALSNLLINAIKYTDV
SP2AB_BACST     --------------NEMHLQFSARSENESFAR-VTVAAFVAQLDPTTDELTEIKTVVSEAVTNAIHGYNN
HSSS_STAAN      XXXXXXXFDDKIQVDQLIKDIIRHEQFAADEKSLIILADLESI-NFLGNQRLLHQALSNLLINAIKYTDV
HSSS_STAAM      XXXXXXXFDDKIQVDQLIKDIIRHEQFAADEKSLIILADLESI-NFLGNQRLLHQALSNLLINAIKYTDV
HSSS_STAA9      XXXXXXXFDDKIQVDQLIKDIIRHEQFAADEKSLIILADLESI-NFLGNQRLLHQALSNLLINAIKYTDV
HSSS_STAA2      XXXXXXXFDDKIQVDQLIKDIIRHEQFAADEKSLIILADLESI-NFLGNQRLLHQALSNLLINAIKYTDV
HSSS_STAA1      XXXXXXXFDDKIQVDQLIKDIIRHEQFAADEKSLIILADLESI-NFLGNQRLLHQALSNLLINAIKYTDV
BPHY_DEIRA      LLSAPPPVRRPTPLGRVVDDVLQDLEPRIADTGASIEV-APELPVIAADAGXXXXXXXXXIGNALTFGGP
SPHS_SYNE7      LSRLEQQKLEAVDLVALLTSVRNSLEPLAAYQGPEQGFVRG-------DRQRLFRLWLNLVDNAIRHSPS
CSEC_STRCO      VARLDGASERAELQDIMLGDFVS---RRVAAKDPAVEVRVIHESEVTTDPRRLERVLFNLLANAARHGRS
TCSB_EMENI      ------------------------------------------------DQHRILQILINLVGNSLKFTPE
SP2AB_BACLD     --------------NEMNIQFTALSQNESFAR-VTVAAFIAQLDPTMDELTEIKTVVSEAVTNAIYENSG
SP2AB_ANOFW     --------------NEMHLQFSALSQNESFAR-VTVAAFVAQLDPTLDELTEIKTVVSEAVTNAIYENDP
HSSS_STAAB      XXXXXXXFDDKIQVDQLIKDIIRHEQFAADEKSLIILADLESI-NFLGNQRLLHQALSNLLINAIKYTDV
DHKI_DICDI      V-RPFPFKLRD-TFNQLFKVFYRIIEKKISLT---FSIDPNIADDFYGDQNRLKQILSNLIDNAIK----
SP2AB_BACWK     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
SP2AB_BACHK     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
SP2AB_BACCZ     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
SP2AB_BACCQ     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
SP2AB_BACC7     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
SP2AB_BACC3     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
SP2AB_BACC1     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
SP2AB_BACC0     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
SP2AB_BACAN     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
SP2AB_BACAH     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
SP2AB_BACAC     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
SP2AB_BACAA     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
DHKJ_DICDI      FSKIEAGRLEEFSLRAHLYDALKTLSWRAHQKCIELVCDISDVPSLIGDPGRLRQIVNNLVGNAIK-FTS
ACOR_RALEH      ----------------------------------------------------------------------
TCSA_EMENI      YSKLSSGSF---SLHADMLDIREIVGASSLQEGVELDTEISKLPTRMRDPLRYRQVLQNLVGNAVK-FTE
SP2AB_BACC4     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
SP2AB_BACC2     --------------NEMNLQFSALSQNESFAR-VTVAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
PHOQ_ECO57      RASMHGGTLLSRELHPLLDNLTSALNKVYQRKGVNISLDISPEISFVGEQNDFVEVMGNVLDNACKYC--
SLN1_YEAST      --RTKLEKRDFC-ITDVALQIKSIFGKVAKDQRVRLSISLNLIRTMVLDSNRIIQIVMNLVSNALKFTPV
HSSS_STAAR      XXXXXXXFDDKIQVDQLIKDIIRHEQFAADEKSLIILADLESIDFLG-NQRLLHQALSNLLINAIKYTDV
GRAS_STAES      LTRHRDMYFDYISLKRMVIDEIQVTRHISQAKGIGFELDFKDEQKVYTDVKWCRMMIRQVLSNSLKYSDN
GRAS_STAEQ      LTRHRDMYFDYISLKRMVIDEIQVTRHISQAKGIGFELDFKDEQKVYTDVKWCRMMIRQVLSNSLKYSDN
SP2AB_BACLI     --------------NEMNIQFTALSQNESFAR-VTVAAFIAQLDPTMDELTEIKTVVSEAVTNAIYENSG
CSEC_STRAW      VARLDGASERA-ELQDIMLG--EFVSRRVAAKDADIEVRVVHESEVTTDPRRLERVLFNLLANAARHGKP
LYTS_BACAN      -------------------------------------------------------VLQLLVENALRHAFP
DHKH_DICDI      LSKLEENKITEFYPTKIVEDSVDILSSQAEQKKLDIIFQLNCLSKVVGDFYRIRQVLTNLISNSVKFTPA
LYTS_BACCR      -------------------------------------------------------VLQLLVENALRHAFP
SP2AB_BACCR     --------------NEMNLQFSALSQNESFAR-VHRAAFIAQLDPTMEELTEIKTVVSEAVTNAIYEGNA
CSSS_BACSU      -------------------------------------IDVEEDILMPGDPEQWNKLLENILENQIRYAET
COPS_PSESM      LAKSDVPEAVELDLRTVISKLFGYYEFLAEDKGIQ--LQASGNASIFADSVMIDRVVSNLLSNALRYTSS
SP2AB_CLOPS     --------------NKMRLEFLAKSENEGFAR-VSVSAFIAQLDPTIEELTDIKTAVSEAVTNAIHGYEC
SEX3_MYCLE      LSRERLPNVTDIDVDIIVSEAIARHKVAADTAAIEVRTDPPSGLRVLGDQTLLVTALANLVSNAI-AYSP
REGB_RHOS4      RAGKDDLQMRQAPLGEVLREAAEPHVG----RGKRVEFDLDERQPVILRRPEVIHGLRNLIQNAVDF--A
QSEC_SALTY      LSRLDSQDVAEISLEELLQSAVMDIYHPAQQANIDVRLQLNAHDVIRTGQPXXXXXXXXXXXDNAIRYSP
QSEC_SALTI      LSRLDSQDVAEISLEELLQSAVMDIYHPAQQANIDVRLQLNAHDVIRTGQPXXXXXXXXXXXDNAIRYSP
DHKE_DICDI      ----------------------------------------------------------------------
PHOQ_SALTY      RASMRGSGVELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYC--
PHOQ_SALTI      RASMRGSGVELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYC--
PHOQ_SALPA      RASMRGSGVELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYC--
PHOQ_SALCH      RASMRGSGVELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYC--
GRAS_STAS1      LTRNKDMYFEHVPLKRLVIEEIQITRYISQSKGIGYDLDFEDTLNVYTDRMMIRQVLSNAVKYSEESM--
CNPD_PELLD      ----------------------------------------------------------------------
QSEC_ECO57      LSR---------------------LDSLDNLQ------DVAEIPL----EDLLQSSVMDIYHTAQQALNV
NREB_STAAR      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGVKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
CHEA_THEMA      --------------------------------------------------EEIGEPLLHLLRNAIEERIA
YQIR_BACSU      TRRPVRGVRMKVGPNEVIVNVAPVIVDGILKGSVGVIHDVSEIKMLTAELNRARQIIRTL----------
NREB_STAAW      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGIKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
NREB_STAAT      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGIKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
NREB_STAAS      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGIKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
NREB_STAAN      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGIKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
NREB_STAAM      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGIKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
NREB_STAAE      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGIKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
NREB_STAAC      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGIKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
NREB_STAAB      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGIKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
NREB_STAA9      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGIKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
NREB_STAA8      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGIKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
NREB_STAA3      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGIKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
NREB_STAA2      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGIKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
NREB_STAA1      DIRNMSVELRPASLDDLGLSYFKQFEEN---YGIKI-IYTSNIKNTRFDSD-IETVVYRVVQEAI-----
QSEC_ECOLI      LSRDNLQDVAEIPLEDLLQSSVMDIYHTA--QQAKIDVRL------TLNAHSIKRTXXXXXDNAVR-YSP
TOP6B_ARCFU     -------------------------------------------------------VVKEAVDNALDACEE
HPRK_STAES      ----------------------------------------------------------------------
HPRK_STAEQ      ----------------------------------------------------------------------
HPRK_STAAW      ----------------------------------------------------------------------
HPRK_STAAT      ----------------------------------------------------------------------
