[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49715.1

[Show Plain Result]


## Summary of Sequence Search
    1::621
   40::627     3e-49  27%  662 aa  TLPA_BACSU RecName: Full=Methyl-accepting chemotaxis protein tlpA;
  112::603     2e-45  30%  662 aa  MCPB_BACSU RecName: Full=Methyl-accepting chemotaxis protein
   51::583     9e-43  31%  655 aa  MCPC_BACSU RecName: Full=Methyl-accepting chemotaxis protein mcpC;
   55::595     3e-40  31%  661 aa  MCPA_BACSU RecName: Full=Methyl-accepting chemotaxis protein
    8::627     7e-40  30%  662 aa  TLPB_BACSU RecName: Full=Methyl-accepting chemotaxis protein tlpB;
   64::494     3e-23  27%  566 aa  MCP4_THEMA RecName: Full=Methyl-accepting chemotaxis protein 4;
  145::577     9e-19  27%  656 aa  MCP1_THEMA RecName: Full=Methyl-accepting chemotaxis protein 1;
  227::473     1e-18  34%  551 aa  MCP1_ECOLI RecName: Full=Methyl-accepting chemotaxis protein I;    
  363::633     7e-18  23%  682 aa  PILJ_PSEAE RecName: Full=Protein pilJ;
  204::491     3e-16  30%  506 aa  AER_ECOLI RecName: Full=Aerotaxis receptor;
  216::471     4e-16  32%  553 aa  MCP2_SALTY RecName: Full=Methyl-accepting chemotaxis protein II;   
  213::508     2e-15  29%  573 aa  TLPC_BACSU RecName: Full=Methyl-accepting chemotaxis protein tlpC;
  229::472     4e-15  32%  547 aa  MCPC_SALTY RecName: Full=Methyl-accepting chemotaxis citrate
  228::471     1e-14  32%  553 aa  MCP2_ECOLI RecName: Full=Methyl-accepting chemotaxis protein II;   
  226::411     2e-14  34%  417 aa  BDLA_PSEAE RecName: Full=Biofilm dispersion protein bdlA;AltName:
  220::475     2e-13  31%  557 aa  MCPS_ENTAE RecName: Full=Methyl-accepting chemotaxis serine
  103::309     2e-13  24%  417 aa  FRZCD_MYXXA RecName: Full=Frizzy aggregation protein frzCD;
  173::457     5e-12  20%  545 aa  HTR5_HALSA RecName: Full=Halobacterial transducer protein
  439::685     8e-12  25%  756 aa  Y4SI_RHISN RecName: Full=Probable chemoreceptor y4sI;AltName:
  687::955     3e-11  26% 1000 aa  Y041_SYNY3 RecName: Full=Putative methyl-accepting chemotaxis
  517::712     4e-11  24%  778 aa  HTR6_HALSA RecName: Full=Halobacterial transducer protein
   57::358     7e-11  23%  433 aa  HTR2_HALVA RecName: Full=Sensory rhodopsin II transducer;AltName:
    2::506     1e-10  24%  620 aa  TCPI_VIBCH RecName: Full=Toxin coregulated pilus biosynthesis
  173::472     1e-10  24%  530 aa  MCP2_THEMA RecName: Full=Methyl-accepting chemotaxis protein 2;
    2::506     2e-10  24%  620 aa  TCPI_VIBC3 RecName: Full=Toxin coregulated pilus biosynthesis
  209::450     2e-10  26%  536 aa  HTR1_HALSA RecName: Full=Sensory rhodopsin I transducer;AltName:
  404::625     6e-10  26%  669 aa  DCRA_DESVH RecName: Full=Chemoreceptor protein A;
  536::800     7e-10  24%  845 aa  Y4FA_RHISN RecName: Full=Probable chemoreceptor y4fA;AltName:
   16::208     7e-10  23%  506 aa  KIND_BACSU RecName: Full=Sporulation kinase D;       
  212::466     1e-09  25%  512 aa  MCPD_ENTAE RecName: Full=Methyl-accepting chemotaxis aspartate
  208::469     1e-09  28%  533 aa  MCP4_ECOLI RecName: Full=Methyl-accepting chemotaxis protein IV;   
  176::285     1e-09  34%  665 aa  CYA1_RHIME RecName: Full=Adenylate cyclase 1;       
  158::455     1e-09  30%  557 aa  CPS_CLOTH RecName: Full=Putative sensory transducer protein;
  200::398     2e-09  22%  432 aa  HEMAT_BACSU RecName: Full=Heme-based aerotactic transducer hemAT;
  178::481     4e-09  23%  539 aa  MCP3_THEMA RecName: Full=Methyl-accepting chemotaxis protein 3;
  226::481     4e-08  28%  546 aa  MCP3_ECOLI RecName: Full=Methyl-accepting chemotaxis protein III;  
  135::371     5e-08  28%  634 aa  ICFG_SYNY3 RecName: Full=Protein icfG;
  255::449     2e-07  24%  533 aa  MCPE_RHIME RecName: Full=Probable chemoreceptor mcpE;
  167::446     1e-06  19%  534 aa  HTR2_NATPH RecName: Full=Sensory rhodopsin II transducer;AltName:
  502::552     2e-06  35% 1116 aa  CA2D4_MOUSE RecName: Full=Voltage-dependent calcium channel subunit
  523::573     2e-06  35% 1137 aa  CA2D4_HUMAN RecName: Full=Voltage-dependent calcium channel subunit
  194::288     5e-06  26%  583 aa  SRRB_STAAW RecName: Full=Sensor protein srrB;       
  194::288     5e-06  26%  583 aa  SRRB_STAAU RecName: Full=Sensor protein srrB;       
  194::288     5e-06  26%  583 aa  SRRB_STAAS RecName: Full=Sensor protein srrB;       
  194::288     5e-06  26%  583 aa  SRRB_STAAR RecName: Full=Sensor protein srrB;       
  194::288     5e-06  26%  583 aa  SRRB_STAAN RecName: Full=Sensor protein srrB;       
  194::288     5e-06  26%  583 aa  SRRB_STAAM RecName: Full=Sensor protein srrB;       
  194::288     5e-06  26%  583 aa  SRRB_STAAC RecName: Full=Sensor protein srrB;       
  194::288     5e-06  26%  583 aa  SRRB_STAA8 RecName: Full=Sensor protein srrB;       
  600::687     6e-06  30%  764 aa  HTR2_HALSA RecName: Full=Sensory rhodopsin II transducer;AltName:
  363::442     6e-06  26%  489 aa  HMAT_HALSA RecName: Full=Heme-based aerotactic transducer hemAT;
  572::738     1e-05  23%  810 aa  HTR4_HALSA RecName: Full=Halobacterial transducer protein
  441::542     1e-05  28% 1091 aa  CA2D3_HUMAN RecName: Full=Voltage-dependent calcium channel subunit
  441::542     2e-05  28% 1091 aa  CA2D3_MOUSE RecName: Full=Voltage-dependent calcium channel subunit
  450::536     5e-05  32% 1085 aa  CA2D3_RAT RecName: Full=Voltage-dependent calcium channel subunit
  447::531     9e-05  32% 1091 aa  CA2D1_HUMAN RecName: Full=Voltage-dependent calcium channel subunit
  525::568     1e-04  39% 1157 aa  CA2D2_RAT RecName: Full=Voltage-dependent calcium channel subunit
  525::568     1e-04  39% 1154 aa  CA2D2_MOUSE RecName: Full=Voltage-dependent calcium channel subunit
  522::565     1e-04  39% 1150 aa  CA2D2_HUMAN RecName: Full=Voltage-dependent calcium channel subunit
  484::530     2e-04  34% 1091 aa  CA2D1_RAT RecName: Full=Voltage-dependent calcium channel subunit
  449::528     2e-04  33% 1106 aa  CA2D1_RABIT RecName: Full=Voltage-dependent calcium channel subunit
 2009::2135    2e-04  21% 3106 aa  LAMA2_MOUSE RecName: Full=Laminin subunit alpha-2;AltName:
  848::936     2e-04  26% 1449 aa  CAHD1_DROME RecName: Full=VWFA and cache domain-containing protein
 1468::1603    3e-04  26% 2614 aa  TALB_DICDI RecName: Full=Talin-B;
  746::792     3e-04  41% 1288 aa  CAHD1_MOUSE RecName: Full=VWFA and cache domain-containing protein
  732::778     3e-04  41% 1274 aa  CAHD1_HUMAN RecName: Full=VWFA and cache domain-containing protein
  485::526     3e-04  36% 1103 aa  CA2D1_MOUSE RecName: Full=Voltage-dependent calcium channel subunit
  547::694     4e-04  24% 2062 aa  DHKJ_DICDI RecName: Full=Hybrid signal transduction histidine
  191::263     6e-04  23%  589 aa  RESE_BACSU RecName: Full=Sensor histidine kinase resE;       
    1::621

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxIKPSGSLKFQVSVFIAILLIVCVMAVSWLSISKMEKAINQKVKEGEMVASLIIREEIQHFLD
TLPA_BACSU      -------------------------------------AVASLDVQMTQSAKENVQILDHIIDDKISTTEK
MCPB_BACSU      ----------------------------------------------------------------------
