[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49801.1

[Show Plain Result]


## Summary of Sequence Search
    1::916
  462::842     6e-53  36%  858 aa  LUXQ_VIBPA RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  463::843     6e-51  35%  859 aa  LUXQ_VIBHA RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  464::842     2e-47  35%  857 aa  LUXQ_VIBVY RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  464::842     2e-47  35%  857 aa  LUXQ_VIBVU RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  122::519     5e-47  32%  677 aa  RPFC_XANC8 RecName: Full=Sensory/regulatory protein rpfC;       
  122::518     7e-47  32%  677 aa  RPFC_XANCP RecName: Full=Sensory/regulatory protein rpfC;       
  788::1202    2e-43  33% 1213 aa  DHKK_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  276::640     3e-42  36%  778 aa  ARCB_SHIFL RecName: Full=Aerobic respiration control sensor protein
  276::640     3e-42  36%  778 aa  ARCB_ECOLI RecName: Full=Aerobic respiration control sensor protein
  276::640     3e-42  36%  778 aa  ARCB_ECO57 RecName: Full=Aerobic respiration control sensor protein
  483::833     3e-41  33%  857 aa  LUXQ_VIBCH RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  265::781     2e-37  39%  918 aa  BARA_SHIFL RecName: Full=Signal transduction histidine-protein
  265::781     2e-37  39%  918 aa  BARA_ECOLI RecName: Full=Signal transduction histidine-protein
  265::781     2e-37  39%  918 aa  BARA_ECOL6 RecName: Full=Signal transduction histidine-protein
  265::781     2e-37  39%  918 aa  BARA_ECO57 RecName: Full=Signal transduction histidine-protein
  252::776     3e-36  38%  907 aa  GACS_PSESY RecName: Full=Sensor protein gacS;         EC=2.7.13.3;
  502::1051    6e-35  37% 1065 aa  TCSB_EMENI RecName: Full=Two-component system protein B;       
  716::1087    1e-34  34% 1238 aa  BVGS_BORPE RecName: Full=Virulence sensor protein bvgS;       
  716::1087    4e-34  34% 1238 aa  BVGS_BORPA RecName: Full=Virulence sensor protein bvgS;       
  716::1087    5e-34  34% 1238 aa  BVGS_BORBR RecName: Full=Virulence sensor protein bvgS;       
  277::679     9e-33  29%  682 aa  TCSA_EMENI RecName: Full=Two-component system protein A;       
 1040::1633    3e-32  37% 1671 aa  DOKA_DICDI RecName: Full=Hybrid signal transduction protein dokA;
  314::736     1e-31  27%  741 aa  ETR2_PELHO RecName: Full=Ethylene receptor 2;       
  359::742     3e-31  30%  754 aa  ETR1_SOLLC RecName: Full=Ethylene receptor 1;         Short=LeETR1;
 1740::1990    4e-31  31% 2310 aa  MAK2_SCHPO RecName: Full=Peroxide stress-activated histidine kinase
  343::726     4e-31  31%  736 aa  ETR2_SOLLC RecName: Full=Ethylene receptor 2;         Short=LeETR2;
  314::735     7e-31  29%  740 aa  ETR1_CUCSA RecName: Full=Ethylene receptor 1;       
  943::1963    7e-31  39% 1969 aa  DHKB_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  345::733     9e-31  29%  738 aa  ETR1_PRUPE RecName: Full=Ethylene receptor;         EC=2.7.13.3;
  345::735     9e-31  30%  740 aa  ETR1_CUCMR RecName: Full=Ethylene receptor 1;       
 1388::2145    9e-31  33% 2150 aa  DHKA_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  189::680     2e-30  33% 1546 aa  DHKD_DICDI RecName: Full=Hybrid signal transduction histidine
  345::734     3e-30  30%  738 aa  ETR1_PASED RecName: Full=Ethylene receptor;       
  345::736     3e-30  28%  741 aa  ETR1_MALDO RecName: Full=Ethylene receptor;         EC=2.7.13.3;
 1320::1644    6e-30  31% 2062 aa  DHKJ_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  835::1676    1e-29  39% 1709 aa  DHKL_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  314::736     4e-29  27%  740 aa  ETR1_PELHO RecName: Full=Ethylene receptor 1;       