HPRK_STAAS      ----------------------------------------------------------------------
HPRK_STAAR      ----------------------------------------------------------------------
HPRK_STAAN      ----------------------------------------------------------------------
HPRK_STAAM      ----------------------------------------------------------------------
HPRK_STAAE      ----------------------------------------------------------------------
HPRK_STAAC      ----------------------------------------------------------------------
HPRK_STAAB      ----------------------------------------------------------------------
HPRK_STAA9      ----------------------------------------------------------------------
HPRK_STAA8      ----------------------------------------------------------------------
HPRK_STAA3      ----------------------------------------------------------------------
HPRK_STAA2      ----------------------------------------------------------------------
HPRK_STAA1      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           QGTITIATRFHAAEKEVSLSVRDNGPGIPGDNIDKLGTPFFTTKDKGTGLGLSISYTIVDKHQGRIEVES
ATOS_ECOLI      RGKIRIQT-WQYSDSQQAISIEDNGCGIDLSLQKKIFDPFFTTKASGTGLGLALSQRIINAHQGDIRVAS
KINC_BACSU      GGVVTISTAKTASHAVIS--VKDEGNGMPQEKLKQIGKPFYSTKEKGTGLGLPICLRILKEHDGELKIES
KINE_BACSU      GGNIFVTIKA-LDQDHVLISLKDEGIGMTEDKLKRLGEPFYTTKERGTGLGLMVSYKIIEEHQGEIMVES
ZRAS_SALTI      QGTITVEAKESGTDR-VIITVTDSGKGIAPDQLEAIFTPYFTTKADGTGLGLAVVQNIIEQHGGAIKVKS
ZRAS_SALTY      QGTISVEAKESGTDR-VIITVTDSGKGIAPDQLEAIFTPYFTTKADGTGLGLAVVQNIIEQHGGAIKVKS
KINA_BACSU      GGTVDIIIT--EDEHSVHVTVKDEGEGIPEKVLNRIGEPFLTTKEKGTGLGLMVTFNIIENHQGVIHVDS
KIND_BACSU      GGKLTIS--LGALDKKAIIKVVDNGEGISQEMLDHIFLPFVTSKEKGTGLGLVVCKRIVLMYGGSIHIES
ZRAS_ECOLI      HGVISVTASESGAG--VKISVTDSGKGIAADQLDAIFTPYFTTKAEGTGLGLAVVHNIVEQHGGTIQVAS
PILS_PSEAE      RGQVWLSLARDPESDLPVLEVIDDGPGVPADKLNNLFEPFFTTESKGTGLGLYLSRELCESNQARIDYRN
ZRAS_ECO57      HGVISVTASESGAG--VKISVTDSGKGIAADQLEAIFTPYFTTKAEGTGLGLAVVHNIVEQHGGTIQVAS
KINB_BACSU      KGMIHISAKRNG--HTIMINITDNGVGMTDHQMQKLGEPYYSLKTNGTGLGLTVTFSIIEHHHGTISFNS
ZRAS_KLEOX      EGVITVAVR-ECGDGRVKVSVADSGKGMTAEQLQAIFTPYFSTKADGTGLGLAVVQNIVEQHGGTIDAES
DEGM_BACB2      GDTVTI--QLDRLKDRAQIEINDNGVGMSRQQLKQLGTAYFTTKESGNGIGTMVSIRIVEMMNGMVTFKS
NTRB_KLEOX      EGEITLRTRLHGVRYRLAIDVEDNGPGIPSHLQDTLFYPMVSGREGGTGLGLSIARSLIDQHSGKIEFTS
NTRB_SALTY      EGEITLRTRLHGERYRLAIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHAGKIEFTS
NTRB_SALTI      EGEITLRTRLHGERYRLAIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHAGKIEFTS
NTRB_VIBAL      QGKITIRTRVHQANKRCKLAARDNGPGIPPELQDTLFYPMVSGREGGTGLGLSISQNLIDQHNGKIDVES
NTRB_SHIFL      EGEIILRTRLHGERYRLAIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFTS
NTRB_ECOLI      EGEIILRTRLHGERYRLAIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFTS
NTRB_ECO57      EGEIILRTRLHGERYRLAIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFTS
WALK_STAHJ      EKRVEFHVKQNALYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
FIXL_BRAJA      QRRELVVTNTPAADDMIEVEVSDTGSGFQDDVIPNLFQTFFTTKDTGMGVGLSISRSIIEAHGGRMWAES
NTRB_AZOBR      GGEIILSTSYQHGVRPLLVSVQDNGDGIPDDLRSNLFDAFITTKVNGTGLGLALVAKIVGDHGGVIEFDS
VIRA_AGRT9      NGQIDISQAFLPVKKYVLLSISDNGGGIPEAVLPHIFEPFFTTRARGTGLGLASVHGHISAFAGYIDVSS
WALK_STAAE      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
FIXL_AZOC5      ASRRQLLVQTTPAEDDVTVSVCDTGHGISDEMRAQLFTPFVTTKAQGMGVGLSISRTIIEAHGGRIWAEP
VIRAW_RHIRD     NGQIDISQAFLPVKKYVLLSISDNGGGIPEAVLPHIFEPFFSTRARGTGLGLASVHGHISAFAGYIDVSS
WALK_STAAW      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAAU      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAAT      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAAS      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAAR      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAAN      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAAM      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAAC      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAAB      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAA9      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAA8      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAA3      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAA2      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAA1      DKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
NTRB_RHOCA      QGTIRLRTFYDYALRPLQVEVIDDGPGIPADIASSIFEPFVSGRENGTGLGLALVSKIISEHNGWISVES
NTRB_RHILP      RGEIMLTTAYRGTREKISLPVHDNGPGVPADLLPHLFDPFITTKTNGSGLGLALVAKIIGDHGGIIECDS
NODV_BRAJA      VTDRPRELLIQSSTDDVQLSVTDCGVGIAENDADRVLDPFFTTKSSGLGMGLSICRSIVEVHGGRISVVQ
DCTB_RHIME      SEDGAIQVRCEEAAGGIALTVADNGPGIAADVREELFTPFNTSKEDGLGLGLAISKEIVSDYGGTIEVES
WALK_STAES      EKRVEFHVKQNALYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
WALK_STAEQ      EKRVEFHVKQNALYNRMTIRIKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
NTRB_RHIME      DGEILLTTAYRGTREKISLPVHDNGPGVXXXXXXXXXXXXITTKTNGSGLGLALVAKIIGGHGGIVECDS
Y3689_SHEFN     QGIIVIDT--HVANNMAILSIKDNGCGMDSATLKRITEPFFTTREGGSGLGLSVCSKIIKEHQGEMQIQS
WALK_STASR      HKRVEFHVKQNTLYNRMTIQIKDNGIGIPVNKVDKIFDRFYARKMGGTGLGLAITKEIVEAHKGRIWASS
VIRA_AGRT5      DGQIIIVSRIFVSRQKVLLSVSDDGEGIAETVLPHIFEPFFTTRSGGTGLGLAAVHGHVSALAGYIDVTS
WALK_STAS1      DKRVEFHVKQNALYNRMTIRVKDNGIGIPINKVDKIFDRFYTRKMGGTGLGLAISKEIVEAHNGRIWANS
NTRB_BRASR      LGTIQLTTAFRPGKSRVSLPVKDNGSGVPEDLLPNLFDPFVTTKQTGSGLGLALVAKIVGDHGGIIECES
PHOR_BACSU      GGSVAINVK--PREKDIQIEVADSGIGIQKEEIPRIFERFYVDKDRGTGLGLAIVKHLIEAHEGKIDVTS
YYCG_BACSU      GGHVTFSIDVNEEEELLYISVKDEGIGIPKKDVEKVFDRFYTRKXXXXXXXXAIAKEMVQAHGGDIWADS
STC_CLOBE       ----------------------------------------------------------------------
PDHS_OCHA4      GGQVIVSTSYE-MNGDVVMRVRDTGIGMTKSEVEQALKPFETAKDEGTGLGLPLTKAMVEANRAQFAIDS
DCTB_RHILE      EGRVEIRTSTDAGM--VTVTVADNGPGIPTEIRKGLFTPFNTSKESGLGLGLVISKDIVGDYGGRMDVAS
NTRYL_RICBR     SNQAAIKVNINTSEQFINITVLDNGRGFPPELIGKATESYVTTRSKGMGVGLAIVKRIVEEHCGVLDI--
SASA_CYAP7      EGTITVSI-LHRTTQKVQVSICDTGPGIPEEKQDRIFEGHFRLKKEGYGLGLSLCRKIIRAHYGQIWVDS
RESE_BACSU      GGSVSISV--HSVKDGLKIDIKDSGSGIPEEDLPFIFERFYKA-DKXXXXXXXIVKNIVEAHNGSITVHS
DIVJ_CAUCR      GGQVTVTA--HGYDGVLEIVVADTGVGISPEDLERLGRPYEQARARGTGLGLSLVRAFAQLHGGEMVIES
SASA_SYNY3      HGSITVGA-LHRTTQKVQVSITDNGPGIPNSKQETIFEGHFRLQTDGYGLGLSLCRKIIQAHYGQIWVDS
SASA_PROMM      GGEVSL-TMLHRTSHWVQVSICDNGPGIPEDELDRVRLPQTSVSTSGFGVGLSVCRRIVEVHGGKIWVVS
FIXL_RHIME      VDRRELTIRTMPADPEVAVVVEDTGGGIPEEVAGQLFKPFVTTKASGMGIGLSISKRIVEAHGGEMTVSK
SASA_CYAA5      GGEITLSI-LHRTSQKVQVSVCDTGPGIPEEKQERIFEGHFRLQKEGYGLGLSLCRKIIRVHYGQIWVDS
PDHS_BRUSU      GGQVIVSTSYE-LNGDVVMRVRDTGIGMSKSEVEQALKPFRQIRNEGTGLGLPLTKAMVEANRAQFAIDS
PDHS_BRUSI      GGQVIVSTSYE-LNGDVVMRVRDTGIGMSKSEVEQALKPFRQIRNEGTGLGLPLTKAMVEANRAQFAIDS
PDHS_BRUME      GGQVIVSTSYE-LNGDVVMRVRDTGIGMSKSEVEQALKPFRQIRNEGTGLGLPLTKAMVEANRAQFAIDS
PDHS_BRUAB      GGQVIVSTSYE-LNGDVVMRVRDTGIGMSKSEVEQALKPFRQIRNEGTGLGLPLTKAMVEANRAQFAIDS
PDHS_BRUA2      GGQVIVSTSYE-LNGDVVMRVRDTGIGMSKSEVEQALKPFRQIRNEGTGLGLPLTKAMVEANRAQFAIDS
PDHS_BRUA1      GGQVIVSTSYE-LNGDVVMRVRDTGIGMSKSEVEQALKPFRQIRNEGTGLGLPLTKAMVEANRAQFAIDS
DCTS_RHOCA      EGPRTLTVRLARAGAAVTIEVMDRGPGISDAVAASLFDPFTSTKSEGMGMGLNICRSIVEMHHGSLSHGP
