[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49707.1

[Show Plain Result]


## Summary of Sequence Search
    1::298
  156::233     1e-05  28%  436 aa  KCO6_ARATH RecName: Full=Probable calcium-activated
  152::228     2e-05  31%  443 aa  KCO2_ARATH RecName: Full=Probable calcium-activated
   53::108     3e-05  38%  246 aa  KCO4_ARATH RecName: Full=Putative outward-rectifying potassium
   12::89      6e-05  27%  343 aa  MJK2_METJA RecName: Full=Probable potassium channel protein
  380::485     6e-05  34% 1174 aa  KCNAE_DROME RecName: Full=Potassium voltage-gated channel protein
  390::468     8e-05  39%  962 aa  KCNH1_RAT RecName: Full=Potassium voltage-gated channel subfamily H
  417::495     8e-05  39%  989 aa  KCNH1_MOUSE RecName: Full=Potassium voltage-gated channel subfamily
  417::495     8e-05  39%  989 aa  KCNH1_HUMAN RecName: Full=Potassium voltage-gated channel subfamily
  417::495     8e-05  39%  987 aa  KCNH1_BOVIN RecName: Full=Potassium voltage-gated channel subfamily
  598::663     1e-04  31% 1163 aa  KCNH2_RAT RecName: Full=Potassium voltage-gated channel subfamily H
  598::663     1e-04  31% 1162 aa  KCNH2_MOUSE RecName: Full=Potassium voltage-gated channel subfamily
  596::661     1e-04  31% 1159 aa  KCNH2_HUMAN RecName: Full=Potassium voltage-gated channel subfamily
  595::660     1e-04  31% 1158 aa  KCNH2_CANFA RecName: Full=Potassium voltage-gated channel subfamily
  605::664     1e-04  33% 1195 aa  KCNH7_RAT RecName: Full=Potassium voltage-gated channel subfamily H
  605::664     1e-04  33% 1195 aa  KCNH7_MOUSE RecName: Full=Potassium voltage-gated channel subfamily
  605::664     1e-04  33% 1196 aa  KCNH7_HUMAN RecName: Full=Potassium voltage-gated channel subfamily
  306::365     1e-04  33%  526 aa  KCNH2_CHICK RecName: Full=Potassium voltage-gated channel subfamily
  252::304     2e-04  32% 1230 aa  KCNT1_HUMAN RecName: Full=Potassium channel subfamily T member
  454::508     2e-04  35%  950 aa  KCNH6_RAT RecName: Full=Potassium voltage-gated channel subfamily H
  454::508     2e-04  35%  994 aa  KCNH6_HUMAN RecName: Full=Potassium voltage-gated channel subfamily
  383::471     2e-04  29%  988 aa  KCNH5_RAT RecName: Full=Potassium voltage-gated channel subfamily H
  383::471     2e-04  29%  988 aa  KCNH5_MOUSE RecName: Full=Potassium voltage-gated channel subfamily
  383::471     2e-04  29%  988 aa  KCNH5_HUMAN RecName: Full=Potassium voltage-gated channel subfamily
  598::663     2e-04  31% 1161 aa  KCNH2_RABIT RecName: Full=Potassium voltage-gated channel subfamily
  226::332     3e-04  25%  828 aa  SKOR_ARATH RecName: Full=Potassium channel SKOR;AltName:
    5::124     4e-04  31%  134 aa  LCTB_BACCA RecName: Full=Protein lctB;
  196::250     4e-04  36% 1142 aa  KCNT2_RAT RecName: Full=Potassium channel subfamily T member
  196::250     4e-04  36% 1135 aa  KCNT2_HUMAN RecName: Full=Potassium channel subfamily T member
  368::416     4e-04  31%  498 aa  KCNAW_DROME RecName: Full=Potassium voltage-gated channel protein
  128::209     4e-04  28%  417 aa  KCH_ECOLI RecName: Full=Putative potassium channel protein;
   25::103     6e-04  25%  336 aa  MTHK_METTH RecName: Full=Calcium-gated potassium channel mthK;
  252::304     6e-04  30% 1237 aa  KCNT1_RAT RecName: Full=Potassium channel subfamily T member
  238::290     6e-04  30% 1224 aa  KCNT1_MOUSE RecName: Full=Potassium channel subfamily T member 1;
  271::302     6e-04  41% 1201 aa  KCNT1_CHICK RecName: Full=Potassium channel subfamily T member
  434::481     6e-04  33%  655 aa  KCNAS_DROME RecName: Full=Potassium voltage-gated channel protein
  369::419     8e-04  43%  557 aa  TWK7_CAEEL RecName: Full=TWiK family of potassium channels protein
    1::298

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KCO6_ARATH      ----------------------------------------------------------------------
KCO2_ARATH      ----------------------------------------------------------------------
KCO4_ARATH      ----------------------------------------------------------------------
MJK2_METJA      ----------------------------------------------------------------------
KCNAE_DROME     ----------------------------------------------------------------------
KCNH1_RAT       ----------------------------------------------------------------------
KCNH1_MOUSE     ----------------------------------------------------------------------
KCNH1_HUMAN     ----------------------------------------------------------------------
KCNH1_BOVIN     ----------------------------------------------------------------------