MCPC_BACSU      -----------------------------------------LEQNIELQLKSYAISLSRLANGELTHTF-
MCPA_BACSU      -------------------------------------NVQQLNEIINTSIGEKENSADYFSEWLTKEKYN
TLPB_BACSU      --------IKQPSISKPLIAAFLAVLILP-VGVLAYFSYQSAWNALDRELISSAKGNVEELNSTLQNKLE
MCP4_THEMA      ----------------------------------------------------------------------
MCP1_THEMA      ----------------------------------------------------------------------
MCP1_ECOLI      ----------------------------------------------------------------------
PILJ_PSEAE      ----------------------------------------------------------------------
AER_ECOLI       ----------------------------------------------------------------------
MCP2_SALTY      ----------------------------------------------------------------------
TLPC_BACSU      ----------------------------------------------------------------------
MCPC_SALTY      ----------------------------------------------------------------------
MCP2_ECOLI      ----------------------------------------------------------------------
BDLA_PSEAE      ----------------------------------------------------------------------
MCPS_ENTAE      ----------------------------------------------------------------------
FRZCD_MYXXA     ----------------------------------------------------------------------
HTR5_HALSA      ----------------------------------------------------------------------
Y4SI_RHISN      ----------------------------------------------------------------------
Y041_SYNY3      ----------------------------------------------------------------------
HTR6_HALSA      ----------------------------------------------------------------------
HTR2_HALVA      ----------------------------------------------------------------------
TCPI_VIBCH      --------------IKKIISVF---LLLACIITLAFTAFFYHSK-LSDQTKSISSLSSQQAQERLQSYQD
MCP2_THEMA      ----------------------------------------------------------------------
TCPI_VIBC3      --------------IKKIISVF---LLLACIITSAFTAFFYHSK-LSDQTKSISSLSSQQAQERLQSYQD
HTR1_HALSA      ----------------------------------------------------------------------
DCRA_DESVH      ----------------------------------------------------------------------
Y4FA_RHISN      ----------------------------------------------------------------------
KIND_BACSU      -----------------RVKLYI-ILVVIPAIVISFFVYEKEKDTIAAEHKQEASVLLNLHRNKINYLIG
MCPD_ENTAE      ----------------------------------------------------------------------
MCP4_ECOLI      ----------------------------------------------------------------------
CYA1_RHIME      ----------------------------------------------------------------------
CPS_CLOTH       ----------------------------------------------------------------------
HEMAT_BACSU     ----------------------------------------------------------------------
MCP3_THEMA      ----------------------------------------------------------------------
MCP3_ECOLI      ----------------------------------------------------------------------
ICFG_SYNY3      ----------------------------------------------------------------------
MCPE_RHIME      ----------------------------------------------------------------------
HTR2_NATPH      ----------------------------------------------------------------------
CA2D4_MOUSE     ----------------------------------------------------------------------
CA2D4_HUMAN     ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
HTR2_HALSA      ----------------------------------------------------------------------
HMAT_HALSA      ----------------------------------------------------------------------
HTR4_HALSA      ----------------------------------------------------------------------
CA2D3_HUMAN     ----------------------------------------------------------------------
CA2D3_MOUSE     ----------------------------------------------------------------------
CA2D3_RAT       ----------------------------------------------------------------------
CA2D1_HUMAN     ----------------------------------------------------------------------
CA2D2_RAT       ----------------------------------------------------------------------
CA2D2_MOUSE     ----------------------------------------------------------------------
CA2D2_HUMAN     ----------------------------------------------------------------------
CA2D1_RAT       ----------------------------------------------------------------------
CA2D1_RABIT     ----------------------------------------------------------------------
LAMA2_MOUSE     ----------------------------------------------------------------------
CAHD1_DROME     ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
CAHD1_MOUSE     ----------------------------------------------------------------------
CAHD1_HUMAN     ----------------------------------------------------------------------
CA2D1_MOUSE     ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SKGEIVKNLSLAQEFQSQDKKQILKLLLSAQNQSEFQNIYFVTGSGEITIAPVKQLPKDFDPRQRVWYQE
TLPA_BACSU      SLAYF-SDWATAEKFQDKKKTELKQEFKQFIQMNDNVAAVFSSGKGDFTRYPYADMPSDFNALERDWYKE
MCPB_BACSU      --------------------------------------IYGGADNGTYVQAPKEKLPEGYDPRQRPWYQD
MCPC_BACSU      ----VTKPSKEASRLFHDDIKQI------KDNDDYVAMAYIGTAKKEMFTYPKADFAEDYDPTSRPWYKL
MCPA_BACSU      AKS----NASIAEKFS-----QYISI------NKDVESIYTSDTKGHFTRYPDLPMPSGYNPVERDWYKK
TLPB_BACSU      DK---VKAIDYYSETVDKDNKTLLKEKFKQYTNDDVGAIYAASEDKKLYKYPDSGVPKGFDPTGRDWYKQ
MCP4_THEMA      ----------------------------------------------------------------------
MCP1_THEMA      ----------------------------------------------------------------------
MCP1_ECOLI      ----------------------------------------------------------------------
PILJ_PSEAE      ----------------------------------------------------------------------
AER_ECOLI       ----------------------------------------------------------------------
MCP2_SALTY      ----------------------------------------------------------------------
TLPC_BACSU      ----------------------------------------------------------------------
MCPC_SALTY      ----------------------------------------------------------------------
MCP2_ECOLI      ----------------------------------------------------------------------
BDLA_PSEAE      ----------------------------------------------------------------------
MCPS_ENTAE      ----------------------------------------------------------------------
FRZCD_MYXXA     ----------------------------------------------------------------------
HTR5_HALSA      ----------------------------------------------------------------------
Y4SI_RHISN      ----------------------------------------------------------------------
Y041_SYNY3      ----------------------------------------------------------------------
HTR6_HALSA      ----------------------------------------------------------------------
HTR2_HALVA      ----------------------------------------------------------------------
TCPI_VIBCH      SLDFYKKSVAIANSLRDKAVEELNAIALRIQENHGFIGVTFASLDGTM-FTDIGTLDWNAKTLRRDWFVK
MCP2_THEMA      ----------------------------------------------------------------------
