[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49782.1

[Show Plain Result]


## Summary of Sequence Search
    1::154
  132::204     6e-04  31%  335 aa  T12BB_XENLA RecName: Full=Transmembrane protein 120B-B;
    1::154

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLYLISSL
T12BB_XENLA     ---------------------------------------------------------------LYLTIIL


                         .         .         *         .         .         .         .:140
query           ALGMVTLRFYPREHREQLIYIAVLAALFLMAEIILMKTGNFIHLKGWHLGKSYILNILGFIIITWxxxxx
T12BB_XENLA     LLGAITCRFVLHYRVTDEVFNFLLVWYFCIRESILISNGS--RIKGWWVSHHYVSTFLSGVMLTW-----


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxx
T12BB_XENLA     --------------