KCNH2_RAT       ----------------------------------------------------------------------
KCNH2_MOUSE     ----------------------------------------------------------------------
KCNH2_HUMAN     ----------------------------------------------------------------------
KCNH2_CANFA     ----------------------------------------------------------------------
KCNH7_RAT       ----------------------------------------------------------------------
KCNH7_MOUSE     ----------------------------------------------------------------------
KCNH7_HUMAN     ----------------------------------------------------------------------
KCNH2_CHICK     ----------------------------------------------------------------------
KCNT1_HUMAN     ----------------------------------------------------------------------
KCNH6_RAT       ----------------------------------------------------------------------
KCNH6_HUMAN     ----------------------------------------------------------------------
KCNH5_RAT       ----------------------------------------------------------------------
KCNH5_MOUSE     ----------------------------------------------------------------------
KCNH5_HUMAN     ----------------------------------------------------------------------
KCNH2_RABIT     ----------------------------------------------------------------------
SKOR_ARATH      ----------------------------------------------------------------------
LCTB_BACCA      ----------------------------------------------------------------------
KCNT2_RAT       ----------------------------------------------------------------------
KCNT2_HUMAN     ----------------------------------------------------------------------
KCNAW_DROME     ----------------------------------------------------------------------
KCH_ECOLI       ----------------------------------------------------------------------
MTHK_METTH      ----------------------------------------------------------------------
KCNT1_RAT       ----------------------------------------------------------------------
KCNT1_MOUSE     ----------------------------------------------------------------------
KCNT1_CHICK     ----------------------------------------------------------------------
KCNAS_DROME     ----------------------------------------------------------------------
TWK7_CAEEL      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KCO6_ARATH      ----------------------------------------------------------------------
KCO2_ARATH      ----------------------------------------------------------------------
KCO4_ARATH      ----------------------------------------------------------------------
MJK2_METJA      ----------------------------------------------------------------------
KCNAE_DROME     ----------------------------------------------------------------------
KCNH1_RAT       ----------------------------------------------------------------------
KCNH1_MOUSE     ----------------------------------------------------------------------
KCNH1_HUMAN     ----------------------------------------------------------------------
KCNH1_BOVIN     ----------------------------------------------------------------------
KCNH2_RAT       ----------------------------------------------------------------------
KCNH2_MOUSE     ----------------------------------------------------------------------
KCNH2_HUMAN     ----------------------------------------------------------------------
KCNH2_CANFA     ----------------------------------------------------------------------
KCNH7_RAT       ----------------------------------------------------------------------
KCNH7_MOUSE     ----------------------------------------------------------------------
KCNH7_HUMAN     ----------------------------------------------------------------------
KCNH2_CHICK     ----------------------------------------------------------------------
KCNT1_HUMAN     ----------------------------------------------------------------------
KCNH6_RAT       ----------------------------------------------------------------------
KCNH6_HUMAN     ----------------------------------------------------------------------
KCNH5_RAT       ----------------------------------------------------------------------
KCNH5_MOUSE     ----------------------------------------------------------------------
KCNH5_HUMAN     ----------------------------------------------------------------------
KCNH2_RABIT     ----------------------------------------------------------------------
SKOR_ARATH      ----------------------------------------------------------------------