TCPI_VIBC3      SKLNISLSVAIANSLRDKAVEELNAIALRIQENHGFIGVTFASLDGTM-FTDIGTLDWNAKTLRRDWFVK
HTR1_HALSA      ----------------------------------------------------------------------
DCRA_DESVH      ----------------------------------------------------------------------
Y4FA_RHISN      ----------------------------------------------------------------------
KIND_BACSU      ETMARMTSLSIAIDRPVDIKKMQSILEKTFDSEPRFSGLYFLNAKGDVT-ASTTELKTKVNLADRSFFIK
MCPD_ENTAE      ----------------------------------------------------------------------
MCP4_ECOLI      ----------------------------------------------------------------------
CYA1_RHIME      -----------------------------------FDRILFLDASG-LQFAERHAASNGFDPRTRPWYRA
CPS_CLOTH       ----------------------------------------------------------------------
HEMAT_BACSU     ----------------------------------------------------------------------
MCP3_THEMA      ----------------------------------------------------------------------
MCP3_ECOLI      ----------------------------------------------------------------------
ICFG_SYNY3      ------------------------------------------------------------------WFEE
MCPE_RHIME      ----------------------------------------------------------------------
HTR2_NATPH      ----------------------------------------------------------------------
CA2D4_MOUSE     ----------------------------------------------------------------------
CA2D4_HUMAN     ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
HTR2_HALSA      ----------------------------------------------------------------------
HMAT_HALSA      ----------------------------------------------------------------------
HTR4_HALSA      ----------------------------------------------------------------------
CA2D3_HUMAN     --------------------------------------------------------PKVIDQEHDVVWTE
CA2D3_MOUSE     --------------------------------------------------------PKVIDQEHDVVWTE
CA2D3_RAT       ----------------------------------------------------------------------
CA2D1_HUMAN     ----------------------------------------------------------------------
CA2D2_RAT       ----------------------------------------------------------------------
CA2D2_MOUSE     ----------------------------------------------------------------------
CA2D2_HUMAN     ----------------------------------------------------------------------
CA2D1_RAT       ----------------------------------------------------------------------
CA2D1_RABIT     ----------------------------------------------------------------------
LAMA2_MOUSE     ----------------------------------------------------------------------
CAHD1_DROME     ---------------------------------------YIASVSGVLQLYPGCLLSSSYDPTRRPWFRQ
TALB_DICDI      ----------------------------------------------------------------------
CAHD1_MOUSE     ---------------------------------------YIATPNGVLRIYPGSLMDKAFDPTRRQWYLH
CAHD1_HUMAN     ---------------------------------------YIATPNGVLRIYPGSLMDKAFDPTRRQWYLH
CA2D1_MOUSE     ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AVKKGTMVCTDPYIDQATGKPCMTVALAVKDSEGRFVGVLGADIKLETISSLAVKYKFGEEGYFYVCDKQ
TLPA_BACSU      AMNKGKTIVTEPYESISSGKMVVTIARQTVDGSG----VVAIDMKIDDLVTTAKGINIGKEGYAFILSQN
MCPB_BACSU      AMKAGEIVVTDPYVAASDGSMVITIAQELKDGSG----VVAMDITIDKLLEQMKQIKVGKEGYAFIATKN
MCPC_BACSU      AAETDQVVWTEPYKDVVTGDMIVTASKAILDRQ-KVIGVASYDLKLSAIQSMVNKQKVPYKGFAFLADAS
MCPA_BACSU      AVNKGKVVITDPYKTASTNTMVVTIAQQTKDGSG----VIAINMTIENLLKTTKKVNIGTQGYAFIMTKD
TLPB_BACSU      AVEKGQAVFSEPYTDEATGDIVVTISKQLKDGS----GVIALDLNLDEVLTASKRIKIGKEGFAFITTGN
MCP4_THEMA      -------------------------------------GELTREQAQELAKSLIGKIRYDDNNYFWINDTH
MCP1_THEMA      ------------------GTPVLTVVVPIETMNTR-TGIVGFGINLSENSDLVEEGKASKSGYGLLVTSD
MCP1_ECOLI      ----------------------------------------------------------------------
PILJ_PSEAE      ----------------------------------------------------------------------
AER_ECOLI       ----------------------------------------------------------------------
MCP2_SALTY      ----------------------------------------------------------------------
TLPC_BACSU      ----------------------------------------------------------------------
MCPC_SALTY      ----------------------------------------------------------------------
MCP2_ECOLI      ----------------------------------------------------------------------
BDLA_PSEAE      ----------------------------------------------------------------------
MCPS_ENTAE      ----------------------------------------------------------------------
FRZCD_MYXXA     ----------------------------------------------------------------------
HTR5_HALSA      ----------------------------------------------------------------------
Y4SI_RHISN      ----------------------------------------------------------------------
Y041_SYNY3      ----------------------------------------------------------------------
HTR6_HALSA      ----------------------------------------------------------------------
HTR2_HALVA      ----------------------------------------------------------------------
TCPI_VIBCH      TVELGTKHYTAFDIDKTTGQHVLTIATPVYVGND-IVGSVALDIAGDQIASP------NGSGMFMMTDRN
MCP2_THEMA      ----------------------------------------------------------------------
TCPI_VIBC3      TVELGTKHYTAFDIDKTTGQHVLTIATPVYVGND-IVGSVALDIAGDQIASP------NGSGMFMMTDRN
HTR1_HALSA      ----------------------------------------------------------------------
DCRA_DESVH      ----------------------------------------------------------------------
Y4FA_RHISN      ----------------------------------------------------------------------
KIND_BACSU      AKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLI--NLLSPDVYIEVVNQD
MCPD_ENTAE      ----------------------------------------------------------------------
MCP4_ECOLI      ----------------------------------------------------------------------
CYA1_RHIME      AVNGKAPVAIGPYEMATTGNLGMTISQA---HRGNPQIVIGADVVLDTITDFLSRERLTDDSVSFVLDAV
CPS_CLOTH       ----------------------------------------------------------------------
HEMAT_BACSU     ----------------------------------------------------------------------
MCP3_THEMA      ----------------------------------------------------------------------
MCP3_ECOLI      ----------------------------------------------------------------------
ICFG_SYNY3      VKDKNRHLNRFPGKTYAESKDCLIVPIHSKNDQTQ-IGIVVECIPLPVIADFVQKIKDAELERILLVNYE
MCPE_RHIME      ----------------------------------------------------------------------
HTR2_NATPH      ----------------------------------------------------------------------
CA2D4_MOUSE     -------------------------------SHGILLGVVGSDVTLRELMKLAPRYKLGVHGYAFLNTNN
CA2D4_HUMAN     -------------------------------SHGILLGVVGSDVALRELMKLAPRYKLGVHGYAFLNTNN
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
HTR2_HALSA      ----------------------------------------------------------------------
HMAT_HALSA      ----------------------------------------------------------------------
HTR4_HALSA      ----------------------------------------------------------------------
CA2D3_HUMAN     AYIDSTLPQAQKLTDDQGPVLMTTVAMPVFSSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNN
CA2D3_MOUSE     AYIDSTLPQAQKLADDQGLVLMTTVAMPVFSSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNN
CA2D3_RAT       ------VVWTEAYIDSTLADDMTTVAMPVFSSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNN
CA2D1_HUMAN     ---------TNVYLDALELGLVITGTLPVFNITGQFLGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPN
CA2D2_RAT       ------------------------------------LGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLN
CA2D2_MOUSE     ------------------------------------LGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLN
CA2D2_HUMAN     ------------------------------------LGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLN
CA2D1_RAT       ------------------------------------LGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPN
CA2D1_RABIT     ---------TNVYLDALELGLVITGTLPVFNITGQFLGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPN
LAMA2_MOUSE     ----------------------------------------------------------------------
CAHD1_DROME     AIQPGKIVSTAPYLDAGGAGYIITIAHTIFEGKAHALHSAQQDRPVAVV-ALDVPYAF------------
TALB_DICDI      ----------------------------------------------------------------------
CAHD1_MOUSE     AVNPGLISLTGPYLD-------------------------------------------------------
CAHD1_HUMAN     AVNPGLISLTGPYLD-------------------------------------------------------
CA2D1_MOUSE     ------------------------------------LGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPN
DHKJ_DICDI      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GKVIGHPDAKAINGDIMNRAYVKAALAGKSGFDTYADNGVKKLVYYSEIPKTGWGLFVQQPEQEAYAELY
TLPA_BACSU      KKVIAYSGEKALKGDWVDKLY-----KDKSGDFEYTYKGKKKKMAFATSQTTGWKISGTMYANEIHDAAS
MCPB_BACSU      KTYVAHKNHKA--GEKLSGDWVAKMYANDSGELQYTLNNEDKKMTYTTNELTGWKIAGTMYMDEIKDASK
MCPC_BACSU      GNLLAHPSNQGKN--ISKDQTLQTIASEKKGIQDV--NG--KMVVYQTIGETGWKVGTQF-DTDQLMWIS
MCPA_BACSU      KKVVAHPNEQS--GTELKGDWLDKMLSADKGDFQYTMDGDKKKMAFDTNKLTGWKIGGTMYLDEIHEAAQ
TLPB_BACSU      KKYIAHPTIKTGSGDWTNQVYSK-----KEGSFEYTFEGKEKKMAFTTNKLTGWKIFVSELQDASSPVLN
MCP4_THEMA      PRMVFHPIKPEMNGDLSNNEMVKVAKEKGEGFVSYSDKPEPKISYVKLFEPWGWGIYVDDVKVTVGNLIF
MCP1_THEMA      GKVLIHKDMGNFMKDVKELGFEKAFEEAKSGGEKYVENGEKKYTVWEKVPGYDFYIFSTGYLEELLAEGR
MCP1_ECOLI      ----------------------------------------------------------------------
PILJ_PSEAE      ----------------------------------------------------------------------
AER_ECOLI       ----------------------------------------------------------------------
MCP2_SALTY      ----------------------------------------------------------------------
TLPC_BACSU      ----------------------------------------------------------------------
MCPC_SALTY      ----------------------------------------------------------------------
MCP2_ECOLI      ----------------------------------------------------------------------
BDLA_PSEAE      ----------------------------------------------------------------------
MCPS_ENTAE      ----------------------------------------------------------------------
FRZCD_MYXXA     ----------------------------------------------------------------------
HTR5_HALSA      ----------------------------------------------------------------------
Y4SI_RHISN      ----------------------------------------------------------------------
Y041_SYNY3      ----------------------------------------------------------------------
HTR6_HALSA      ----------------------------------------------------------------------
HTR2_HALVA      ----------------------------------------------------------------------
TCPI_VIBCH      FNVFASTHSTLIGKDLKEKPLFKNLVSGQ--YVTFSDDSHWFAVSQTEIDGEN-KLFTIIDIQQIVQTYK
MCP2_THEMA      ----------------------------------------------------------------------
TCPI_VIBC3      FNVFASTHSTLIGKDLKEKPLFKNLVSGQ--YVTFSDDSHWFAVSQTEIDGEN-KLFTIIDIQQIVQTYK
HTR1_HALSA      ----------------------------------------------------------------------
DCRA_DESVH      ----------------------------------------------------------------------
Y4FA_RHISN      ----------------------------------------------------------------------
KIND_BACSU      GKMI------------------------------------------------------------------
MCPD_ENTAE      ----------------------------------------------------------------------
MCP4_ECOLI      ----------------------------------------------------------------------
CYA1_RHIME      GRPIIHSDS-------------------------------------------------------------
CPS_CLOTH       ----------------------------------------------------------------------
HEMAT_BACSU     ----------------------------------------------------------------------
MCP3_THEMA      ----------------------------------------------------------------------
MCP3_ECOLI      ----------------------------------------------------------------------
ICFG_SYNY3      GYIYADTDFKNY-GVLENKKLVNRLLNDQSGF-VYSQG---KFSYLSPVHLRGWGLIVENSESDIQAAIL
MCPE_RHIME      ----------------------------------------------------------------------
HTR2_NATPH      ----------------------------------------------------------------------
CA2D4_MOUSE     GYILSHPDLRPL----------------------------------------------------------
CA2D4_HUMAN     GYILSHPDLRPL----------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
HTR2_HALSA      ----------------------------------------------------------------------
HMAT_HALSA      ----------------------------------------------------------------------
HTR4_HALSA      ----------------------------------------------------------------------
CA2D3_HUMAN     GYILTHPELRLL----------------------------------------------------------
CA2D3_MOUSE     GYILTHPELRPL----------------------------------------------------------
CA2D3_RAT       GYILTHPELRPL----------------------------------------------------------
CA2D1_HUMAN     GYVLLHPNLQPKN---------------------------------------------------------
CA2D2_RAT       GYVLLHPNLK------------------------------------------------------------
CA2D2_MOUSE     GYVLLHPNLK------------------------------------------------------------
CA2D2_HUMAN     GYVLLHPNLK------------------------------------------------------------
CA2D1_RAT       GYVLLHPNLQPKN---------------------------------------------------------
CA2D1_RABIT     GYVLLHPN--------------------------------------------------------------
LAMA2_MOUSE     ----------------------------------------------------------------------
CAHD1_DROME     ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
CAHD1_MOUSE     ----------------------------------------------------------------------
CAHD1_HUMAN     ----------------------------------------------------------------------
CA2D1_MOUSE     GYVLLHPN--------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RARNMXXXXXXXXXXXXXXXXXYFTGKMVNVIKMVGEGARAIAQGNLTYSLTIARKDELGILSDSINEMT
TLPA_BACSU      RVLIMASIVLAIAIGAGMTAIYFVIRSITKPLRRIVASAEKISEGDLTETIEINSKDELGVLSESFNHMA
MCPB_BACSU      SVLTTGMIVLIASIVAGGILILFIVRSITKPLKRLVQSSKTISRGDLTETIEIHSKDELGELGESFNEMG
MCPC_BACSU      DKMNRANXXXXXXXXXXXXXXSYFLAKTITPIQQLIVKTKAVSAGDLTVRAESKSKDEVGILTRDFNLMV
MCPA_BACSU      PXXXXXXXXXXXXXXXXXXXXXXXXRSITTPLKQLVGSSKRISEGDLTETIDIRSKDELGELGKSFNNMA