PLEC_CAUCR      AGSVTVEVRRDPFGDLIKVSVTDTGIGIAKEDLARLAKPFFSKXXXXXXXXXXXXKSLITMHDGVLEMHS
PDHS_BRUC2      GGQVIVSTSYE-LNGDVVMRVRDTGIGMSKSEVEQALKPFRQIRNEGTGLGLPLTKAMVEANRAQFAIDS
NTRY_AZOBR      EGTELVAIRVEADAERIAMIIEDNGKGLPTEERDRLTEPYVTTRAKGTGLGLAIVKKIMEDHGGVLTLED
SASA_PROM3      GGQVSLSM-LHRTSQWVQVSICDNGPGIPEDELDRVRLPQTSVTTSGFGVGLSVCRRIVEVHGGKIWVVS
MTRB_MYCTU      K---PVRIRMAADEDTVAVTVRDYGVGLPGE--EKLSDPSRVRRSGGTGLGLAISVEDARLHQGRLEAWG
MTRB_MYCBO      K---PVRIRMAADEDTVAVTVRDYGVGLPGE--EKLSDPSRVRRSGGTGLGLAISVEDARLHQGRLEAWG
LOVHK_PSE14     DPKISIETRNLVVDRYVSIAITDNGIGMPSSIRDRVMDPFFTTKEKGSGLGLSMVYGFAKQSGGAARIYT
SASA_SYNJA      GGSIRLNI-LHRTSQKVQVTVSDTGPGIPEAEQENIFSDAVRLQQEGYGIGLSLCRRIVRAHYGQIWVES
SASA_PROM2      SGSIKI-TMIHKTNQWVEITICDKGAGIPLSELDRVRLPQTSEGTSGFGIGLSVCRRIVQVHGGRIWVVS
NTRYL_RICPR     QEFGKIDVILDAKDDFISVIVMDNGKGFPPELIGKATESYVTTSSKGMGVGLAIVKRIVEEHCGVLDIAN
LUXQ_VIBHA      -GSIRLHAQFYGAENSVLVELTDTGIGIESDKLDQMFEPFVTTREYGSGLGLTIVKNLVDMLEGDVQVRS
SASA_PROMP      SGRIKI-TLIHKTNQWVEITICDKGAGIPVSELDRVRLPQTSEGTSGFGIGLSVCRRIVEVHGGRIWVVS
PDHS_BRUO2      PGRQVIVSTSYELNGDVVMRVRDTGIGMSKSEVEQALKPFRQIRNEGTGLGLPLTKAMVEANRAQFAIDS
VIRAL_RHIRD     TGRIVLANGTIPAGDYILLSFEDNGGGIGQAALPHIFEPFFRTRAQGTGLGLSTVHGHVSAMAGFVDVIS
LOVHK_PSESM     NPKVFIETRNLLVDRYVSIAVTDNGIGMPASIRDRVMDPFFTTKEKGSGLGLSMVYGFAKQSGGAARIYT
SASA_SYNJB      GGSIRLDV-LHRTSQKVQVTVSDTGPGIPEADQESIFSDSVRLQQEGYGIGLSLCRRIVRAHYGQIWVES
SASA_NOSP7      GGKISVSG-LHRTTQKVQFSIGDTGPGIPVENRDRIFENHFRLQKEGYGIGLCLCQRIIVAHYGQIWVDS
SRRB_STAAR      GDEIAITCDEN--ESEDILYIKDTGTGIAPEHLQQVFDRFYTRGKQGTGLGLFICKMIIEEHGGSIDVKS
SASA_PROMA      GDTVEI-TMLHRTNQWVQISVSDKGPGIPEEELDRVRLPQTSNETSGFGIGLSVCRRIVEVHGGKIWVVS
KINB_PSEAE      GGQIHLQARRQG--DRVLIAVEDNGEGIPFSQQGRIFEPFVQVKKGGAGLGLELCKEIIQLHGGRIAVRS
SASA_THEEB      GGKIHLSA-FHRMTQKVQVTVSDTGPGIPIEQQEKIGETVRLDRDRGYGIGLALCRQIIRMHYGQIWVDS
NTRYL_RICFE     RESGKIEVTIDAKDDFISVIVIDSGKGFPPELIGKATESYVTTSSKGMGVGLAIVKRIVEEHCGILDIAN
LOVHK_PSEU2     NPKIFIETRNLVVDRYVSIAVTDNGIGMPASIRDRVMDPFFTTKEKGSGLGLSMVYGFAKQSGGAARIYT
SRRB_STAAW      GDEIAITCDEN--ESEDILYIKDTGTGIAPEHLQQVFDRFYTRGKQGTGLGLFICKMIIEEHGGSIDVKS
SRRB_STAAU      GDEIAITCDEN--ESEDILYIKDTGTGIAPEHLQQVFDRFYTRGKQGTGLGLFICKMIIEEHGGSIDVKS
SRRB_STAAS      GDEIAITCDEN--ESEDILYIKDTGTGIAPEHLQQVFDRFYTRGKQGTGLGLFICKMIIEEHGGSIDVKS
SRRB_STAAC      GDEIAITCDEN--ESEDILYIKDTGTGIAPEHLQQVFDRFYTRGKQGTGLGLFICKMIIEEHGGSIDVKS
SRRB_STAA8      GDEIAITCDEN--ESEDILYIKDTGTGIAPEHLQQVFDRFYTRGKQGTGLGLFICKMIIEEHGGSIDVKS
SASA_SYNE7      GGTITIAA-LHRTSQKVQISISDTGSGIPRDQLSVIFKNLVDSSQEGYGIGLSVCQRIVQAHFGRIWVAS
SRRB_STAAN      GDEIAITCDEN--ESEDILYIKDTGTGIAPEHLQQVFDRFYTRGKQGTGLGLFICKMIIEEHGGSIDVKS
SRRB_STAAM      GDEIAITCDEN--ESEDILYIKDTGTGIAPEHLQQVFDRFYTRGKQGTGLGLFICKMIIEEHGGSIDVKS
MTRB_MYCLE      K---PVRIRMAADEDTVAVTVRDYGIGLPGE--EKLSDPSRVRRSGGTGLGLAISIEDARLHQGRLEAWG
NTRY_AZOC5      RGQGRIRVSANRVGEDLVIDIIDNGTGLPQESRNRLLEPYVTTREKGTGLGLAIVGKIMEEHGGGIEL--
SASA_PROM0      SGSIKI-TMIHKTNQWVEITICDKGAGIPLSELDRVRLPQTSEGTSGFGIGLSVCRRIVQVHGGRIWVVS
SASA_SYNS3      GGLISL-TMLHRTSQWVQVSISDSGPGIPEEELDRVRLPQTSAGASGFGVGLSVCRRIVEVHGGRIWVIS
MTRB_MYCPA      K---PVKIRMAADEDTVAVTVRDYGVGLPGE--EKLADPSRVRRSGGTGLGLAISIEDARLHQGRLEAWG
YCF26_PORYE     DGIIVLRTRINDSAQKVRVEICDTGIGISKKNQERIFARFLRIENEGTGLGLSIVKNIIQKHNSEIHLYS
SASA_PROMS      SGSIKI-TMIHKTNQWVEITICDKGAGIPLSELDRVRLPQTSEGTSGFGIGLSVCRRIVQVHGGRIWVVS
SASA_PROM9      YGSIKI-TMIHKTNQWVEITICDKGAGIPLNELDRVRLPQTSEGTSGFGIGLSVCRRIVQVHGGRIWVVS
NTRYL_RICCN     RESGKIEVTIDVKDDFISVIVTDNGKGFPPELIGKATESYVTTSSKGMGVGLAIVKRIVEEHCGILDIAN
SASA_ANASP      GGTISIA-GLHRTTQKVQFSIGDTGPGIPSDNRERIFENHYRLEKEGYGIGLSLCQRIIRAHYGQIWVDS
SASA_SYNPX      GGHITL-TMLHRTSQRVEVSVCDSGPGIPTEELDRVRLPQTSDRTTGFGVGLSVCRRIVEVHGGRIWVVS
SASA_ANAVT      GGTISIA-GLHRTTQKVQFSIGDTGPGIPTDNRERIFENHYRLEKEGYGIGLSLCQRIIRAHYGQIWVDS
NTRYL_RICTY     QEFGRIDVILDIKDDFINVIVMDNGKGFPPELIGKATESYVTTSSKGMGVGLAIVKRIVEEHCGVLDIAN
LUXQ_VIBPA      SGCVRLHAQFYGADNSVLVEISDTGIGIESDKLDEMFEPFVTTREYGSGLGLTIVKNLVDMLDGDVQVRS
PHOR_SHIDY      EGT-HITVRWQRVPHGAEFSVEDNGPGIAPEHIPRLTERFYSRQTGGSGLGLAIVKHAVNHHESRLNIES
NTRB_PROVU      TGTIILRTRLHGERHRLRIDVIDTGSGIPPHLQDTLFYPMVSGREDGNGLGLSIARNLVDQHAGKIEFTS
SASA_SYNS9      GGHIALSM-LHRTNQWVEVSVCDSGPGIPNEELDRVRLPQTSDRTTGFGVGLSVCRRIVEVHGGRIWVVS
SASA_CYAP8      GGKVTVSI-LHRTTQKVQVSICDTGPGIPEEKQERIFEGHFRLKKEGYGLGLSLCRKIIRTHYGQIWVDS
PHOR_KLEPN      PGT-EIRVSWQRTPQGALFSVEDNGPGIAPEHIPLLTERFYSRQTGGSGLGLAIVKHAVNHHDSRLEIDS
YVRG_BACSU      KGT-EIQVILEQTKNHISLKVKDNGKGMDEETITHLFNRYYNTKDSGTGLGLAIAKELVHLHNGTIHVNS
PHOR_ECOLI      EGT-HITVRWQRVPHGAEFSVEDNGPGIAPEHIPRLTERFYSRQTGGSGLGLAIVKHAVNHHESRLNIES
ARCB_SHIFL      QGQVTVRVRYDEGDM-LHFEVEDSGIGIPQDELDKIFAMYYQVKDSGTGIGLAVSRRLAKNMGGDITVTS
ARCB_ECOLI      QGQVTVRVRYDEGDM-LHFEVEDSGIGIPQDELDKIFAMYYQVKDSGTGIGLAVSRRLAKNMGGDITVTS
ARCB_ECO57      QGQVTVRVRYDEGDM-LHFEVEDSGIGIPQDELDKIFAMYYQVKDSGTGIGLAVSRRLAKNMGGDITVTS
YCF26_PORPU     NGIIILRAYTHFNSQKVRVEICDNGIGISRKNQERIFARFLRIENEGTGLGLSIVKNIIQKHNSEIHLYS
SASA_MICAN      GGEITLSV-LHRTTQKVQVSISDTGPGIPEEKQEHIFEGHVRLKKEGYGIGLSVCRKIIRAHYGQIWVDS
DSPA_SYNY3      GGKIIVAYPLHRSNLRVRVEISDTGIGIDPEDQAAIFERFYRVENRGTGLGLSIVKNIIAKHQSQIHLVS
Y1002_RHIME     GGLVTVDAALEG--NMLKLTVSDTGIGIAADKLQMLGQPFYTRRYEGTGLGLSLVKGLAELHGGDVSIRS
PGTB_SALTY      DAVIAVTWQTQGEALEVYIA--DNGPGWPVALLPSLLKPFTTSKAVGLGIGLSISVSLMAQMKGDLRLAS
BVGS_BORBR      QVVLTVTARPDGEAAHVQFSVSDTGCGISEADQRQLFKPFSQVGGSGTGLGLSISRRLVELMGGTLVMRS
BVGS_BORPA      QVVLTVTARPDGEAAHVQFSVSDTGCGISEADQRQLFKPFSQVGGSGTGLGLSISRRLVELMGGTLVMRS
CHVG_AGRT5      EGRITVRLSRH--KDRCIVQVEDNGPGIQAEDIDRIFERFYTDRGQNSGLGLSISRQIAEAHGGSLRAEN
KDPD_ECOLI      QAEIGIDA--HVEGENLQLDVWDNGPGLPPGQFDKFARGNKESAVPGVGLGLAICRAIVDVHGGTITAFN
DCTS_BACSU      SEDKRIDISIEQTDDILAILIEDNGCGIEPTHMPRLYDKGFTVKTGGTGYGLYLVKQIIDKGSGTIEVDS
LUXQ_VIBVU      AGRIEVSEKFARSEHSISIQVSDTGIGIDESKLESIFEPFVTREYGGSGLGLTIVKNLVEMLEGEISVQS
RPRX_BACFR      EEDLVLNVRTWNEPGKLMISIQDNGIGIKKENLKKVFDKFYRVHTKGFGLGLAYVKKIIQDHKGTIRAES
LUXQ_VIBVY      AGRIEVSFKFARSEHSISIQVSDTGIGIDESKLESIFEPFVTREYGGSGLGLTIVKNLVEMLEGEISVQS
DOKA_DICDI      GFVLLEISTDYESGDQISLTVKDSGIGIPENKIEQIFVPFFSRKYGGSGLGLSFCKELVALMGGYIRVES
BVGS_BORPE      QVVLAVTARPDGDAAHVQFSVSDTGCGISEADQRQLFKPFSQVGGSGTGLGLSISRRLVELMGGTLVMRS
LUXQ_VIBCH      QGSIRVELQLIEGDPQLVIQVVDTGIGIREQDLTVIFEPFMTTREYGSGLGLTIVHSLVEMLSGQLHVSS
SAES_STAAW      GSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFNTKTGGSGLGLYIANELAQQNNAKISVSS
SAES_STAAS      GSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFNTKTGGSGLGLYIANELAQQNNAKISVSS
SAES_STAAR      GSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFNTKTGGSGLGLYIANELAQQNNAKISVSS
SAES_STAAN      GSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFNTKTGGSGLGLYIANELAQQNNAKISVSS
SAES_STAAM      GSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFNTKTGGSGLGLYIANELAQQNNAKISVSS
SAES_STAAE      GSRIDINISENEDQDTIDIAISDEGIGIIPELQERIFERTFNTKTGGSGLGLYIANELAQQNNAKISVSS
SAES_STAAC      GSRIDINISENEDQDTIDIAISDEGIGIIPELQERIFERTFNTKTGGSGLGLYIANELAQQNNAKISVSS
SAES_STAAB      GSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFNTKTGGSGLGLYIANELAQQNNAKISVSS
SAES_STAA8      GSRIDINISENEDQDTIDIAISDEGIGIIPELQERIFERTFNTKTGGSGLGLYIANELAQQNNAKISVSS
SAES_STAA3      GSRIDINISENEDQDTIDIAISDEGIGIIPELQERIFERTFNTKTGGSGLGLYIANELAQQNNAKISVSS
DHKD_DICDI      GGAVKILEKFDLSPNKFQIVVSDTGPGIP-DNLHEIIFERFTRKHGGTGLGLSIVKEFVTLHGGTVTIHN