  343::726     5e-29  29%  738 aa  ETR1_TOBAC RecName: Full=Ethylene receptor;       
  473::942     1e-28  38%  949 aa  RCSC_ECOLI RecName: Full=Sensor kinase protein rcsC;       
  473::942     2e-28  38%  948 aa  RCSC_SALTY RecName: Full=Sensor protein rcsC;       
  473::942     5e-28  38%  948 aa  RCSC_SALTI RecName: Full=Sensor protein rcsC;       
  291::1048    7e-28  31% 1109 aa  DHKF_DICDI RecName: Full=Hybrid signal transduction histidine
  240::464     3e-27  35%  525 aa  Y1002_RHIME RecName: Full=Uncharacterized sensor-like histidine
  976::1215    5e-25  31% 1639 aa  MAK1_SCHPO RecName: Full=Peroxide stress-activated histidine kinase
  564::827     8e-24  30%  842 aa  PLEC_CAUCR RecName: Full=Non-motile and phage-resistance protein;  
  314::583     1e-23  30%  613 aa  ERS1_ARATH RecName: Full=Ethylene response sensor 1;       
  447::803     1e-23  29%  914 aa  TORS_ECOLI RecName: Full=Sensor protein torS;         EC=2.7.13.3;
  686::1066    4e-23  27% 1197 aa  EVGS_ECOLI RecName: Full=Sensor protein evgS;       
  134::368     5e-23  31%  384 aa  SENX3_MYCS2 RecName: Full=Signal-transduction histidine kinase
  447::803     7e-23  29%  914 aa  TORS_ECO57 RecName: Full=Sensor protein torS;         EC=2.7.13.3;
  345::725     9e-23  26%  738 aa  ETR1_ARATH RecName: Full=Ethylene receptor 1;         Short=AtETR1;
  376::594     1e-22  28%  595 aa  KINB_PSEAE RecName: Full=Alginate biosynthesis sensor protein kinB;
  314::730     1e-22  25%  735 aa  ETR1_BRAOL RecName: Full=Ethylene receptor 1;         EC=2.7.13.3;
  420::655     2e-22  34%  663 aa  DSPA_SYNY3 RecName: Full=Drug sensory protein A;       
  401::1199    2e-22  30% 1225 aa  DHKC_DICDI RecName: Full=Hybrid signal transduction histidine
  329::550     8e-21  34%  597 aa  DIVJ_CAUCR RecName: Full=Histidine protein kinase divJ;       
  349::569     2e-20  38%  579 aa  PHOR_BACSU RecName: Full=Alkaline phosphatase synthesis sensor
   85::349     9e-20  29%  351 aa  SAES_STAAE RecName: Full=Histidine protein kinase saeS;       
   85::349     9e-20  29%  351 aa  SAES_STAAC RecName: Full=Histidine protein kinase saeS;       
   85::349     9e-20  29%  351 aa  SAES_STAA8 RecName: Full=Histidine protein kinase saeS;       
   85::349     9e-20  29%  351 aa  SAES_STAA3 RecName: Full=Histidine protein kinase saeS;       
   87::320     2e-19  29%  325 aa  ARCB_HAEIN RecName: Full=Aerobic respiration control sensor protein
  125::372     3e-19  28%  377 aa  SASA_SYNJA RecName: Full=Adaptive-response sensory-kinase sasA;    
   85::351     3e-19  30%  351 aa  SAES_STAAR RecName: Full=Histidine protein kinase saeS;       
  794::1048    3e-19  30% 1055 aa  PDHS_OCHA4 RecName: Full=Cell-division control histidine kinase pdhS;
  541::755     3e-19  34%  769 aa  DIVL_CAUCR RecName: Full=Sensor protein divL;         EC=2.7.13.3;
  358::580     4e-19  37%  583 aa  SRRB_STAAR RecName: Full=Sensor protein srrB;       
  120::381     6e-19  28%  382 aa  SASA_CYAA5 RecName: Full=Adaptive-response sensory-kinase sasA;    
  774::1028    6e-19  30% 1035 aa  PDHS_BRUSU RecName: Full=Cell-division control histidine kinase pdhS;
  774::1028    6e-19  30% 1035 aa  PDHS_BRUSI RecName: Full=Cell-division control histidine kinase pdhS;
  774::1028    6e-19  30% 1035 aa  PDHS_BRUO2 RecName: Full=Cell-division control histidine kinase pdhS;
  774::1028    6e-19  30% 1035 aa  PDHS_BRUC2 RecName: Full=Cell-division control histidine kinase pdhS;
  358::580     8e-19  35%  583 aa  SRRB_STAAN RecName: Full=Sensor protein srrB;       
  358::580     8e-19  35%  583 aa  SRRB_STAAM RecName: Full=Sensor protein srrB;       