LCTB_BACCA      ----------------------------------------------------------------------
KCNT2_RAT       ----------------------------------------------------------------------
KCNT2_HUMAN     ----------------------------------------------------------------------
KCNAW_DROME     ----------------------------------------------------------------------
KCH_ECOLI       ----------------------------------------------------------------------
MTHK_METTH      ----------------------------------------------------------------------
KCNT1_RAT       ----------------------------------------------------------------------
KCNT1_MOUSE     ----------------------------------------------------------------------
KCNT1_CHICK     ----------------------------------------------------------------------
KCNAS_DROME     ----------------------------------------------------------------------
TWK7_CAEEL      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxFTGIVISYYQIFRGIIYCLQTPRTFFSYLDSRFIPILMIVSWLF
KCO6_ARATH      --------------------------------------------------------------------LL
KCO2_ARATH      --------------------------------------------------------------------LL
KCO4_ARATH      ----------------------------------------------------------------------
MJK2_METJA      ----------------------------------------------------------------------
KCNAE_DROME     --------------------------------------------------------------MLVAHWLA
KCNH1_RAT       ------------------------------------------------------------------SWLY
KCNH1_MOUSE     ------------------------------------------------------------------SWLY
KCNH1_HUMAN     ------------------------------------------------------------------SWLY
KCNH1_BOVIN     ------------------------------------------------------------------SWLY
KCNH2_RAT       ----------------------------------------------------------------------
KCNH2_MOUSE     ----------------------------------------------------------------------
KCNH2_HUMAN     ----------------------------------------------------------------------
KCNH2_CANFA     ----------------------------------------------------------------------
KCNH7_RAT       ----------------------------------------------------------------------
KCNH7_MOUSE     ----------------------------------------------------------------------
KCNH7_HUMAN     ----------------------------------------------------------------------
KCNH2_CHICK     ----------------------------------------------------------------------
KCNT1_HUMAN     ----------------------------------------------------------------------
KCNH6_RAT       ----------------------------------------------------------------------
KCNH6_HUMAN     ----------------------------------------------------------------------
KCNH5_RAT       --------------------------------------------------------------IQIDSWLY
KCNH5_MOUSE     --------------------------------------------------------------IQIDSWLY
KCNH5_HUMAN     --------------------------------------------------------------IQIDSWLY
KCNH2_RABIT     ----------------------------------------------------------------------
SKOR_ARATH      -----------------------------------------LYCTHTAACIFYYLATTLPASQEGYTWIG
LCTB_BACCA      --------------------------FLGIVAA---VLLGSITSLWTVRVQATHLDSLWV----LVQWYL
KCNT2_RAT       ----------------------------------------------------------FNQVLILISTLL
KCNT2_HUMAN     ----------------------------------------------------------FNQVLILISTLL
KCNAW_DROME     ----------------------------------------------------------------------
KCH_ECOLI       ------------------------------------------------RKDFSHSSAAAGTIFAFISFTT
MTHK_METTH      ----------------------------------------------------------------------
KCNT1_RAT       ----------------------------------------------------------------------
KCNT1_MOUSE     ----------------------------------------------------------------------
KCNT1_CHICK     ----------------------------------------------------------------------
KCNAS_DROME     ----------------------------------------------------------------------
TWK7_CAEEL      ----------------------------------------------------------------IPAFLV


                         .         .         .         +         .         .         .:280
query           VIIFNLYTMILLVSNTNPYSFIDSTGPVTEHIRLLYFTIITFTSVGYGDITPRGNFPVFITMIISITGFL
KCO6_ARATH      VVYLSLGVLIYWLNRD--HYVVNQTHPVVDG---LYFCIVTMCTIGYGDITPNSVVTKLFSIMFVLVGFG
KCO2_ARATH      VVYLSLGVLIYWL-NRDSYN-VKQTHPVVD---ALYFCIVTMCTIGYGDITPDSVVTKLFSIFFVLVGFG
KCO4_ARATH      ------------------YSFFRDQFSGTEFVDAFYFSIVTFSTVGYGDIVPSTSTTKILTIVLVSTGVV