CHVG_RHIME      QNG-RIVVRLTRSRLRCIVYVEDNGPGIQAEDIDRIFERFYTDRPEGSGLGLSISRQIAEAHGGTLRAEN
DCTS_BACHD      TQDQNKTVHVFIGEENLKIRVRDNGEGIREEVREKMFVRGFSTKSSGRGIGLFLIQAIVERVEGKIEVES
CPXA_ECOLI      K----IEVGFAVDKDGITITVDDDGPGVSPEDREQIFRPFYRTDEAGTGLGLAIVETAIQQHRGWVKAED
CPXA_ECOL6      K----IEVGFAVDKDGITITVDDDGPGVSPEDREQIFRPFYRTDEAGTGLGLAIVETAIQQHRGWVKAED
CPXA_ECO57      K----IEVGFAVDKDGITITVDDDGPGVSPEDREQIFRPFYRTDEAGTGLGLAIVETAIQQHRGWVKAED
CITS_BACHD      SGNKKIYISFTDMGDDFIFEVEDNGPGIPPQLMESIFEEGFSTKE-GTGFGLALVKKAVHELGGAIFLEE
VANS_ENTFC      NSIIDITAGL--SGDVVSIEFKNTG-SIPKDKLAAIFEKFYSSDTGGAGLGLAIAKEIIVQHGGQIYAES
RSSA_SERMA      GSRIEANIR-SLAPLGCYITLRDNGPGVSEEHRSRLFERFYRTQQTGSGLGLAIARNLADKIGAQLRVEG
PHYA_ANASP      EAP-QIHIGAERLEDEWLFSVRDNGIGIDPQFSDRIFVIFLHTRDEGTGMGLAICKKIIECHRGRIWVES
DHKA_DICDI      GHVLTDISVDDSTEEEICITIEDTGIGIPQSLFDSIFEPFTTRKYGGTGLGLSITKRLIEEVMGTIQVSS
NIFL_AZOVI      QNQVSRRELFISTRVEVRMEITDSGPGIPPDLVLKVFEPFFSTKPPGRGMGLPVVQEIVAKHAGMVHVDT
BAES_ECOLI      GGSLQISAG--QRDKTVRLTFADSAPGVSDDQLQKLFERFYRTEGSGSGLGLAICLNIVEAHNGRIIAAH
SAES_STAES      GSRIDIIISECKENDVISISIKDEGIGIVPELQSRIFERTFNTKTGGSGLGLYIANELAQQIDASITVQS
SAES_STAEQ      GSRIDIIISECKENDVISISIKDEGIGIVPELQSRIFERTFNTKTGGSGLGLYIANELAQQIDASITVQS
PHY1_SYNY3      KSP-KIKIWGDRQEDAWVFAVQDNGIGIDPQFFERIFVIFLHTRDKGTGMGLAICKKIIEGHQGQIWLES
DCUS_SHIFL      EPGGEISVTLHYRHGWLHCEVNDDGPGIAPDKIDHIFDKGVSTKGSERGVGLALVKQQVENLGGSIAVES
DCUS_ECOLI      EPGGEISVTLHYRHGWLHCEVNDDGPGIAPDKIDHIFDKGVSTKGSERGVGLALVKQQVENLGGSIAVES
DCUS_ECOL6      EPGGEISVTLHYRHGWLHCEVNDDGPGIAPDKIDHIFDKGVSTKGSERGVGLALVKQQVENLGGSIAVES
DCUS_ECO57      EPGGEISVTLHYRHGWLHCEVNDDGPGIAPDKIDHIFDKGVSTKGSERGVGLALVKQQVENLGGSIAVES
GACS_PSESY      EGTIVARAMLEDETEELRISVQDTGIGLSSQDVRALFQAFLSRQPGGTGLGLVISKRLIEQMGGEIGVDS
DLTS_STRA5      KSAIQFSLK--QARRKAILTISNPSAIYSKEVMDNLFERFYQAKDDHAGLGLSIAKAIVERHKGRIRAYQ
YKOH_BACSU      PIEMSAGTR----NGRPFLSVRDEGIGIPEEHIPHLFERFYRAKTGGTGLGLSIAKQIADEHGIELSVKS
PHYB_ANASP      ANKWIEIGYIDNPPLPPTFYVRDNGIGIREKHFETIFRIFKRLHSPGTGAGLTIAKKIVERHGGKIWVES
DLTS_STRA3      KSEIQFSLK--QARRKAILTISNPSAIYSKEVMDNLFERFYQAKDDHAGLGLSIAKAIVERHKGRIRAYQ
TORS_ECO57      EGQIVLRSRTDGEQWLVE--VEDSGCGIDPAKLAEIFQPFIQVSGKGTGLGLTISSRLAQAMGGELSATS
KDPD_CLOAB      GSTIEI--KVYEKKKDVVFEIIDEGQGISEDILPNIFDRFFTNGSKGVGLGLAICKSIVEAHGGKIEAVN
MAK1_SCHPO      GEVFTRCSKIDYSTNTVVLKWEDTGQGFNRDDQLQMFKPFSQVESSGSGLGLVISKELVELHNGSMSCQS
YCBM_BACSU      GKLIGLTLSYD--ERNIAITVWDRGKGISETDQQRVFERLYTLEEQGSGLGLTITKRLTEKMGGIISVQS
DIVL_CAUCR      GGRVTLSAR--RALGEVRLDVSDTGRGVPFHVQAHIFDRFVGRDRGGPGLGLALVKALVELHGGWVALES
BARA_SHIFL      NGNIDILVEKRATKVQIEVQIRDTGIGIPERDQSRLFQAFISRRHGGTGLGLVITQKLVNEMGGDISFHS
BARA_ECOLI      NGNIDILVEKRATKVQIEVQIRDTGIGIPERDQSRLFQAFISRRHGGTGLGLVITQKLVNEMGGDISFHS
BARA_ECOL6      NGNIDILVEKRATKVQIEVQIRDTGIGIPERDQSRLFQAFISRRHGGTGLGLVITQKLVNEMGGDISFHS
BARA_ECO57      NGNIDILVEKRATKVQIEVQIRDTGIGIPERDQSRLFQAFISRRHGGTGLGLVITQKLVNEMGGDISFHS
ENVZ_SALTI      WIKVSSGTESHRAW----FQVEDDGPGIKPEQRKHLFQPFVARSTSGTGLGLAIVQRIIDNHNGMLEIGT
DHKB_DICDI      HGQIIIRVKLESDDSTHSLDVEDSGIGIKTEHLNQLFASFSSRKYQGTGLGLSISKRLCKMMGGDVKVKS
ACOR_BACSU      ----------------------------------------------------------------------
TORS_ECOLI      EGYIILRSRTDGEQWLVE--VEDSGCGIDPAKLAEIFQPFVQVSGKGTGLGLTISSRLAQAMGGELSATS
ENVZ_SALTY      WIKVSSGTESHRAW----FQVEDDGPGIKPEQRKHLFQPFVARSTSGTGLGLAIVQRIIDNHNGMLEIGT
CITS_BACSU      QSVKEVLFFITDMGHDIVIEVSDTGPGVPPEKIEAVFERGYSSKGMRRGYGLANVKDSVRELGGWIELAN
ARLS_STAS1      NKYIQIQTKLR--NKQISIEITDHGVGIPKEDIEFIFDRFYSRKLGGNGLGLSIAKKIIELNNGTIHVDS
YCLK_BACSU      NGDIWL--RGMEGYKXXXXXXXXXXXXXPKEDIEHIWERFYKADISRTGLGLSIVRQLVEMHQGTVEIKS
SENX3_MYCS2     NGTVSISRRKRGGNIEIA--VTDRGIGIAKDDQERVFERFFRV-DKGTGLGLAIVKHVAANHNGSIRLWS
CUSS_ECOL6      GETIVV--RCQTVDHLVQVTVENPGTPIAPEHLPRLFDRFYRVKGEGSGIGLAIVKSIVVAHKGTVAVTS
ARLS_STAHJ      NKQIEIATQLR--NKQISIEITDHGLGIPKEDQEFIFDRFYSRSQGGNGLGLFIAEKIVQQYGGYITVDS
SILS_SALTY      GQAITVSIR--EQESFFDLVIENPGKPIPEEHLSRLFDRFYRVKGEGSGIGLAIVKSIVEAHHGRVQVES
PHOR_PSEAE      EGEIRI--RWWADEQGAHLSVQDTGIGVDPKHLPRLTERFYRVDSSGTGLGLAIVKHVLIRHRARLEISS
YFHK_ECOLI      SGNICLRSSLHGAR--VYIDVINTGTPIPQEERAMIFEPFFQGSHKGSGLGLSIARDCIRRMQGELYLVD
MAK2_SCHPO      EGHIAIDEEINAEENQCKLEIEDTGIGLKEEQLKLLFNPFTQVDGSGSGLGLSICLQICKIMDGDIGVQS
DHKL_DICDI      KGEISICCLLNDSEYEIKVDVRDTGIGIKKEALPLLFKAFITRQYGGSGLGLAICKELVHAFNGEISVES
IRLS_BURPS      GSTITIECA--QAADAATISVSDTGRGIEAPHRERIFERFYRVDPSGTGLGLAIVRSIMENHGGTCGVDS
ETR1_CUCSA      EGSISISADFHPVPSDLRVQVKDTGSGISPQDIPKLFTKFAQTNSCGSGLGLAICKRFVNLMEGHIWLES
DHAR_CITFR      ----------------------------------------------------------------------
CUSS_ECOLI      GETIVV--RCQTVDHLVQVIVENPGTPIAPEHLPRLFDRFYRVKGEGSGIGLAIVKSIVVAHKGTVAVTS
SPAK_BACSU      GGTVSV----HACDSEIYFFVKDTGNGFSEMGLKK-ATELFYMDDKSRGMGLTFAKNAVNLHNGELTLGN
RPFC_XANCP      GHVLLRVTRVSSAEDAVRLDVEDTGIGVPMDMRPRLFEAFLSRRYEGTGLGTTIAKGLVEAMGGSIGFKE
RPFC_XANC8      GHVLLRVTRVSSAEDAVRLDVEDTGIGVPMDMRPRLFEAFLSRRYEGTGLGTTIAKGLVEAMGGSIGFKE
LUXN_VIBHB      YPDSQIEISTKTGPYENTLIFRDTGPGIDETISHKIFDDFFSQKSGGSGLGLGYCQRVMRSFGGRIECKS
LUXN_VIBHA      YPDSQIEISTKTGPYENTLIFRDTGPGIDETISHKIFDDFFSQKSGGSGLGLGYCQRVMRSFGGRIECKS
ETR1_PRUPE      EGSISIAPEFFPAQSDLRVQVKDSGSGINPQDIPKLFTKFAQTQSLGSGLGLAICKRFVNLMEGHIWIES
ETR1_CUCMR      EGSISISADFHPVPSDLRVQVKDTGSGISPQDIPKLFTKFAQTNSGGSGLGLAICKRFVNLMEGHIWLES
ARLS_STAES      HKHIKIVTQLK--NKMIMIDITDHGMGIPKADLEFIFDRFYRVDKSGNGLGLSIAEKIVQLNGGMIQVES
ARLS_STAEQ      HKHIKIVTQLK--NKMIMIDITDHGMGIPKADLEFIFDRFYRVDKSGNGLGLSIAEKIVQLNGGMIQVES
MPRB_MYCVP      GGRVGVGTQIDALHAE--LVVSDRGPGIPPQERALVFERFFRSTSAGSGLGLAIVKQVVLKHGGTLRIED
CUSS_ECO57      GEAIVV--RCQTVDHLVQVIVENPGTPIAPEHLPRLFDRFYRVKGEGSGIGLAIVKSIVVAHKGTVAVTS
AFSQ2_STRCO     PVRVSVAR----ADHEIVIRVRDNGPGIPEDVLPHVFDRFYKARSEGSGLGLSIALENAHIHGGEITAEN
ETR1_SOLLC      EGNVSIAPEFFAVPSELRVQIKDTGIGITPQDIPNLFSKFTTTNSGGTGLGLAICKRFVNLMEGHIWIES
ENVZ_SHIFL      WIKVSSGTEPNRAW----FQVEDDGPGIAPEQRKHLFQPFVRGDSSGTGLGLAIVQRIVDNHNGMLELGT
ENVZ_ECOLI      WIKVSSGTEPNRAW----FQVEDDGPGIAPEQRKHLFQPFVRGDSSGTGLGLAIVQRIVDNHNGMLELGT
MPRB_MYCPA      GGHVGVTMR-QLDPSHVELVVSDHGPGIPPQERRLVFERFYRSTSAGSGLGLAIVKKVVLNHGGMLRVED
ETR2_SOLLC      EGSVSVAPEFFPVQSELRVQVKDTGSGINPQDFPKLFCKFATKNSAGTGLGLAICKRFVNLMEGHIWIES
CIAH_STRR6      DGEIDFL--ISATDRNLYLLVSDNGIGISTEDKKKIFDRFYTRQKGGFGLGLSLAKQIVDALKGTVTVKD
CIAH_STRPN      DGEIDFL--ISATDRNLYLLVSDNGIGISTEDKKKIFDRFYTRQKGGFGLGLSLAKQIVDALKGTVTVKD
RCSC_ECOLI      -GCIVLHVR--ADGDYLSIRVRDTGVGIPAKEVVRLFDPFFQVGTQGTGLGLAICEKLISMMDGDISVDS
DHKK_DICDI      SGYVXXXXXXXXGEYNISFRVKDTGIGVPVESHQKIADPSDSRKYGGSGLGLYLCAKLVRLMKGEIGVYN
CQSS_VIBCH      HFSVCIS--IEQTSEHNLIRVRDNGVGIAPEMLEDIFRDFYTFGKNGSGLGLPFCRKVMSAFGGTIRCAS
YTH3_RHOER      ----------------------------------------------------------------------
MPRB_MYCA1      GGHVGVTMR-QLDPSHAELVVSDHGPGIPPQERRLVFERFYRSTSAGSGLGLAIVKKVVLNHGGMLRVED
HSSS_STAS1      GGMVDVTLSQNL--ETITCTITDDGQGMSAETQARIFERFYKSSDNSNGLGLAIAKAIFELHHGTITVDS
ETR1_TOBAC      EGSVSIAPEFFPVQSELRVQVKDTGSGINPQDIPKLFCKFATKSSGGTGLGLAISKRFVNLMEGHIWIES
DHKC_DICDI      KGQVCISVEPEQVNEHLHFQVKDSGIGIKEENMSKLFAGFSQVNNGGTGLGLAISKDLVELMGGKIWCSS
BASS_SALTY      EGTITIHI---SADPDAIMAVEDEGPGIDESKCGKLSEAFVRMDSRGIGLGLSIVSRITQLHQGQFFLQN
ARLS_STAAW      XXXXXXXXXXXXXQKIIEIT--DHGIGIPEEDQDFIFDRFYSRSQGGNGLGLSIAQKIIQLNGGSIKIKS
