[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49675.1

[Show Plain Result]


## Summary of Sequence Search
    1::176
    2::175     3e-48  50%  178 aa  SPMB_BACSU RecName: Full=Spore maturation protein B;
    1::176

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxELINQISRWAIPVMLLFIPLLAFIKKVPVFETFVEGAEAGFSTAIKTIPFLTAMLVAVSIFRASGAME
SPMB_BACSU      --EIINWLSLAMIPIIIAGILLYGTIKKVPTYESFVEGGKEGIEIAFSIIPYLVGMLVAITVFRSSGALD


                         .         .         *         .         .         .         .:140
query           LLASWISPVLNMVGIPADILPHAVMRPLSGGAALGIATEIIKTHGPDSFVGRLVSTMQGSSDTTFYVLTL
SPMB_BACSU      FIMDLLKPAFSAIGIPAEVVPLALIRPISGTAALGMTTDLIAVYGPDSFIGRLASVMQGSTDTTLYVLTV


                         +         .         .         .         .         *         .:210
query           YFGSVGIRKYRYAVASGLTADFTTLIASIMICKLMF
SPMB_BACSU      YFGAVGIKKMGDALKVGLLADLIGVVASIIIVTLLF