MJK2_METJA      ---------VLSITLILTYAYLISIIEGVDYFTALYFSVITITTTGYGDFTPKTFLGRTLTVVYLCVG-V
KCNAE_DROME     CIWYSIYSWLWKLANVSPYSYINDTGPESMYVTALYFTMTCMTSVGFGNVAAEDNEKVFTICMMIIAALL
KCNH1_RAT       QLALDIGT---------PYQFNGSGSGKWEYISSLYFTMTSLTSVGFGNIAPSTDIKIFAVAIMMIGSLL
KCNH1_MOUSE     QLALDIGT---------PYQFNGSGSGKWEYISSLYFTMTSLTSVGFGNIAPSTDIKIFAVAIMMIGSLL
KCNH1_HUMAN     QLAMDIGT---------PYQFNGSGSGKWEYISSLYFTMTSLTSVGFGNIAPSTDIKIFAVAIMMIGSLL
KCNH1_BOVIN     QLAMDIGT---------PYQFNGSGSGKWEYISSLYFTMTSLTSVGFGNIAPSTDIKIFAVAIMMIGSLL
KCNH2_RAT       -----------------PYNSSGLGGPSIKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSL
KCNH2_MOUSE     -----------------PYNSSGLGGPSIKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSL
KCNH2_HUMAN     -----------------PYNSSGLGGPSIKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSL
KCNH2_CANFA     -----------------PYNSSGLGGPSIKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSL
KCNH7_RAT       -----------------------SSGPSIKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSL
KCNH7_MOUSE     -----------------------SSGPSIKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSL
KCNH7_HUMAN     -----------------------SSGPSIKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSL
KCNH2_CHICK     -----------------------SSGPSIKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSL
KCNT1_HUMAN     VLILFCTLLCLVFTGTCGIQHLERAGENLSLLTSFYFCIVTFSTVGYGDVTPK-----------------
KCNH6_RAT       -----------------------ASGPSVQYVTALYFTFSSLTSVGFGNVSPNTNSKVFSICVMLIGSLM
KCNH6_HUMAN     -----------------------ASGPSVQYVTALYFTFSSLTSVGFGNVSPNTNSKVFSICVMLIGSLM
KCNH5_RAT       QLALSIGT---------PYRYNTSAGPSKDYVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSL
KCNH5_MOUSE     QLALSIGT---------PYRYNTSAGPSKDYVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSL
KCNH5_HUMAN     QLALSIGT---------PYRYNTSAGPSKDYVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSL
KCNH2_RABIT     -----------------PYNSSGLGGPSIKYVTGLYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSL
SKOR_ARATH      SLKLGDYS----------YSKFREIDLWTRYTTSMYFAVVTMATVGYGDIHAVNMREMIFAMVYISFDMI
LCTB_BACCA      TMLLG-FAMIYMILQVNGHAVFTPSPNSASKDRLLYLSGMTLLSVGYGDVTPIG-VGRWIAIAEALVGYI
KCNT2_RAT       CLIFTCICGI---------QHLERIGKKLNLFDSLYFCIVTFSTVGFGDVTP------------------
KCNT2_HUMAN     CLIFTCICGI---------QHLERIGKKLNLFDSLYFCIVTFSTVGFGDVTP------------------
KCNAW_DROME     ----------------------------------LWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVL
KCH_ECOLI       LLFYSTYGALYLSEGFNPR--------IESLMTAFYFSIETMSTVGYGDIVPVSESARLFTISVIISG--
MTHK_METTH      -----LLVLAVIIYGTAGFHFIEGESWTVS----LYWTFVTIATVGYGDYSPSTPLGMYFTVTLIVLGIG
KCNT1_RAT       VLILFCTLLCLVFTGTCGIQHLERAGGNLNLLTSFYFCIVTFSTVGFGDVTPK-----------------
KCNT1_MOUSE     VLILFCTLLCLVFTGTCGIQHLERAGGNLNLLTSFYFCIVTFSTVGFGDVTPK-----------------
KCNT1_CHICK     ---------------------LERAGEKLSLFKSFYFCIVTFSTVGYGDVTPK-----------------
KCNAS_DROME     -----------------------------------WWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVL
TWK7_CAEEL      LAILIVYTAFVLMSKLEPWSFFTS----------FYWSFITMTTVGFGDLMPR-----------------


                         .         *         .         .         .         .         +:350
query           YSALFIGGLLAAFTSRSK
KCO6_ARATH      FIDILLSGMVS-------
KCO2_ARATH      FMDILLSGMV--------
KCO4_ARATH      F-----------------
MJK2_METJA      GIVMYLFSLIAEFIVEGK
KCNAE_DROME     YATIF-------------
KCNH1_RAT       YATIF-------------
KCNH1_MOUSE     YATIF-------------
KCNH1_HUMAN     YATIF-------------
KCNH1_BOVIN     YATIF-------------
KCNH2_RAT       MYASIFGNVSA-------
KCNH2_MOUSE     MYASIFGNVSA-------
KCNH2_HUMAN     MYASIFGNVSA-------
KCNH2_CANFA     MYASIFGNVSA-------
KCNH7_RAT       MYASIFGNVSA-------
KCNH7_MOUSE     MYASIFGNVSA-------
KCNH7_HUMAN     MYASIFGNVSA-------
KCNH2_CHICK     MYASIFGNVSA-------
KCNT1_HUMAN     ------------------
KCNH6_RAT       YASIF-------------
KCNH6_HUMAN     YASIF-------------
KCNH5_RAT       LYATIFGNVTTIF-----
KCNH5_MOUSE     LYATIFGNVTTIF-----
KCNH5_HUMAN     LYATIFGNVTTIF-----
KCNH2_RABIT     MYASIFGNVSA-------
SKOR_ARATH      LGAYLIGNMTALIVKGSK
LCTB_BACCA      MPAVIV------------
KCNT2_RAT       ------------------
KCNT2_HUMAN     ------------------
KCNAW_DROME     TIALPVPVIVSNF-----
KCH_ECOLI       ------------------
MTHK_METTH      TFAVAVERLLEFLINREQ
KCNT1_RAT       ------------------
KCNT1_MOUSE     ------------------
KCNT1_CHICK     ------------------
KCNAS_DROME     TIALPVPVIVSNF-----
TWK7_CAEEL      ------------------