ARLS_STAAS      XXXXXXXXXXXXXQKIIEIT--DHGIGIPEEDQDFIFDRFYSRSQGGNGLGLSIAQKIIQLNGGSIKIKS
ARLS_STAAR      XXXXXXXXXXXXXQKIIEIT--DHGIGIPEEDQDFIFDRFYSRSQGGNGLGLSIAQKIIQLNGGSIKIKS
ARLS_STAAN      XXXXXXXXXXXXXQKIIEIT--DHGIGIPEEDQDFIFDRFYSRSQGGNGLGLSIAQKIIQLNGGSIKIKS
ARLS_STAAM      XXXXXXXXXXXXXQKIIEIT--DHGIGIPEEDQDFIFDRFYSRSQGGNGLGLSIAQKIIQLNGGSIKIKS
ARLS_STAAC      XXXXXXXXXXXXXQKIIEIT--DHGIGIPEEDQDFIFDRFYSRSQGGNGLGLSIAQKIIQLNGGSIKIKS
ARLS_STAAB      XXXXXXXXXXXXXQKIIEIT--DHGIGIPEEDQDFIFDRFYSRSQGGNGLGLSIAQKIIQLNGGSIKIKS
ARLS_STAA8      XXXXXXXXXXXXXQKIIEIT--DHGIGIPEEDQDFIFDRFYSRSQGGNGLGLSIAQKIIQLNGGSIKIKS
ARLS_STAA3      XXXXXXXXXXXXXQKIIEIT--DHGIGIPEEDQDFIFDRFYSRSQGGNGLGLSIAQKIIQLNGGSIKIKS
RCSC_SALTY      -GCIVLHVRCDG--DYLSIRVRDTGVGIPAKEVVRLFDPFFQVGTQGTGLGLAICEKLISMMDGDISVDS
RCSC_SALTI      -GCIVLHVRCDG--DYLSIRVRDTGVGIPAKEVVRLFDPFFQVGTQGTGLGLAICEKLISMMDGDISVDS
CUTS_STRLI      QGWVEVATAVENGQ--AVLVVTNTGPVVPAYEVDNLFEPFRTGSDKGVGLGLSIARSVARAHGGHISAQP
CUTS_STRCO      QGWVEVATAVENGQ--AVLVVTNTGPVVPAYEVDNLFEPFRTGSDKGVGLGLSIARSVARAHGGHISAQP
SP2AB_BACME     DGVVYISVTLHE-DGVVELMIRDEGIGI--DNVDEAKQPLYTTKPERSGMG----FTIMENFMDEIRVES
GRAS_STAAR      NYNVDISTEL--IDQHVALIIKDHGRGISKKDMPRIFERGFTSETTSSGMGLYLVDSVKDQLGIQLQVTS
ETR1_PELHO      EGIISV-TAFVAKSESVRVQVKDSGSGINPQDMPKLFTPVATKNSGGSGLGLAISKRFVNLMDGHIWIDS
ETR1_MALDO      EGSISI-TAFVAKSESLRVQVKDSGSGINPQDIPKLFTKFAQTQSGGSGLGLAICKRFVNLMEGHIWIES
CREC_ECOLI      SGCITLSA--EVDQEHVTLKVLDTGSGIPDYALSRIFERFYSNGQKSSGLGLAFVSEVARLFNGEVTLRN
PHOR_HAEIN      QCHIQI--QWETCEQGIKFNVIDNGVGISPQHIPHLTERFYRVDESGSGLGLAIVKHTLLQYHSHLNIES
GTCS_ANEMI      KGT-KVALSLTDTHEAILLEVMDNGIGIAEELKESIFQPFVARTGEGTGLGL------------------
ETR1_ARATH      QGSISVTALVTKSDTRAAVKVKDSGAGINPQDIPKIFTKFAQTQSLATXXXXAISKRFVNLMEGNIWIES
BCES_BACSU      S---EIEIKSFQKGEQTQLQVKDCGRGIDPKDVPRIFDKGFTSDQASTGMGXXXXXXXXXXXXIHIDVES
QSEC_HAEIN      D------TXXXXXXXXXXXXXEDNGGGVEPEDLKKLGQRFYRPNEKGSGLGLSIVMRIAELHGFKVRLEN
PFES_PSEAE      DGTVSLD-----GEREGDLRLQDQGPGVAEDQLERIFLPYQRLDDEGFGLGLAIARRAIELQGGRLWA-S
GRAS_STAHJ      QDIII---RSYTNDGHVTLEIKDFGRGISHKDLPRIFERGFTSETTSSGIGLYLVNSVKDQLGINVRVES
RSTB_ECOLI      ----TVETSLLLSGNRATLIVEDDGPGIAPENREHIFEPFVPSRDRGCGLGLAIVHSIALAMGGTVNCDT
MPRB_MYCLE      GGRVVVTMR-QFDPSHVELVVSDYGPGIPPQERRLVFERFYRSTTAGSGLGLAIVKQVVINHGGLLRVED
ETR2_PELHO      EGNISI-TAFVAKSESLRVQVKDSGLGINPQDIPRLFTKFAQTQSGGSGLGLAICKRFVNLMEGHIWIDS
YEDV_ECOLI      KSRIHI-TSFLDTNSYLNIDIA--SPGTKINEPEKLFRRFWSRHSVGQGLGLSLVKAIAELHGGSATYH-
ETR1_BRAOL      QGSISVTALVTKSDNRLRVKVKDLGAGINPQDIPKLFTKFAQTQSLATXXXXAISKRFVNLMEGNIWIES
GLNK_BACSU      EGMVSLRLR-KPNESMVEFQVEDNGPGISEKIGDIVFDPGFTSKTPSTGIGLSYVKEIVTELEGDITFDN
DHAR_ECOLI      ----------------------------------------------------------------------
CZCS_RALME      NSMIDLVVRREAAH--CCIDITNVGDPIPERELSLIFDRFFSNSSQSTGLGLAIVLSIMELHGGDASAVS
YXDK_BACSU      GKSDRLELNVFCDEDRTVLEVKDYGVGIPSQDIKRVFDPYYTGENESTGIGLHLVKEITDKLNHTVDISS
SENX3_MYCTU     GSLVSISRRRRGANIEIA--VTDRGIGIAPEDQERVFERFFSRATGGSGLGLAIVKHVAANHDGTIRVWS
SENX3_MYCBO     GSLVSISRRRRGANIEIA--VTDRGIGIAPEDQERVFERFFSRATGGSGLGLAIVKHVAANHDGTIRVWS
MPRB_MYCSS      GGRVGVRLT-QTDPVHAELVVSDQGPGIPEAERRLVFERFYRSTAAGSGLGLAIVKQVVLKHGGALRVED
MPRB_MYCSK      GGRVGVRLT-QTDPVHAELVVSDQGPGIPEAERRLVFERFYRSTAAGSGLGLAIVKQVVLKHGGALRVED
MPRB_MYCSJ      GGRVGVRLT-QTDPVHAELVVSDQGPGIPEAERRLVFERFYRSTAAGSGLGLAIVKQVVLKHGGALRVED
MALK_BACSU      K-QITMSMRFHNSILDIEIT--DTGAGMSEEDQAKVFEQGYSTKGKNRGFGLYFTQQSIENLKGQMILTS
KDPD_MYCTU      APDCVVRVNAGRVRERVLINVIDEGPGVPRGTEEQLFAPFQRPGDTGVGLGMSVARGFVEAMGGTISATD
CQSS_VIBHB      E-DFHIHVTMYSDEFANQIVVTDNGSGIAPEVLQSIFQDFYTTGKSGNGLGLPFCKKVMRSFGGDIRCQS
PCOS_ECOLX      DNTCT-AIHLERDSDCVNVMITNTMSGQVPANLERLFDRFYRADSEGAGLGLSITRSIIHAHGGELSAEQ
KDPD_RATRA      GAVPTIDQSFGDT---VQIRVTDHGPGIAADRRDDVFVPFDTDNSTGLGLGLALSKGFTVGMGGELDTED
MPRB_MYCS2      GGRVGV--RLHQVDHHAEIVVSDQGPGIPPEERRLVFERFYRSDAAGSGLGLAIVQQVVLKHGGALRIDE
GRAS_STAAN      NFNIEIGTELN--DQHVSLYIKDYGRGISKKDMPRIFERGFTSETTSSGMGLYLVNSVKDQLGIHLQVTS
GRAS_STAAM      NFNIEIGTELN--DQHVSLYIKDYGRGISKKDMPRIFERGFTSETTSSGMGLYLVNSVKDQLGIHLQVTS
GRAS_STAA9      NFNIEIGTELN--DQHVSLYIKDYGRGISKKDMPRIFERGFTSETTSSGMGLYLVNSVKDQLGIHLQVTS
GRAS_STAA2      NFNIEIGTELN--DQHVSLYIKDYGRGISKKDMPRIFERGFTSETTSSGMGLYLVNSVKDQLGIHLQVTS
GRAS_STAA1      NFNIEIGTELN--DQHVSLYIKDYGRGISKKDMPRIFERGFTSETTSSGMGLYLVNSVKDQLGIHLQVTS
NISK_LACLA      EGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKKNAGKLFFTRSGKHYGIGLSFAQGVALKHQGNL----
ETR1_PASED      EGSISITAIVAKLESYLRVQVKDSGVGINPQDIPKLFIKFAQTQSSGSGLGLAICRRFVNLMDGHIWLES
BCES_BACHD      SDIII---KSDVVSGKTVVEVTDFGRGIEPKDLPRIFEKGFTSTNGATGMGLYLAKRVAEPLLIDLAVSS
MPRB_MYCUA      GGRVGIRLR-QLDPSHAELVVSDNGPGISPQERRLVFERFYRSTSAGSGLGLAIVKQVVLNHGGSLRIED
HSSS_STAHJ      NSMIDV--NLFNNEGTIYFTVTNEGHTIPESVQPHLFDRFYNAEDNSNGLGLAITQSIIHLHRGQISVTS
GRAS_STAAW      NFNIEIGTELN--DQHVSLYIKDYGRGISKKDMPRIFERGFTSETTSSGMGLYLVNSVKDQLGIHLQVTS
GRAS_STAAT      NFNIEIGTELN--DQHVSLYIKDYGRGISKKDMPRIFERGFTSETTSSGMGLYLVNSVKDQLGIHLQVTS
GRAS_STAAS      NFNIEIGTELN--DQHVSLYIKDYGRGISKKDMPRIFERGFTSETTSSGMGLYLVNSVKDQLGIHLQVTS
GRAS_STAAE      NFNIEIGTELN--DQHVSLYIKDYGRGISKKDMPRIFERGFTSETTSSGMGLYLVNSVKDQLGIHLQVTS
GRAS_STAAC      NFNIEIGTELN--DQHVSLYIKDYGRGISKKDMPRIFERGFTSETTSSGMGLYLVNSVKDQLGIHLQVTS
GRAS_STAAB      NFNIEIGTELN--DQHVSLYIKDYGRGISKKDMPRIFERGFTSETTSSGMGLYLVNSVKDQLGIHLQVTS
GRAS_STAA8      NFNIEIGTELN--DQHVSLYIKDYGRGISKKDMPRIFERGFTSETTSSGMGLYLVNSVKDQLGIHLQVTS
GRAS_STAA3      NFNIEIGTELN--DQHVSLYIKDYGRGISKKDMPRIFERGFTSETTSSGMGLYLVNSVKDQLGIHLQVTS
CITA_KLEPN      QGSKQIECLINSDGQEVIIEIADQGCGIDEDRIFERGVTSSASKDHGIGLWLVRSY--VEQAGGSIVVEN
DPIB_ECOLI      EGNKIVELFLSDEGDDVVIEVADQGCGVPESLRDKIFEQGVSTREHGIGLYLIASY--VTRCGGVITLED
BPHY_PSEAE      PGRPVLVTLTRQGD-EVCLSVLNETSGLSEAQLANLFEPFKRESANGLGIGLYISQAIAQAHQGRIDVDC
MPRB_MYCBP      GGHVGVRSQLDASHAE--LVVSDRGPGIPVQERRLVFERFYRSASAGSGLGLAIVKQVVLNHGGLLRIED
MPRB_MYCBO      GGHVGVRSQLDASHAE--LVVSDRGPGIPVQERRLVFERFYRSASAGSGLGLAIVKQVVLNHGGLLRIED
HSSS_STAAT      GGAIDIALQH--SHNNIIFTISNDGSPISPQAEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
HSSS_STAAE      GGAIDIALQH--SHNNIIFTISNDGSPISPQAEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
HSSS_STAAC      GGAIDIALQH--SHNNIIFTISNDGSPISPQAEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
HSSS_STAA8      GGAIDIALQH--SHNNIIFTISNDGSPISPQAEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
HSSS_STAA3      GGAIDIALQH--SHNNIIFTISNDGSPISPQAEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
DHKG_DICDI      ----------------------------------------------------------------------
YVCQ_BACSU      PITIRIETQGH----ETRLSVADEGIGIPPQDLPRIFDAFFTTMKEATGMGLYLAKQVCSRLGHKLYAES
SP2AB_THETN     IGIITI--RAFILDNKITIEVIDEGKGI--EDVEKAMQPLFTTREERAGMGFTVMQTFMDE----LEVES
MPRB_MYCTU      GGHVGVRSQLDASHAE--LVVSDRGPGIPVQERRLVFERFYRSASAGSGLGLAIVKQVVLNHGGLLRIED
MPRB_MYCTA      GGHVGVRSQLDASHAE--LVVSDRGPGIPVQERRLVFERFYRSASAGSGLGLAIVKQVVLNHGGLLRIED
BASS_ECOLI      GSNIMIKLQ---EDDGAVMAVEDEGPGIDESKCGELSKAFVRMDSRGIGLGLSIVSRITQLHHGQFFLQN
SP2AB_THEPX     IGIITI--KAFISGNKITIEVIDEGKGI--EDIEKAMQPLFTTREERAGMGFTVMQTFMDE----LEVES
SP2AB_THEP3     IGIITI--KAFISGNKITIEVIDEGKGI--EDIEKAMQPLFTTREERAGMGFTVMQTFMDE----LEVES
PHOQ_SHIFL      LEFVEISAR--QTDEHLYIVVEDDGPGIPGQRVDTLRP--------GQGVGLAVAREITEQYEGKI----
PHOQ_ECOLI      LEFVEISAR--QTDEHLYIVVEDDGPGIPGQRVDTLRP--------GQGVGLAVAREITEQYEGKI----