TLPB_BACSU      TAXXXXXXXXXXXXXXXXXXXRAITKPL---RKLVSTSAK-ISSGDLTEVIDIHSKNEFGQLGESFNEMS
MCP4_THEMA      R-----NVLTVSVIGIAVIIMIFFYGRVLSKTKAVLSALEKISSGDLSVSVDIKSKDEFGLIAQKLNETV
MCP1_THEMA      KATLGTIVTYVVFGGVIFAVLFVSMMPVVKRMRQQVEKVKRFGEGDLTVEFEAKGRDELTQIEESLKEAA
MCP1_ECOLI      ------------------------------------DSIRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQ
PILJ_PSEAE      -----------------------------------------LADGDLTVAATVT-EDFTGAIADSINYSI
AER_ECOLI       -----------------------FEWQIVRPIENVAHQALKVATGERNSVEHLNRSDELGLTLRAVGQLG
MCP2_SALTY      ---------------------------LLNPLARVITHIREIASGDLTKTLTVSGRNEIGELAGTVEHMQ
TLPC_BACSU      --------------------------KRLNALKSAFESA---GNGDMTIEVSDKTGDELSELSVYYNKMR
MCPC_SALTY      ---------------------------------------QTIADGDLTHEIEAEGRSEMGQLAAGLKTMQ
MCP2_ECOLI      ---------------------------------------REIAGGNLANTLTIDGRSEMGDLAQSVSHMQ
BDLA_PSEAE      ----------------------------------------------------------------------
MCPS_ENTAE      ---------------------------LVRPLNRMIEHIKRIASGDLTQPIPVTSRNEIGVLAASLKHMQ
FRZCD_MYXXA     -----------------------------------------VREGDLSRWNTTTEDPQLGPLLEGFGKVI
HTR5_HALSA      ----------------------------------VGATLEAASDGDLTARVDATTDNEIAEVATVVNDML
Y4SI_RHISN      ------------------------------VMAQIGGGLAALSDGVFSRPITVDFPEEYRPLKSDFNRAL
Y041_SYNY3      -----------------------------------------VSRGDLTIRAHVT-EDEIGTIADSYNATI
HTR6_HALSA      ----------------------------------------------------------------------
HTR2_HALVA      ------------------------TGHLELKAQQYSDALDAAANGDLTARVTDSMNDAMAEVGEDINTTL
TCPI_VIBCH      RDIQLIIAGFSGFSCVMLIGLYWVLSKELSGVRQIREWILALSDGQIKERRPIKFHNELDTIAQSLENLQ
MCP2_THEMA      --------------------------RSLRLLKPVMEASRSLRNNDLTINIQEAKKDEISTLLNSIEYLR
TCPI_VIBC3      RDIQLIIAGFSGFSCVMLIGLYWVLSKELSGVRQIREWILSLSDGQIKERRPIKFHNELDTIAQSLENLQ
HTR1_HALSA      --------------------------------------------------------DEIEAKTERMSETS
DCRA_DESVH      ----------------------------------------------------------------------
Y4FA_RHISN      -------------------------------VDALADGLDAMAKGRLTSTIETPFAPALDKLRTDFNAAV
KIND_BACSU      ----------------------------------------------------------------------
MCPD_ENTAE      ---------------------------LVQPLNIIRGHFERIASGDLSAPIEVYGRNEISQLFASLQRMQ
MCP4_ECOLI      ----------------------WWTRKMVQPLAIIGSHFDSIAAGNLARPIAVYGRNEITAIFASLKTMQ
CYA1_RHIME      ----------------------------------------------------------------------
CPS_CLOTH       ------------------------------------EAADRLALGDVEVDVKAETRDEIGKLAESFKRMI
HEMAT_BACSU     ----------------------------------------------------------------------
MCP3_THEMA      ----------------------FTTRNLTTPLKKLAVLVENLSHGVLNVEIEIRSKDEIGKAAMAVEKLR
MCP3_ECOLI      ---------------------------VIRPLQHAAQRIEKIASGDLTMNDEPAGRNEIGRLSRHLQQMQ
ICFG_SYNY3      NVNRIGYLLVLVIGGIVAYASWMVIHHSTVPILDLTKASQAIAAGDLDYEININRQDEIGILGNSFIYMK
MCPE_RHIME      ----------------------------------------------------------------------
HTR2_NATPH      -----------------------------------GEVMDRCADGDFTQRLDAETDNEMQSIEGSFNEMM
CA2D4_MOUSE     ----------------------------------------------------------------------
CA2D4_HUMAN     ----------------------------------------------------------------------
SRRB_STAAW      ----------------------FLSSRITKPLRRLRDQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMS
SRRB_STAAU      ----------------------FLSSRITKPLRRLRDQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMS
SRRB_STAAS      ----------------------FLSSRITKPLRRLRDQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMS
SRRB_STAAR      ----------------------FLSSRITKPLRRLRDQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMS
SRRB_STAAN      ----------------------FLSSRITKPLRRLRDQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMS
SRRB_STAAM      ----------------------FLSSRITKPLRRLRDQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMS
SRRB_STAAC      ----------------------FLSSRITKPLRRLRDQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMS
SRRB_STAA8      ----------------------FLSSRITKPLRRLRDQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMS
HTR2_HALSA      ----------------------------------------------------------------------
HMAT_HALSA      ----------------------------------------------------------------------
HTR4_HALSA      ----------------------------------------------------------------------
CA2D3_HUMAN     ----------------------------------------------------------------------
CA2D3_MOUSE     ----------------------------------------------------------------------
CA2D3_RAT       ----------------------------------------------------------------------
CA2D1_HUMAN     ----------------------------------------------------------------------
CA2D2_RAT       ----------------------------------------------------------------------
CA2D2_MOUSE     ----------------------------------------------------------------------
CA2D2_HUMAN     ----------------------------------------------------------------------
CA2D1_RAT       ----------------------------------------------------------------------
CA2D1_RABIT     ----------------------------------------------------------------------
LAMA2_MOUSE     ----------------------------------------------------------LGALNDTMDKLT
CAHD1_DROME     ----------------------------------------------------------------------
TALB_DICDI      ------------------------TSKLVNIAKSVASG-----QSQADVSQLAATKKEVSELISKLLNAT
CAHD1_MOUSE     ----------------------------------------------------------------------
CAHD1_HUMAN     ----------------------------------------------------------------------
CA2D1_MOUSE     ----------------------------------------------------------------------
DHKJ_DICDI      -------------------------------VRSIAEVTTAVAKGDLSKNITIDAQGEILQLKNTINTMV
RESE_BACSU      ----------------------FLSSRVTYPLRKMREGAQDLAKGKFDTKIPILTQDEIGELATAFNQMG


                         .         .         .         .         *         .         .:420
query           NHLKTIIGGVKDSTNRVTGACNSMAVSMEQIHEASDKNASDISNVAATTEQITASAENINEMVGSVSLSA
TLPA_BACSU      HSLRSLIHGIKDSVEHVASSSEELTASADQIEQFSNGSESQSEKIETTTEQINEMNDGLAELARAAAVIT
MCPB_BACSU      QSLRSLISAIQDSVNNVAASSEQLTASAGQIEQFSNGNEEQSEKVESSSHQLNLMNEGLQQVITKASIQA
MCPC_BACSU      ENMKEMVEQVRLSSGKVSDTSEQLTAVAAETNETSGQIAKAIEEVAAGASEQASEVETINEKSESLSTKI
MCPA_BACSU      SSLRSLIHAIQDSVDNVXXATEHITLAIEQFSNGNEKQNENIETAAEHIYQMNDGLTNMSEVITDSSVQA
TLPB_BACSU      ASLRSVIGVIQTSVENVXXXXXXXXXXXXXXXKATEHITLAIEQFSAQSEKLETSSNHLSQMNEGISKAA
MCP4_THEMA      GNLRKMVQEIQDEVERVSALSQQLRSALEEIARASDTISKEVQNASASIEEVTANSQNISKLIQEISENA
MCP1_THEMA      LSLKEMIVSIIEAAKELSGASEEIKVLSEESHKMSENMSSALTEVTSGVEEVAASAQNISERSEAVTKAA
MCP1_ECOLI      GELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATAENARQLALSASETA
PILJ_PSEAE      DQLRELVETINXXXXXXXXXXXXXXXXXMHLAEASEHQAQEIAGASAAINEMAVSIDQXXXXXXXXXXXA
AER_ECOLI       LMCRWLINDVSSQVSSVRNGSETLAKGTDELNEXXXXXXXXMNQMAASVKQNSATASAADKLSITASNAA
MCP2_SALTY      RSLIDTVTQVREGSDAIYSGTSEIAAGNTDLSSRTEQQASALEETAASMEQLTATADNARXXXXXXXXTA
