[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49729.1

[Show Plain Result]


## Summary of Sequence Search
    1::328
 1428::1568    2e-04  26% 1820 aa  KI20B_HUMAN RecName: Full=Kinesin-like protein KIF20B;AltName:
  388::633     7e-04  24%  691 aa  NDC80_YEAST RecName: Full=Kinetochore protein NDC80;AltName:
    1::328

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKQDFISALVATYSLPDK
KI20B_HUMAN     ----------------------------------------------------------------------
NDC80_YEAST     -----------------------------------------------------KEEEIKALQSNISELHK


                         .         .         *         .         .         .         .:140
query           PIIKRILGANPFEASLLSEAMQLCKNYDYAIRLYKSFKLYNLLGSNRYGYEYTPDYVNRDVLQFLRDMLR
KI20B_HUMAN     ----------------------------------------------------------------------
NDC80_YEAST     ILRKKGISTEQFELQN-QEREKLTRELD-KINI-QSDKLTSSIKSRKLEAE--------GIFKSLLDTLR


                         +         .         .         .         .         *         .:210
query           VYGESGIVHMMENAKEINLKDCIRLYQQLKDENQRAIKTEKVRIRDLHDWMSYRHKLQNHENLKFNVPNH
KI20B_HUMAN     ------------NKEHENNTDVLGKLTNLQDELQ---ESEQKYNADRKKWLEEKMMLITQAKEAENIRNK
NDC80_YEAST     QY-DSSIQNLTRSRSQLG--------HNVNDSSLKINISENLLDRDFHEGISYEQLFPKGSGINESIKKS


                         .         .         .         +         .         .         .:280
query           IIRRLSMQNEKLKFFLPKESMELLKAGVELHNCVASYSRAMQDNSKWVVLVANDKGKLVACLEVQGRRLI
KI20B_HUMAN     EMKKYAEDRER--FFKQQNEMEIL---------TAQLTEKDSDLQKW----REERDQLVAALEIQLKALI
NDC80_YEAST     ILKLNDEIQERIK-TIEKDNITLEK---DIKNLKHDINEKTQINEKLELELSEANSKFELSKQENERLLV


                         .         *         .         .         .         .         +:350
query           QAKIDKNKPVSSDNKLNAEVISWAKEANLEIKTNDLKVxxxxxxxxxx
KI20B_HUMAN     SSNVQKDNEIEQLKRIISET------SKIETQIMDIK-----------
NDC80_YEAST     AQRIEMEKKINDSNLLMKTKISDAEETSTELKLEELKV----------