PHOQ_ECOL6      LEFVEISAR--QTDEHLYIVVEDDGPGIPGQRVDTLRP--------GQGVGLAVAREITEQYEGKI----
SP2AB_GEOTN     DPNGIVFISVVIEDGIVHLTVRDEGVGIA--NIDEARQPLFTTKPELERSGMG--FTIMENFMDEVVVES
SP2AB_GEOKA     DPNGIVSISVIIEDGVVHLTVRDEGVGIP--DIEEARQPLFTTKPELERSGM--GFTIMENFMDEVIVES
SP2AB_CLOPE     DESKVVIIEASICEDEISITVEDNGIGI--ENLEEAREPLYTSKPERSGMGFTVMETFMDS----LEVYS
SP2AB_CLOP1     DESKVVIIEASICEDEISITVEDNGIGI--ENLEEAREPLYTSKPERSGMGFTVMETFMDS----LEVYS
HSSS_STAAW      GGAIDIALQH--SHNNIIFTISNDGSPISPQAEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
HSSS_STAAS      GGAIDIALQH--SHNNIIFTISNDGSPISPQAEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
SP2AB_BACST     DPNGIVSISVIIEDGVVHLTVRDEGVGIP--DIEEARQPLFTTKPELERSGM--GFTIMENFMDEVIVES
HSSS_STAAN      GGAIDIALQH--SHNNIIFTISNDGSPISPQAEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
HSSS_STAAM      GGAIDIALQH--SHNNIIFTISNDGSPISPQAEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
HSSS_STAA9      GGAIDIALQH--SHNNIIFTISNDGSPISPQAEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
HSSS_STAA2      GGAIDIALQH--SHNNIIFTISNDGSPISPQAEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
HSSS_STAA1      GGAIDIALQH--SHNNIIFTISNDGSPISPQAEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
BPHY_DEIRA      EPRIAVRTERQGAGW--SIAVSDQGAGIAPEYQERIFLLFSLDEALGNGLGLPLCRKIAELHGGTLTVES
SPHS_SYNE7      GGCLYVELRQRGDTWICDL--YDDGPGFADADLPYLFERFYXXXXXXXXXXXXIARQVVEAHQGRISARN
CSEC_STRCO      PVEVSVEGRV--------IRVRDHGPGFPEDLLAEGPSRFRTRAGRGHGLGLTIA---------------
TCSB_EMENI      QGTVAIRIKCVGEEKNPSASVEDTGPGIPQHLQNRVFEPFLNRKYGGTGLGLSICSQLARLMRGQIQLNS
SP2AB_BACLD     QGNVYISVTLE--DHIVYLTIRDEGVGIP--NLEEARQPLFTTKPELERSGM--GFTIMENFMDDISIDS
SP2AB_ANOFW     SGVVYISVIIEG--HTVHLTIRDHGKGI--ENVEEARQPLFTTKPELERSGMG--FTIMENFMDEVNIYS
HSSS_STAAB      GGAIDIALQH--SHNNIIFTISNDGSPISPQVEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
DHKI_DICDI      ----------------LKFSIKDRGIGVPEDKHDFIFDRFFQVDGSGVGLGLSICKKLIEFFGGAIWFES
SP2AB_BACWK     EGVVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
SP2AB_BACHK     EGVVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
SP2AB_BACCZ     EGVVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
SP2AB_BACCQ     EGVVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
SP2AB_BACC7     EGVVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
SP2AB_BACC3     EGVVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
SP2AB_BACC1     EGVVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
SP2AB_BACC0     EGVVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
SP2AB_BACAN     EGVVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
SP2AB_BACAH     EGVVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
SP2AB_BACAC     EGVVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
SP2AB_BACAA     EGVVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
DHKJ_DICDI      QGEVDLVVKLSCGEVVLKFSVIDTGIGIPKDKL-------------------------------------
ACOR_RALEH      ----------------------------------------------------------------------
TCSA_EMENI      KGSIHVKIXXXXXXXXXXXXXXXXGIGVPDSAINTLFTPFSARKYQGTGLGLSICKSLAELMDGSV----
SP2AB_BACC4     EGIVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
SP2AB_BACC2     EGIVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
PHOQ_ECO57      LEFVEISAR--QTDEHLYIVVEDDGPGIPGQRVDTLRP--------GQGVGLAVAREITKQYEGKI----
SLN1_YEAST      DGTVDVRMKLLGEDKELS----------------------------------------------------
HSSS_STAAR      GGAIDIALQH--SHNNIIFTISNDGSPISPQAEARLFERFYKVSDNSNGLGLAITKSIIELHHGTIQFTQ
GRAS_STAES      S---TINLSGYNIEGHVVLKIKDYGRGISKRDLPRIFDRGFTTTDRNSGMGLYLVQSVKEQLGIEVKVDS
GRAS_STAEQ      S---TINLSGYNIEGHVVLKIKDYGRGISKRDLPRIFDRGFTTTDRNSGMGLYLVQSVKEQLGIEVKVDS
SP2AB_BACLI     QGNVYISVTLE--DHIVYLTIRDEGVGIP--DLEEARQPLFTTKPELERSGM--GFTIMENFMDDISIDS
CSEC_STRAW      PIEVSVEGRV--------IRVRDHGPGFPADGPRRFRTGSTDRAGHGHGLGLTIA---------------
LYTS_BACAN      KKQPVCEVEVHVFEKEVHFEVKDNGQGIEEERLEQLGKMVVSSK-KGTGTAL---YNINERLIGMLHIES
DHKH_DICDI      NGQIIVGCEIY-----------------------------------------------------------
LYTS_BACCR      KKQPVCEVEVHVFEKEVHFEVKDNGQGIEEERLEQLGKMVVSSK-KGTGTAL---YNINERLIGMLHIES
SP2AB_BACCR     EGIVYISVILE--EAMVKLTIRDEGIGI--FNLDEARQPLFTTKPELERSGM--GFTIMENFMDEVEVIS
CSSS_BACSU      KIEISMKQD----DRNIVITIKNDGPHIEDEMLSSLYEPFNKGKKGEFGIGLSIVKRILTLHKASISIEN
COPS_PSESM      GETIKVSIHDHGG--RVELRLENPGPEIVPQHLDRIFDRFY-----------------------------
SP2AB_CLOPS     DESKVVIIEASICEDEISITVEDNGIGI--ENLEEAREPLYTSKPERSGMGFTVMETFMD----------
SEX3_MYCLE      GGSLVSISRRRRGDN-IEIAVTDRGIGIALEDQERVFERFFSRATGGSGLGLAIVKHVAANHNGSIGVWS
REGB_RHOS4      RSTVWIDGEW--TGDRIAIRIVDDGEGYPPAIIGRIGDPFVXXXXEGMGLGLFIAKTLLERSGAELSFAN
QSEC_SALTY      QGSVVDVT-LHAR----SFTVRDNGPGVAPEILTHIGERFYRPPGQGSGLGLSIVRRIATLH--------
QSEC_SALTI      QGSVVDVT-LHAR----SFTVRDNGPGVAPEILTHIGERFYRPPGQGSGLGLSIVRRIATLH--------
DHKE_DICDI      ---------------KLSFSVEDSGVGIKEEVLDCLFTPFHPRKYLGTGLGLSISKKLTTLMGGEIGVKS
PHOQ_SALTY      LEFVEISAR--QTDDHLHIFVEDDGPGIPHSKVFDRGQRADTLRP-GQGVGLAVAREITEQYAGQIIASD
PHOQ_SALTI      LEFVEISAR--QTDDHLHIFVEDDGPGIPHSKVFDRGQRADTLRP-GQGVGLAVAREITEQYAGQIIASD
PHOQ_SALPA      LEFVEISAR--QTDDHLHIFVEDDGPGIPHSKVFDRGQRADTLRP-GQGVGLAVAREITEQYAGQIIASD
PHOQ_SALCH      LEFVEISAR--QTDDHLHIFVEDDGPGIPHSKVFDRGQRADTLRP-GQGVGLAVAREITEQYAGQIIASD
GRAS_STAS1      -----IHIRALKESRHVVLEIKDEGKGISEKDLPRIFDKGFXXXXXXXGLGLYLVNHVKEKLSICVRIHS
CNPD_PELLD      ----------------------------------------------------------------------
QSEC_ECO57      QGIKRTAVRYSPQGSVVDVTVRDNGPGVTPEALARIGERFYRPPGQGSGLGLSIVQRIAKLHGMNVE---
NREB_STAAR      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
CHEA_THEMA      KGKPPIGTLILSARHEVVIEVEDDGRGIDKEKIIRLFVPGFSTKEKGRGVGMDVVKNVVESLNGSISIES
YQIR_BACSU      ----------------------------------------------------------------------
NREB_STAAW      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
NREB_STAAT      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
NREB_STAAS      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
NREB_STAAN      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
NREB_STAAM      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
NREB_STAAE      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
NREB_STAAC      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
NREB_STAAB      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
NREB_STAA9      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
NREB_STAA8      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
NREB_STAA3      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
NREB_STAA2      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
NREB_STAA1      -----LNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFDPSSKPKGSGLGLYGMNERAELVSGSVNIET
QSEC_ECOLI      QGSVVDVTL-----NADNFIVRDNGPGVTPEALARIGERFYRPPGQGSGLGLSIVQRIAKLHGMNVE---
TOP6B_ARCFU     AGILPIFVRISKVDDHFKIVVEDNGPGIPREQIPKVGSRFHEIRQQGIGISAAVLYAQLTTGKPATVISK
HPRK_STAES      ----------------------------------------------------------------------
HPRK_STAEQ      ----------------------------------------------------------------------
HPRK_STAAW      ----------------------------------------------------------------------