TLPC_BACSU      MKLNDTIQTVXXGAEETNQASEKITEAVQQIANGAQDQITRIENSESSLKQASADIRDISANTAAIASKA
MCPC_SALTY      QSLIRTVSAVRDNADSIYTGAGEISAGSSDLSSRTEQQASALEETAASMEQLTATVDNARQATGTASETA
MCP2_ECOLI      RSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADXXXXXXXXX
BDLA_PSEAE      ------------------------------------KFASDVSDRMRRYQAEADNAHQAHTLSTETRTVA
MCPS_ENTAE      NELIETVSGVRQGADRSIDGASESAAGNNDLSSRXXXXXXXXXXXXXSMEQLTATAENARXXXXXXXXTA
FRZCD_MYXXA     ETLRTFVREINEAALRLSSSANQVLAASTQHETSSTEQAAAIHETTATMEELKHASAQIAENAGSVARVA
HTR5_HALSA      TTMERTIDEIQGFSTNVTTASREATAGAKEIQDASQTVSESVQEIAAGTDDQREQLESVAEEMDSYSATV
Y4SI_RHISN      GQLRETIRTVAAQAASMSSIVSEISCATDVLAKRTEHQAIVLDGAVNTMDAISNAANNADALVRDAHSAA
Y041_SYNY3      ESLRRIVTQVQTAASQFTETTDTNEXXXXXXXXXXXXXXXD---VAEALERLQAMNKSIXXXXXXATQTV
HTR6_HALSA      --------------------------------------ASETDEMSATIEEVAASADQVAETSQRXXXXX
HTR2_HALVA      DALEDTIADMKAFATNVIQSSDRVNSNAERVDRASKQVSKSINEIEGTTEQNSAAAEMQNLXXXXXXXXG
TCPI_VIBCH      FRLLDVVRNSHRTMNDLSIKQTDITYSIEGNTNNSQQELGLIEQVATATTQLSCTSFDVMQQAQSAELNA
MCP2_THEMA      NNLKDVTFSVAESIEEISKANEEITNQLLGISKEMDNISTRIESISASVQETTAGSEEISSATKNIXXXA
TCPI_VIBC3      FRLLDVVRNSHRTMNDLSIKQTDITYSIEGNTNNSQQELGLIEQVATATTQLSCTSFDVMQQAQSAELNA
HTR1_HALSA      ADIEASAGDTVEAVSKIESQANDQRTEL-------DSAADDVQQVSASAEEIAATIDDLASRSEXXXXXX
DCRA_DESVH      -------------------AAEALVTRMGELERDATEAASETTQVATAMEEVARNASSTAEMADLANGEA
Y4FA_RHISN      AGLRQTLLDIRTTSSVIQGSGRQMAEGAKALSGRTEQQAASLEETAASVDEIVATAANADNTVSKAKQDA
KIND_BACSU      ----------------------------------------------------------------------
MCPD_ENTAE      QSLIGTVGAVRDGAESILIGLQEIAEGNNDLSSRTEQQDRSLEETAASMEQLTATVKQNADNARQASQLA
MCP4_ECOLI      QALRGTVSDVRKGSQEIVAGNNDLSSRTEXXXXXXXXXXXXMEQLTATVGQNADNARQASELAKNAATTA
CYA1_RHIME      ----------------------------------------------------------------------
CPS_CLOTH       ENIREIAAGMVDTNNEVLSNINEXXXSSMQLSQGATEQASSIEELTASLEQVAKNANQANELAEVAKNNA
HEMAT_BACSU     ----------------------------QKIQETSGSIANLFSETSRSVQELVDKSEGISQAAGTVTSST
MCP3_THEMA      EILLDIITGINKXXXXXXXXXNSISEALVSLNKEADENSATLEEFTASIEELSSTADSNSKSAQAMLEST
MCP3_ECOLI      HSLGMTVGTVRQGAEEIYRGTSEISAGNADLSSRXXXXXXXXXXXXXSMEQLTATAHHASKLAQEASIKA
ICFG_SYNY3      NQIKTLIAEVKDGVNRL-----------------------------------------------------
MCPE_RHIME      -----IVSDLRGSAAEFSGNAGAEAKAIDQ----------HLVSLGTVTERIRTGSIRIGETEAQASIAV
HTR2_NATPH      DGIEALVGRIERFADAVSEDAEAVRANAESVMEASEQNISDMDDVSATTEEVAASADDIAKXXXXXXXXX
CA2D4_MOUSE     ----------------------------------------------------------------------
CA2D4_HUMAN     ----------------------------------------------------------------------
SRRB_STAAW      TEIEEHVDALSTSKNIRDSLINSMVEGVLGINESSNKMANDI----------------------------
SRRB_STAAU      TEIEEHVDALSTSKNIRDSLINSMVEGVLGINESSNKMANDI----------------------------
SRRB_STAAS      TEIEEHVDALSTSKNIRDSLINSMVEGVLGINESSNKMANDI----------------------------
SRRB_STAAR      TEIEEHVDALSTSKNIRDSLINSMVEGVLGINESSNKMANDI----------------------------
SRRB_STAAN      TEIEEHVDALSTSKNIRDSLINSMVEGVLGINESSNKMANDI----------------------------
SRRB_STAAM      TEIEEHVDALSTSKNIRDSLINSMVEGVLGINESSNKMANDI----------------------------
SRRB_STAAC      TEIEEHVDALSTSKNIRDSLINSMVEGVLGINESSNKMANDI----------------------------
SRRB_STAA8      TEIEEHVDALSTSKNIRDSLINSMVEGVLGINESSNKMANDI----------------------------
HTR2_HALSA      ----------------------------------------------------------------------
HMAT_HALSA      ----------------------------------------------------------------------
HTR4_HALSA      ------------------------------------------------TAEIARDGEQTAEDAIERSLTV
CA2D3_HUMAN     ----------------------------------------------------------------------
CA2D3_MOUSE     ----------------------------------------------------------------------
CA2D3_RAT       ----------------------------------------------------------------------
CA2D1_HUMAN     ----------------------------------------------------------------------
CA2D2_RAT       ----------------------------------------------------------------------
CA2D2_MOUSE     ----------------------------------------------------------------------
CA2D2_HUMAN     ----------------------------------------------------------------------
CA2D1_RAT       ----------------------------------------------------------------------
CA2D1_RABIT     ----------------------------------------------------------------------
LAMA2_MOUSE     NDTAAKLQAVKEKAREANDTAKAVLAQVKDLHQNLDQNYNKLADSVAKTNAVVKDPSK-NKIIADAGTSV
CAHD1_DROME     ----------------------------------------------------------------------
TALB_DICDI      N------GHDQDATT-ISIDLDSLSKSEQALLDASRSTANYMSQFMAIGKTISTGTKDPN-VHQQFSGAA
CAHD1_MOUSE     ----------------------------------------------------------------------
CAHD1_HUMAN     ----------------------------------------------------------------------
CA2D1_MOUSE     ----------------------------------------------------------------------
DHKJ_DICDI      DQLKSFSSGILGGQAEVTGVDGVWKGLTDNVNTMAANLTGQVRSIAEVT---TAVAK--GDLSKNITIDA
RESE_BACSU      RQLNFHINALNQEKEQLSNILSSMA---------------------------------------------


                         .         .         +         .         .         .         .:490
query           QHGQEEIGEVIGAMEGIKSSTNEISRAISEVENQSKKXXXXXXXXXXXXXXXNXXXXXXXXXXXXXGEHG
TLPA_BACSU      EKGETLVQKTAGQMNTIDHSVKAAEQVVKGLEIKSKDITNILRVINGIADQTNXXXXXXXXXXXXXGEYG
MCPB_BACSU      GTGEKFVQQTVGQMNSINQSVQQAEAVVKGLEGKSKDITSILRVINGIADQTNXXXXXXXXXXXXXGESG
MCPC_BACSU      RQIAEEAG---GIKERSKSSTKKVETMLLDLENQTKNIEEVVTAISNISDQTNLLALNASIEAARAGESG
MCPA_BACSU      SEGGKLVHQTVGQMNVIDKSVKEAEQVVRGLETKSKDITNILRVINGIADQTNXXXXXXXXXXXXXGEYG
TLPB_BACSU      GSGEKLVEHTVGQMKTIDQSVQKAEAVVKGLETKSQDITSILNVINGIADQTNXXXXXXXXXXXXXGEYG
MCP4_THEMA      RNGQRVLEEAVKKVEDVSENSRETADVVSNVTESARNIEEIVRTIQSIAEQTXXXXXXXXXXXXXXXXXX
MCP1_THEMA      REGTERVEAVGGVINKLKGSAERQRDYLRELVDSAKTIGEIVDTISSIAEQTXXXXXXXXXXXXXXXXXX
MCP1_ECOLI      QRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQT--------------NIXXXXXXXXXXXXXXXX
PILJ_PSEAE      NKGNEVVHNTITGMDNIREQIQDTSKRIKRLGESSQEIGDIVSLINDIADQTNILALNAAIQASMAGDAG
AER_ECOLI       VQGGEAMTTVIKTMDDIADSTQRIGTITSLINDIAFQT--------------NILXXXXXXXXXXXGEQG
MCP2_SALTY      RHGGKVVDGVVNTMHEIADSSKKIADIISVIDGIAFQT--------------NIXXXXXXXXXXXXXXXX
TLPC_BACSU      DIGQKEIANVQAQMDAIHQSIQKSGEIIHQLDGRSKQIEQILSVITQIADQTNXXXXXXXXXXXXXGEQG
MCPC_SALTY      RKGGRVVDNVVSTMNDIAESSEKIVDITSVIDGIAFQT--------------NIXXXXXXXXXXXXXXXX
MCP2_ECOLI      XHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQT--------------NIXXXXXXXXXXXXXXXX
BDLA_PSEAE      EHGALIIQSAVEEMLKIANTLDASSLNIGELSQHSQQITSIVNTIREIAEQTNXXXXXXXXXXXXXGDQG
MCPS_ENTAE      QKGGKVVANVVETMHDIASSSQKIADITGVID--------------VIAFQTNIXXXXXXXXXXXXXXXX
FRZCD_MYXXA     EEXXXXXXEFIQAMQQIRSDGVAVADSIAKLSKRVERIGTVVEVIDEIADRSDLLALNAALEGSRAGEAG
HTR5_HALSA      EEGKQTAEDAIDAIDAVQETMQTTVANVDALEDLTTEIDDIAELISDIAEQTNMLALNANIEAARAXXXX
Y4SI_RHISN      AASDEIVSSAIAGMLEIEESSAKIATIVSVIEEIAHQT--------------NLLALNAGVEASRAGEAG
Y041_SYNY3      DQGEDAMNRTVDGIVAIRETVAATAKQVKRLGESSQKISKVVNLIGSFADQTNXXXXXXXXXXXXXXXXX
HTR6_HALSA      XXXXXXXXXXXXXXEEIEDETQAAATAVDDLEAKMSEIETIVAAITDIAEQTNMLALNANIEAARADQDG