HPRK_STAAT      ----------------------------------------------------------------------
HPRK_STAAS      ----------------------------------------------------------------------
HPRK_STAAR      ----------------------------------------------------------------------
HPRK_STAAN      ----------------------------------------------------------------------
HPRK_STAAM      ----------------------------------------------------------------------
HPRK_STAAE      ----------------------------------------------------------------------
HPRK_STAAC      ----------------------------------------------------------------------
HPRK_STAAB      ----------------------------------------------------------------------
HPRK_STAA9      ----------------------------------------------------------------------
HPRK_STAA8      ----------------------------------------------------------------------
HPRK_STAA3      ----------------------------------------------------------------------
HPRK_STAA2      ----------------------------------------------------------------------
HPRK_STAA1      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           TIDEGTCFKVYLPVYEQF
ATOS_ECOLI      LPGYGATFTLILPINPQ-
KINC_BACSU      EAGKGSVFQVVLPL----
KINE_BACSU      EEGKGTVFHITLPV----
ZRAS_SALTI      IEGKGAVFTIWLPV----
ZRAS_SALTY      IEGKGAVFTIWLPV----
KINA_BACSU      HPEKGTAFKISFP-----
KIND_BACSU      EVRRGTEVTITLPV----
ZRAS_ECOLI      QEGKGSTFTLWLPV----
PILS_PSEAE      REEGGGCFRI--------
ZRAS_ECO57      LEGKGARFTLWLPV----
KINB_BACSU      SFQKGTTVTIKLP-----
ZRAS_KLEOX      APGKGALFTFYLPVNGQ-
DEGM_BACB2      KPGKGTKVVLSLPIEKE-
NTRB_KLEOX      WPGH-TEFSVYLPI----
NTRB_SALTY      WPGH-TEFSVYLPI----
NTRB_SALTI      WPGH-TEFSVYLPI----
NTRB_VIBAL      WPGH-TTFTIYLPI----
NTRB_SHIFL      WPGH-TEFSVYLPI----
NTRB_ECOLI      WPGH-TEFSVYLPI----
NTRB_ECO57      WPGH-TEFSVYLPI----
WALK_STAHJ      VEGQGTSIFITLP-----
FIXL_BRAJA      NASGGATFRFTLPAADE-
NTRB_AZOBR      Q-PRRTVFKVSLPMFDE-
VIRA_AGRT9      TVGHGTRFDIYLP-----
WALK_STAAE      VEGQGTSIFITLP-----
FIXL_AZOC5      NAGGGTIFRFTLRTVDE-
VIRAW_RHIRD     TVGHGTRFDIYLP-----
WALK_STAAW      VEGQGTSIFITLP-----
WALK_STAAU      VEGQGTSIFITLP-----
WALK_STAAT      VEGQGTSIFITLP-----
WALK_STAAS      VEGQGTSIFITLP-----
WALK_STAAR      VEGQGTSIFITLP-----
WALK_STAAN      VEGQGTSIFITLP-----
WALK_STAAM      VEGQGTSIFITLP-----
WALK_STAAC      VEGQGTSIFITLP-----
WALK_STAAB      VEGQGTSIFITLP-----
WALK_STAA9      VEGQGTSIFITLP-----
WALK_STAA8      VEGQGTSIFITLP-----
WALK_STAA3      VEGQGTSIFITLP-----
WALK_STAA2      VEGQGTSIFITLP-----
WALK_STAA1      VEGQGTSIFITLP-----
NTRB_RHOCA      APGR-TLFRISLPV----
NTRB_RHILP      Q-NSRTTFRVLMP-----
NODV_BRAJA      KNGPGATFQFALPLHKE-
DCTB_RHIME      G-PSGTTFAVNL------
WALK_STAES      VEGQGTSIFITLP-----
WALK_STAEQ      VEGQGTSIFITLP-----
NTRB_RHIME      Q-HSRTTFRVLMP-----
Y3689_SHEFN     TLGKGTQIRLIFALAQQ-
WALK_STASR      KEGQGTSIYITLP-----
VIRA_AGRT5      AVGRGTRFDIYLP-----
WALK_STAS1      VEGQGTSIFITLP-----
NTRB_BRASR      ------------------
PHOR_BACSU      ELGRGTVFTVTL------
YYCG_BACSU      IEGKGTTITFTLPYKEE-
STC_CLOBE       ------------------
PDHS_OCHA4      TPGHGTVVEIAFP-----
DCTB_RHILE      D-SGGTRFIVQL------
NTRYL_RICBR     ------------------
SASA_CYAP7      TINQGSCFHFTLPVF---
RESE_BACSU      RIDKGTTFSFYIP-----
DIVJ_CAUCR      RLGAGTTVSVRLPV----
SASA_SYNY3      RPKQGSSFHFTLPVY---
SASA_PROMM      EPDKGACFYLTVPVWQR-
FIXL_RHIME      NEAGGATFRFTLPAY---
SASA_CYAA5      VPGQGSCFHFTLPVY---
PDHS_BRUSU      NPGQGTVVEIVFP-----
PDHS_BRUSI      NPGQGTVVEIVFP-----
PDHS_BRUME      NPGQGTVVEIVFP-----
PDHS_BRUAB      NPGQGTVVEIVFP-----
PDHS_BRUA2      NPGQGTVVEIVFP-----
PDHS_BRUA1      NPGQGTVVEIVFP-----
DCTS_RHOCA      RAGGGTVFTVTLPVPQE-
PLEC_CAUCR      TPGEGTTVSFTLPV----
PDHS_BRUC2      NPGQGTVVEIVFP-----
NTRY_AZOBR      REGGGARVGLVIP-----
SASA_PROM3      EPDKGACFYLTVPVWQR-
MTRB_MYCTU      EPGEGACFRLTLPM----
MTRB_MYCBO      EPGEGACFRLTLPL----
LOVHK_PSE14     EEGVGTTLRLYFPVDE--
SASA_SYNJA      ILGKGSSFHFTLPVY---
SASA_PROM2      ELSEGSCFHFTVPVWQ--
NTRYL_RICPR     REDEGAIIDIKFDLKE--
LUXQ_VIBHA      SKGGGTTFVITLPVKDR-
SASA_PROMP      EVGEGSCFHFTVPVWQ--
PDHS_BRUO2      NPGQGTVVEIVFP-----
VIRAL_RHIRD     TVGRGTRFDIYLP-----
LOVHK_PSESM     EEGVGTTLRLYFPVDE--
SASA_SYNJB      SLGKGSSFHFTLPVY---
SASA_NOSP7      APNNGAWFHFTLPVY---
SRRB_STAAR      ELGKGTTFIIKLP-----
SASA_PROMA      QPGEGSCFYFTVPVWDK-
KINB_PSEAE      QPGQGARFYMLLPV----
SASA_THEEB      QPGKGSCFHFTLPVY---
NTRYL_RICFE     REEEG-------------
LOVHK_PSEU2     EEGVGTTLRLYFPVDE--
SRRB_STAAW      ELGKGTTFIIKLP-----
SRRB_STAAU      ELGKGTTFIIKLP-----
SRRB_STAAS      ELGKGTTFIIKLP-----
SRRB_STAAC      ELGKGTTFIIKLP-----
SRRB_STAA8      ELGKGTTFIIKLP-----
SASA_SYNE7      ELGQGSTFHFTMPVY---
SRRB_STAAN      ELGKGTTFIIKLP-----
SRRB_STAAM      ELGKGTTFIIKLP-----
MTRB_MYCLE      EPGQGACFRLTLPL----
NTRY_AZOC5      ------------------
SASA_PROM0      EVGVGSCFHFTVPVWQ--
SASA_SYNS3      EPEKGACFTFNVPIWQ--
MTRB_MYCPA      EPGVGSCFRLTLPL----
YCF26_PORYE     ELKNGSCF----------
SASA_PROMS      EVGVGSCFHFTVPVWQ--
SASA_PROM9      EIGVGSCFHFTVPVWQ--
NTRYL_RICCN     REAEGAIIDIKFDLKE--
SASA_ANASP      NPHGGAWFHFTLPVY---
SASA_SYNPX      EPGEGACFTFTVPIWQ--
SASA_ANAVT      NPHGGAWFHFTLPVY---
NTRYL_RICTY     REDKGAIIDIKFDLKE--
LUXQ_VIBPA      QKGQGTTFVVTLPVKDR-
PHOR_SHIDY      TVGKGTRFSFVIP-----
NTRB_PROVU      W-PGNTEFSIYLPI----
SASA_SYNS9      EPEEGACFTFTVPIWQ--
SASA_CYAP8      VPDQGSCFHFTLPV----
PHOR_KLEPN      TVGKGTRFSFLLP-----
YVRG_BACSU      RTNIGTVITI--------
PHOR_ECOLI      TVGKGTRFSFVIP-----
ARCB_SHIFL      EQGKGSTF----------
ARCB_ECOLI      EQGKGSTF----------
ARCB_ECO57      EQGKGSTF----------
YCF26_PORPU     ELKNGSCF----------
SASA_MICAN      VPDHGSSFHFTLPVY---
DSPA_SYNY3      EVGVGTTFWFDLAVYQ--
Y1002_RHIME     AEGEGTVIVVTIP-----
PGTB_SALTY      TLTRNAC-----------
BVGS_BORBR      APGVGTTVSVDL------
BVGS_BORPA      APGVGTTVSVDL------
CHVG_AGRT5      VVDKGARFTLSLPAAE--
KDPD_ECOLI      RPEGGACFRVTLP-----
DCTS_BACSU      HAGQGTSFSIVFPM----
LUXQ_VIBVU      ELCKGSTFYLSIPV----
RPRX_BACFR      ELNVGTKFIIALPL----
LUXQ_VIBVY      ELCKGSTFYLSIPV----
DOKA_DICDI      GDQEG-------------
BVGS_BORPE      APGVGTTVSVDL------
LUXQ_VIBCH      EYGIGTRFEIQLPI----
SAES_STAAW      DIDVGTTMTVTL------
SAES_STAAS      DIDVGTTMTVTL------
SAES_STAAR      DIDVGTTMTVTL------
SAES_STAAN      DIDVGTTMTVTL------
SAES_STAAM      DIDVGTTMTVTL------
SAES_STAAE      DIDVGTTMTVTL------
SAES_STAAC      DIDVGTTMTVTL------
SAES_STAAB      DIDVGTTMTVTL------
SAES_STAA8      DIDVGTTMTVTL------
SAES_STAA3      DIDVGTTMTVTL------
DHKD_DICDI      ISTGGAQFTLRLPL----
CHVG_RHIME      ------------------
DCTS_BACHD      ELNIGTTFSIYLP-----
CPXA_ECOLI      SPLGGLRLVIWLPLYKR-
CPXA_ECOL6      SPLGGLRLVIWLPLYKR-
CPXA_ECO57      SPLGGLRLVIWLPLYKR-
CITS_BACHD      GELGGACFVLTIPKHE--
VANS_ENTFC      N-DNYTTFRVELP-----
RSSA_SERMA      LDDRGIGFIIDLP-----
PHYA_ANASP      QLGEGATFYFTIPV----
DHKA_DICDI      IVGQGSKFKCIIP-----
NIFL_AZOVI      DYREGCRIVVELP-----
BAES_ECOLI      SPFGGVSITVELPL----
SAES_STAES      DLDIGTTMTLTLKKFQ--
SAES_STAEQ      DLDIGTTMTLTLKKFQ--
PHY1_SYNY3      NPGEGSTFYFSIPI----
DCUS_SHIFL      EPGIFTQFFVQIP-----
DCUS_ECOLI      EPGIFTQFFVQIP-----
DCUS_ECOL6      EPGIFTQFFVQIP-----
DCUS_ECO57      EPGIFTQFFVQIP-----
GACS_PSESY      TPGEGSEFWISL------
DLTS_STRA5      EKDQ-LRLEVQLPI----
YKOH_BACSU      KPGQGT------------
PHYB_ANASP      TYGEGSTF----------
DLTS_STRA3      EKDQ-LRLEVQLPI----
TORS_ECO57      TPEVGSCFCLRLPL----
KDPD_CLOAB      KGSGGAIFKFNIP-----
MAK1_SCHPO      RRGVGTRF----------
YCBM_BACSU      KPYERTAFTITL------
DIVL_CAUCR      EPGNGSTFTCHLPETQQ-
BARA_SHIFL      QPNRGSTF----------
BARA_ECOLI      QPNRGSTF----------
BARA_ECOL6      QPNRGSTF----------
BARA_ECO57      QPNRGSTF----------
ENVZ_SALTI      SERGGLSIRAWLPV----
DHKB_DICDI      EFGVGSTFSFTIP-----
ACOR_BACSU      ------------------
TORS_ECOLI      TPEVGSCFCLRLPL----
ENVZ_SALTY      SERGGLSIRAWLPV----
CITS_BACSU      QKTGGAVFTVFIPKEKQ-
ARLS_STAS1      EVDKYTTFKI--------
YCLK_BACSU      EEGKGTKFIIRLPL----
SENX3_MYCS2     QPGTGSTFTLSIPEY---
CUSS_ECOL6      DV-RGTRFVIILP-----
ARLS_STAHJ      EVNQYTTFKI--------
SILS_SALTY      DV-HSTRFILSVPRLEK-
PHOR_PSEAE      VPGKGSTF----------
YFHK_ECOLI      ESGQDVCFRIELP-----
MAK2_SCHPO      VYGEGSTF----------
DHKL_DICDI      QYGHGTCFKKFLP-----
IRLS_BURPS      EPHVRTTFWLKFPAH---
ETR1_CUCSA      ------------------
DHAR_CITFR      ------------------
CUSS_ECOLI      DA-RGTRFVITLP-----
SPAK_BACSU      TIAGGAEVRVKIPL----
RPFC_XANCP      NQPSGSVFWFELPM----
RPFC_XANC8      NQPSGSVFWFELPM----
LUXN_VIBHB      KLGTFTEFHLYFPV----
LUXN_VIBHA      KLGTFTEFHLYFPV----
ETR1_PRUPE      EGPGKGCTAIFI------
ETR1_CUCMR      ------------------
ARLS_STAES      ELQKYTTFKISFPV----
ARLS_STAEQ      ELQNYTTFKISFPV----
MPRB_MYCVP      TVPGGT------------
CUSS_ECO57      NA-RGTRFVIVLP-----
AFSQ2_STRCO     APEGGAVFTLRLP-----
ETR1_SOLLC      ------------------
ENVZ_SHIFL      SERGGLSIRAWLPV----
ENVZ_ECOLI      SERGGLSIRAWLPV----
MPRB_MYCPA      TVPPGTSFYVLLP-----
ETR2_SOLLC      ------------------
CIAH_STRR6      NKPKGTIFEVKIAI----
CIAH_STRPN      NKPKGTIFEVKIAI----
RCSC_ECOLI      EPGMGSQFTVRIPLY---
DHKK_DICDI      NPDDGSTFWFILPLEE--
CQSS_VIBCH      QQGQWTEFVLSFPRYD--
YTH3_RHOER      ------------------
MPRB_MYCA1      TVPPGTSFYVLLP-----
HSSS_STAS1      EKNAGTTFTI--------
ETR1_TOBAC      ------------------
DHKC_DICDI      NAEAGCTFHFVIPL----
BASS_SALTY      ------------------
ARLS_STAAW      EINKGTTFKI--------
ARLS_STAAS      EINKGTTFKI--------
ARLS_STAAR      EINKGTTFKI--------
ARLS_STAAN      EINKGTTFKI--------
ARLS_STAAM      EINKGTTFKI--------
ARLS_STAAC      EINKGTTFKI--------
ARLS_STAAB      EINKGTTFKI--------
ARLS_STAA8      EINKGTTFKI--------
ARLS_STAA3      EINKGTTFKI--------
RCSC_SALTY      EPGMGSQFTLRIPLY---
RCSC_SALTI      EPGMGSQFTLRIPLY---
CUTS_STRLI      REGGGLVMRVTLPV----
CUTS_STRCO      REGGGLVMRVTLPV----
SP2AB_BACME     TVLEGT------------
GRAS_STAAR      TIGKGTTVKLIFPLQNE-
ETR1_PELHO      ------------------
ETR1_MALDO      ------------------
CREC_ECOLI      VQEGG-------------
PHOR_HAEIN      TETKGSSFSFIIP-----
GTCS_ANEMI      ------------------
ETR1_ARATH      ------------------
BCES_BACSU      EFGAGTVFTLTFPIRNQF
QSEC_HAEIN      VVKEG-------------
PFES_PSEAE      NGKPGLCLHLWLP-----
GRAS_STAHJ      TVGQGTTFVLTFP-----
RSTB_ECOLI      SELGGARFSFSWPLW---
MPRB_MYCLE      TAPPGTSIYVLLP-----
ETR2_PELHO      ------------------
YEDV_ECOLI      YLNKHNVFRITLP-----
ETR1_BRAOL      ------------------
GLNK_BACSU      Q-QRGVVFAIRLPV----
DHAR_ECOLI      ------------------
CZCS_RALME      GLDGKTRFTLRFPL----
YXDK_BACSU      SPGEGT------------
SENX3_MYCTU     KPGTGSTFTLALP-----
SENX3_MYCBO     KPGTGSTFTLALP-----
MPRB_MYCSS      TVPPGTSFYVMLP-----
MPRB_MYCSK      TVPPGTSFYVMLP-----
MPRB_MYCSJ      TVPPGTSFYVMLP-----
MALK_BACSU      EKNEGTTFSIRIP-----
KDPD_MYCTU      T-----------------
CQSS_VIBHB      EVGEWSQFTMTFP-----
PCOS_ECOLX      QGRE-IVFKVRL------
KDPD_RATRA      TPGGGLTMVVTLPV----
MPRB_MYCS2      TVPGG-------------
GRAS_STAAN      TVGKGTTVRLIFPLQNE-
GRAS_STAAM      TVGKGTTVRLIFPLQNE-
GRAS_STAA9      TVGKGTTVRLIFPLQNE-
GRAS_STAA2      TVGKGTTVRLIFPLQNE-
GRAS_STAA1      TVGKGTTVRLIFPLQNE-
NISK_LACLA      ------------------
ETR1_PASED      ------------------
BCES_BACHD      TVGEGTTFTLTFPKENEF
MPRB_MYCUA      TVPGG-------------
HSSS_STAHJ      NDRDGTTFTVTLP-----
GRAS_STAAW      TVGKGTTVRLIFPLQNE-
GRAS_STAAT      TVGKGTTVRLIFPLQNE-
GRAS_STAAS      TVGKGTTVRLIFPLQNE-
GRAS_STAAE      TVGKGTTVRLIFPLQNE-
GRAS_STAAC      TVGKGTTVRLIFPLQNE-
GRAS_STAAB      TVGKGTTVRLIFPLQNE-
GRAS_STAA8      TVGKGTTVRLIFPLQNE-
GRAS_STAA3      TVGKGTTVRLIFPLQNE-
CITA_KLEPN      NIPFGTIFTLYIPL----
DPIB_ECOLI      NDPCGTLFSIYIP-----
BPHY_PSEAE      R-DDVITFCLRLPV----
MPRB_MYCBP      TQPPGTSIYVLLP-----
MPRB_MYCBO      TQPPGTSIYVLLP-----
HSSS_STAAT      SNEYVTTFTITLP-----
HSSS_STAAE      SNEYVTTFTITLP-----
HSSS_STAAC      SNEYVTTFTITLP-----
HSSS_STAA8      SNEYVTTFTITLP-----
HSSS_STAA3      SNEYVTTFTITLP-----
DHKG_DICDI      ------------------
YVCQ_BACSU      KEGAGTVMTI--------
SP2AB_THETN     TPGKGTLVRM--------
MPRB_MYCTU      TQPPGTSIYVLLP-----
MPRB_MYCTA      TQPPGTSIYVLLP-----
BASS_ECOLI      ------------------
SP2AB_THEPX     TPGKGTLVRM--------
SP2AB_THEP3     TPGKGTLVRM--------
PHOQ_SHIFL      ------------------
PHOQ_ECOLI      ------------------
PHOQ_ECOL6      ------------------
SP2AB_GEOTN     EVNKGT--TVYL------
SP2AB_GEOKA     EVNKGT--TVYL------
SP2AB_CLOPE     EKDKGT------------
SP2AB_CLOP1     EKDKGT------------
HSSS_STAAW      SNEYVTTFTITLP-----
HSSS_STAAS      SNEYVTTFTITLP-----
SP2AB_BACST     EVNKGT--TVYL------
HSSS_STAAN      SNEYVTTFTITLP-----
HSSS_STAAM      SNEYVTTFTITLP-----
HSSS_STAA9      SNEYVTTFTITLP-----
HSSS_STAA2      SNEYVTTFTITLP-----
HSSS_STAA1      SNEYVTTFTITLP-----
BPHY_DEIRA      APGEGSTFRCW-------
SPHS_SYNE7      PVTGGAWLRVQLP-----
CSEC_STRCO      ------------------
TCSB_EMENI      EQGRGTLFLVRIPL----
SP2AB_BACLD     SPEMGT------------
SP2AB_ANOFW     KVNEGT------------
HSSS_STAAB      SNEYITTFTITLP-----
DHKI_DICDI      EASQGSTFHFILSI----
SP2AB_BACWK     NESFGT------------
SP2AB_BACHK     NESFGT------------
SP2AB_BACCZ     NESFGT------------
SP2AB_BACCQ     NESFGT------------
SP2AB_BACC7     NESFGT------------
SP2AB_BACC3     NESFGT------------
SP2AB_BACC1     NESFGT------------
SP2AB_BACC0     NESFGT------------
SP2AB_BACAN     NESFGT------------
SP2AB_BACAH     NESFGT------------
SP2AB_BACAC     NESFGT------------
SP2AB_BACAA     NESFGT------------
DHKJ_DICDI      ------------------
ACOR_RALEH      ------------------
TCSA_EMENI      ------------------
SP2AB_BACC4     NESFGT------------
SP2AB_BACC2     NESFGT------------
PHOQ_ECO57      ------------------
SLN1_YEAST      ------------------
HSSS_STAAR      SNAYVTTFTITLP-----
GRAS_STAES      IVGKGTTFYFIFP-----
GRAS_STAEQ      IVGKGTTFYFIFP-----
SP2AB_BACLI     SPEMGT------------
CSEC_STRAW      ------------------
LYTS_BACAN      EVNEGTEITFVIP-----
DHKH_DICDI      ------------------
LYTS_BACCR      ELNEGTEITFVIP-----
SP2AB_BACCR     NESFGT------------
CSSS_BACSU      D-KTGVTYRIAVP-----
COPS_PSESM      ------------------
SP2AB_CLOPS     ------------------
SEX3_MYCLE      KPGTGSTFTLSIP-----
REGB_RHOS4      AAD---------------
QSEC_SALTY      ------------------
QSEC_SALTI      ------------------
DHKE_DICDI      VYGVGS------------
PHOQ_SALTY      SLLGGARMEV--------
PHOQ_SALTI      SLLGG<