HTR2_HALVA      EDGRXXXXXXXXXXXXXXXXTGETVEEINALDDELDEIGEIVGVITSIVEQTNMLALNASIEAAHADGDG
TCPI_VIBCH      ETAQKLIAEIIDSTEMVTLSIHESQQIINQLREFSDNISSVTDVINNISDQTXXXXXXXXXXXXXXXXXX
MCP2_THEMA      KEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAEQTXXXXXXXXXXXXXXXXXX
TCPI_VIBC3      ETAQKLIAEIIDSTEMVTLSIHESQQIINQLREFSDNISSVTDVINNISDQTXXXXXXXXXXXXXXXXXX
HTR1_HALSA      XXXXXXXXXXXXEMSSIETEVDDAVGQVEQLRDQVAEXXXXXXXXXXXGEQTNMLALNASIEXXXXXXXX
DCRA_DESVH      QSGGTEMANTVRETRQVAQRTEDLAESLHELARRADNIGRVIEVINEIADQTNXXXXXXXXXXXXXXXXX
Y4FA_RHISN      DRSTVVVGNATAAMGRIEAASSHIGHIIEVIDDIAFQI--------------NLLALNXXXXXXXXXXXX
KIND_BACSU      ----------------------------------------------------------------------
MCPD_ENTAE      RDASSTAAK--------RTLADDVVTTMHDIANSSQKIGAITSVIDGIAFQTNIXXXXXXXXXXXXXXXX
MCP4_ECOLI      QAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQT--------------NIXXXXXXXXXXXXXXXX
CYA1_RHIME      ----------------------------------------------------------------------
CPS_CLOTH       EQGNKQMAEMLNAMEXXXXXXXXXXKVIDEIAFQT-----------------NILXXXXXXXXXXXGQHG
HEMAT_BACSU     VEGKKELEVQQKQMNKIDTSLVQIEKEMVKLDEIAQQIEKIFGIVTGIAEQTNLLSLNASIESARAGEHG
MCP3_THEMA      QRVHEQVEKSTERIREITESTREMSQALNRLLSMAENINSIVDTINSIAEQTXXXXXXXXXXXXXXXXXX
MCP3_ECOLI      SDGGQTVSGVVGAXXXXXXXXXXXXAVINSIAFQT-----------------NIXXXXXXXXXXXXXXXX
ICFG_SYNY3      ----------------------------------------------------------------------
MCPE_RHIME      ERSGEIAGQAISAMADIEASAEKIGQIIGVIDEIAFQT--------------NLLALNAGIEAARAGESG
HTR2_NATPH      XXXXXXXXXXXXXMNEVESRTEQAVASMEELNEDVREIGEVSEMIADIAEQTNILALNASIEAARADGNS
CA2D4_MOUSE     ----------------------------------------------------------------------
CA2D4_HUMAN     ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
HTR2_HALSA      ------------------------------------------------------------------GADG
HMAT_HALSA      ----------------------------------------------------------------------
HTR4_HALSA      QEAIDATVQNVEALDDQMAEISEIVDLISDIAEQT-----------------NMLALNANIEAARADKSG
CA2D3_HUMAN     ----------------------------------------------------------------------
CA2D3_MOUSE     ----------------------------------------------------------------------
CA2D3_RAT       ----------------------------------------------------------------------
CA2D1_HUMAN     ----------------------------------------------------------------------
CA2D2_RAT       ----------------------------------------------------------------------
CA2D2_MOUSE     ----------------------------------------------------------------------
CA2D2_HUMAN     ----------------------------------------------------------------------
CA2D1_RAT       ----------------------------------------------------------------------
CA2D1_RABIT     ----------------------------------------------------------------------
LAMA2_MOUSE     RNLEQEADRLIDKLKPIKELEDNLKKNISEIKNQARK---------------------------------
CAHD1_DROME     ----------------------------------------------------------------------
TALB_DICDI      QNVSSGVQQLLSAINGMKPEQKDLDESIEIIQN-------------------------------------
CAHD1_MOUSE     ----------------------------------------------------------------------
CAHD1_HUMAN     ----------------------------------------------------------------------
CA2D1_MOUSE     ----------------------------------------------------------------------
DHKJ_DICDI      QGEILQLKNTINTMQQLKSFSSEVTRVSREV---------------------------------------
RESE_BACSU      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           KGFTVVADEVRKLAEQTSAATREIHGVIENVYASVRDSVDKMLTGNEMVEMGSQRVQEAGEVFKTITINI
TLPA_BACSU      RGFSVVAEEVRKLAVQSADSAKEIESLISEIVKEIHTSLNVLQSVNKEVETGLVMTDETKQSFKHISQMT
MCPB_BACSU      RGFSVVAEEVRKLAVQSADSAKEIEKLIQEIVAEIDTSLHMFKEVNQEVQSGLVVTDNTKESFQSIFSMT
MCPC_BACSU      RGFAVVADEVRKLAEQSALSTKHISETVKLIQLETKEASHAMVEASRMNDEQNSAIHETGEVLNTITAEM
MCPA_BACSU      RGFSVVAEEVRKLAVQSADSAKEIEGLIIEIVKEINTSLGMFQSVNQEVQTGLDITDKTEMSFKRIS---
TLPB_BACSU      RGFSVVAEEVRKLAVQSADSAKEIEGLIQEIVREISTSLSMFQSVNHEVKEGLQITDQTAESFKQIYEMT
MCP4_THEMA      XXXXXXXDEIRKLAEESQKATEEISQILENIREGVERTNEMSKKNVEITKDARRLVEESYESFNQIVTRI
MCP1_THEMA      XXXXXXXDEIRKLAEESQRATED----IAKMLSSLRTTIEHVENGSKEMFEGVDEIAVMGEEFREILGRI
MCP1_ECOLI      XXXXVVAGEVRNLAQRSAQAAREIKSLIE-------DSVGK-------VDVGSTLVESAGETMAEIVSAV
PILJ_PSEAE      RGFAVVADEVQRLAERSSAATKQIEALVKTIQTDTNEAVISMEQTTSEVVRGARLAQDAGEEIEKVSKTL
AER_ECOLI       KGFAVVAGEVRHLASRSANAANDIRKLID-------ASADK-------VQSGSQQVHAAGRTMEDIVAQV
MCP2_SALTY      XXXXVVAGEVRNLASRSAQAAKEIKALIE-------DSVSRVDTGSVLVE-------SAGETMTDIVNAV
TLPC_BACSU      KGFAVVADEVRKLAEESQQSAGQISKLIIEIQKDMNRSARSVEHVKTEAAEGVTMIQRTRDAFKEIAAAT
MCPC_SALTY      XXXXVVAGEVRTLASRSAQAAKEIKVLIEN-------SVSR-------IDTGSTQVREAGETMKEIVNAV
MCP2_ECOLI      XXXXVVAGEVRNLASRSAQAAKEIKALIE-------DSVSRVDTGSVLVE-------SAGETMNNIVNAV
BDLA_PSEAE      RGFAVVADEVRQLAERTSKSTKEIADMIGRIQTGTRSVIDDMQHSQEQARRGVELANEAGAAILGIREST
MCPS_ENTAE      XXXXVVAGEVRNLAQRSAQAAKEIKALIE-------DSVNR-------VDMGSVLVESAGDTMGDIVNAV
FRZCD_MYXXA     KGFSIVAAEMRRLAENVLDSTKEIKNLITEI---------------------------------------
HTR5_HALSA      XXFAVVADEVKELATESQRSAKDIAELIEEVQSQTATTVEEIRVAEQRVNDGAAAVEETVDAFGAVTENI
Y4SI_RHISN      KGFAVVASEVRALAQRSSDAAKEIKDLIN--------------VSTQRVERGKELVDSASELLKHIAARV
Y041_SYNY3      XXXXVVADEVRSLARQSAEATAEIAQLVATIQAETNEVVNAMEAGTEQVVVGTKLVEETRRSLNQITAVS
HTR6_HALSA      DGFAVVADEVKDLADESKASAAEIEALVAEVRAQTETSVAAMDRIQERVSDGVETVSETERSLSEIAGRI
HTR2_HALVA      EGFAVVADEIKGLAEETKEAAADIEGRIEAIQEQAGDTVETMESTSTRITEGVSTVEETVDALETIVEYT
TCPI_VIBCH      XXXXVVADEVRSLAVKTQQSTIDIQGII------------------------------------------
MCP2_THEMA      XXXXXXXDEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVSSEITARVEEGTKLADEADEKLNSIVGAV
TCPI_VIBC3      XXXXVVADEVRSLAVKTQQSTIDIQGII------------------------------------------
HTR1_HALSA      XXFSVVADEVKDLAEETQDRANEIAAVVEKVTAQTEDVTASIQQTRTRVESGSETVESTLRDIRTIADSI
DCRA_DESVH      XXXXXXXXEVRKLAEKTMVATREVEQAIAAIQQGSNDAVEVMTETRQQVEVTAGKAEDTGKVLSGIVGRA
Y4FA_RHISN      XXXXVVAQEVRELAQRSAGAAREIAALIGNSTAEVAKGAGLVSTGAALLDI-SKHILEISTQIEAIALSS
KIND_BACSU      ----------------------------------------------------------------------
MCPD_ENTAE      XXXXVVAGEVRNLASRSAQAAKEIKLLID-------ESVSR-------VKHGSVLVENSGATMQDIVRSV
MCP4_ECOLI      XXXXVVAGEVRNLASRSAQAAKEIKGLIE-------ESVNR-------VQQGSKLVNNAAATMIDIVSSV
CYA1_RHIME      ----------------------------------------------------------------------
CPS_CLOTH       KGFAVVAEEVRNLAARSANAAKETTELIEGTIKRTENGTKIARETAEALNKIVEGISKAATLVNDIAVAS
HEMAT_BACSU     KGFAVVANEVRKLSEDTKKTVSTVSELVNNTNTQINIVSKHIKDVNELVSESKEKMTQINRLFDEIVHSM
MCP3_THEMA      XXXXXXXDEIRKLAEESKAATQQIGEILGKLRDEINNSSKIVESTASAIEETASLVESIKDVFESIRIAM
MCP3_ECOLI      XXXXVVASEVRTLASRSAQAAKEIEGLISE---SVR-----------LIDLGSDEVATAGKTMSTIVDAV
ICFG_SYNY3      ----------------------------------------------------------------------
MCPE_RHIME      RGFAVVAQEVRALAQRSGEAAREIKQLVTGTKGQVVAGVEIVGRTQHAISSIAEQVVSINEAVTGIAREA
HTR2_NATPH      EGFAVVADEVXXXXXXXXXXXXXIDDLIGXXXXXXXXXXXXIRETSDQVSEGVETVEDTVDALERIVDSV
CA2D4_MOUSE     ----------------------------------------------------------------------
CA2D4_HUMAN     ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
HTR2_HALSA      DGFAVVADEVKTLAEESRDAAEDIESRLLALQGQVSDVADEMRATSDTVSDGRATVGDAATALDDVVSFV
HMAT_HALSA      ----------KALAEESREQSTRVEELVEQMQAETEETVDQLDEVNQRIGEGVERVEEAMETLQEITDAV
HTR4_HALSA      DGFAVVADEVKDLAEETQESAGDIERRITEVQSQXXXXXXXXXXXXXSMDAGIDAVEEVVDAFTAVSDHA
CA2D3_HUMAN     ----------------------------------------------------------------------
CA2D3_MOUSE     ----------------------------------------------------------------------
CA2D3_RAT       ----------------------------------------------------------------------
CA2D1_HUMAN     ----------------------------------------------------------------------
CA2D2_RAT       ----------------------------------------------------------------------
CA2D2_MOUSE     ----------------------------------------------------------------------
CA2D2_HUMAN     ----------------------------------------------------------------------
CA2D1_RAT       ----------------------------------------------------------------------
CA2D1_RABIT     ----------------------------------------------------------------------
LAMA2_MOUSE     ----------------------------------------------------------------------
CAHD1_DROME     ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
CAHD1_MOUSE     ----------------------------------------------------------------------
CAHD1_HUMAN     ----------------------------------------------------------------------
CA2D1_MOUSE     ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EELVEKMAQITRATITMSASIQNVXXXXXXXXXXXXXXNKMVEDLRQSAIVxxxxxxxxxx
TLPA_BACSU      NQIASELQNMNATVEELSAGAQEISAASNDITAISKESSDGIQDIAASA------------
MCPB_BACSU      NEIAGKLQTMNSTVEQLSDRSQHV-------------------------------------
MCPC_BACSU      QSLVQGIDHI---------------------------------------------------
MCPA_BACSU      ----EMTNQIAGELQNMSATVQQL-------------------------------------
TLPB_BACSU      TQISGELQNLNATVEQLSAGSQEVSSAVEDISAVAKESSAGIQDIAASA------------
MCP4_THEMA      EDLAARIEGI---------------------------------------------------
MCP1_THEMA      EEI----------------------------------------------------------
MCP1_ECOLI      TRVTDIMGEIASASDEQSRGIDQV-------------------------------------
PILJ_PSEAE      AALIQNISNAARQQASSAGHISN--------------------------------------
AER_ECOLI       KNVTQLIAQISHSTLEQADGLSSLTRAVDELNLITQKNAELVEESAQSAMV----------
MCP2_SALTY      TRVTDIMGEIASASDEQSRGIDQV-------------------------------------
TLPC_BACSU      GEISAEISDLSASVTNISASAHQI-------------------------------------
MCPC_SALTY      TRVTDIMGEIASASDEQSKGIEQV-------------------------------------
MCP2_ECOLI      TRVTDIMGEIASASDEQSRGIDQV-------------------------------------
BDLA_PSEAE      HKVVEAVQQFSR-------------------------------------------------
MCPS_ENTAE      TRVTDIMGEIASASDEQSRGIDQV-------------------------------------
FRZCD_MYXXA     -------------------------------------------------------------
HTR5_HALSA      QETTDGVQEISQA------------------------------------------------
Y4SI_RHISN      -DLIRTTVSNIAATATSQA------------------------------------------
Y041_SYNY3      AQISGLVEAITSAAIEQSQTSESV-------------------------------------
HTR6_HALSA      AEADTGVQEISNAMDDQAASVSDV-------------------------------------
HTR2_HALVA      EEVDTGIQEIDRATEEQARTAQDV-------------------------------------
TCPI_VIBCH      -------------------------------------------------------------
MCP2_THEMA      ERINEMLQNIAAAIEEQTAAVDEI-------------------------------------
TCPI_VIBC3      -------------------------------------------------------------
HTR1_HALSA      AEVSNSIDEIQRTTSEQAETVQS--------------------------------------
DCRA_DESVH      ESIADMVRNIATASEQQSSTSDEI-------------------------------------
Y4FA_RHISN      REQASSIAEVNVAITRLDQLTQS--------------------------------------
KIND_BACSU      -------------------------------------------------------------
MCPD_ENTAE      TRVTDIMGEIASASDEQSRGIEQV-------------------------------------
MCP4_ECOLI      TRVNDIMGEIASASEEQQRGIEQV-------------------------------------
CYA1_RHIME      -------------------------------------------------------------
CPS_CLOTH       NEQAAAITQINQGIAQVSQVVQ---------------------------------------
HEMAT_BACSU     KISKEQSGKI---------------------------------------------------
MCP3_THEMA      EDVQSRVESVAASTQEQSASLEEL-------------------------------------
MCP3_ECOLI      ASVTHIMQEIAAASDEQSRGITQV-------------------------------------
ICFG_SYNY3      -------------------------------------------------------------
MCPE_RHIME      ECQVNDLASAT--------------------------------------------------
HTR2_NATPH      ERTNDGIQEINQS------------------------------------------------
CA2D4_MOUSE     -------------------------------------------------------------
CA2D4_HUMAN     -------------------------------------------------------------
SRRB_STAAW      -------------------------------------------------------------
SRRB_STAAU      -------------------------------------------------------------
SRRB_STAAS      -------------------------------------------------------------
SRRB_STAAR      -------------------------------------------------------------
SRRB_STAAN      -------------------------------------------------------------
SRRB_STAAM      -------------------------------------------------------------
SRRB_STAAC      -------------------------------------------------------------
SRRB_STAA8      -------------------------------------------------------------
HTR2_HALSA      ADTDTAAGEIRAAT-----------------------------------------------
HMAT_HALSA      EDAASGMQEVSTATDEQAVS-----------------------------------------
HTR4_HALSA      DETDTGVQEISDTTDDQAASTE---------------------------------------
CA2D3_HUMAN     -------------------------------------------------------------
CA2D3_MOUSE     -------------------------------------------------------------
CA2D3_RAT       -------------------------------------------------------------
CA2D1_HUMAN     -------------------------------------------------------------
CA2D2_RAT       -------------------------------------------------------------
CA2D2_MOUSE     -------------------------------------------------------------
CA2D2_HUMAN     -------------------------------------------------------------
CA2D1_RAT       -------------------------------------------------------------
CA2D1_RABIT     -------------------------------------------------------------
LAMA2_MOUSE     -------------------------------------------------------------
CAHD1_DROME     -------------------------------------------------------------
TALB_DICDI      -------------------------------------------------------------
CAHD1_MOUSE     -------------------------------------------------------------
CAHD1_HUMAN     -------------------------------------------------------------
CA2D1_MOUSE     -------------------------------------------------------------
DHKJ_DICDI      -------------------------------------------------------------
RESE_BACSU      -------------------------------------------------------------