   85::349     8e-19  30%  351 aa  SAES_STAAW RecName: Full=Histidine protein kinase saeS;       
   85::349     8e-19  30%  351 aa  SAES_STAAS RecName: Full=Histidine protein kinase saeS;       
   85::349     8e-19  30%  351 aa  SAES_STAAN RecName: Full=Histidine protein kinase saeS;       
   85::349     8e-19  30%  351 aa  SAES_STAAM RecName: Full=Histidine protein kinase saeS;       
   85::349     8e-19  30%  351 aa  SAES_STAAB RecName: Full=Histidine protein kinase saeS;       
  774::1028    8e-19  30% 1035 aa  PDHS_BRUME RecName: Full=Cell-division control histidine kinase pdhS;
  774::1028    8e-19  30% 1035 aa  PDHS_BRUAB RecName: Full=Cell-division control histidine kinase pdhS;
  774::1028    8e-19  30% 1035 aa  PDHS_BRUA2 RecName: Full=Cell-division control histidine kinase pdhS;
  774::1028    8e-19  30% 1035 aa  PDHS_BRUA1 RecName: Full=Cell-division control histidine kinase pdhS;
  358::580     1e-18  35%  583 aa  SRRB_STAAW RecName: Full=Sensor protein srrB;       
  358::580     1e-18  35%  583 aa  SRRB_STAAU RecName: Full=Sensor protein srrB;       
  358::580     1e-18  35%  583 aa  SRRB_STAAS RecName: Full=Sensor protein srrB;       
  358::580     1e-18  35%  583 aa  SRRB_STAAC RecName: Full=Sensor protein srrB;       
  358::580     1e-18  35%  583 aa  SRRB_STAA8 RecName: Full=Sensor protein srrB;       
  113::379     4e-18  30%  380 aa  SASA_THEEB RecName: Full=Adaptive-response sensory-kinase sasA;    
  204::422     4e-18  31%  431 aa  PHOR_ECOLI RecName: Full=Phosphate regulon sensor protein phoR;    
  378::596     5e-18  33%  608 aa  WALK_STAHJ RecName: Full=Sensor protein kinase walK;       
  379::602     6e-18  31%  608 aa  WALK_STAAR RecName: Full=Sensor protein kinase walK;       
  379::602     8e-18  31%  608 aa  WALK_STAAW RecName: Full=Sensor protein kinase walK;       
  186::409     8e-18  31%  415 aa  WALK_STAAU RecName: Full=Sensor protein kinase walK;       
  379::602     8e-18  31%  608 aa  WALK_STAAT RecName: Full=Sensor protein kinase walK;       
  379::602     8e-18  31%  608 aa  WALK_STAAS RecName: Full=Sensor protein kinase walK;       
  379::602     8e-18  31%  608 aa  WALK_STAAN RecName: Full=Sensor protein kinase walK;       
  379::602     8e-18  31%  608 aa  WALK_STAAM RecName: Full=Sensor protein kinase walK;       
  379::602     8e-18  31%  608 aa  WALK_STAAE RecName: Full=Sensor protein kinase walK;       
  379::602     8e-18  31%  608 aa  WALK_STAAC RecName: Full=Sensor protein kinase walK;       
  379::602     8e-18  31%  608 aa  WALK_STAAB RecName: Full=Sensor protein kinase walK;       
  379::602     8e-18  31%  608 aa  WALK_STAA9 RecName: Full=Sensor protein kinase walK;       
  379::602     8e-18  31%  608 aa  WALK_STAA8 RecName: Full=Sensor protein kinase walK;       
  379::602     8e-18  31%  608 aa  WALK_STAA3 RecName: Full=Sensor protein kinase walK;       
  379::602     8e-18  31%  608 aa  WALK_STAA2 RecName: Full=Sensor protein kinase walK;       
  379::602     8e-18  31%  608 aa  WALK_STAA1 RecName: Full=Sensor protein kinase walK;       
  371::643     1e-17  29%  653 aa  YCF26_PORYE RecName: Full=Uncharacterized sensor-like histidine
  375::605     1e-17  31%  611 aa  YYCG_BACSU RecName: Full=Sensor histidine kinase yycG;       
  158::406     1e-17  27%  410 aa  SENX3_MYCTU RecName: Full=Sensor-like histidine kinase senX3;      
  158::406     1e-17  27%  410 aa  SENX3_MYCBO RecName: Full=Sensor-like histidine kinase senX3;      
  183::414     2e-17  32%  419 aa  WALK_STASR RecName: Full=Sensor protein kinase walK;       
  204::422     2e-17  31%  431 aa  PHOR_SHIDY RecName: Full=Phosphate regulon sensor protein phoR;    
   60::263     3e-17  31%  610 aa  WALK_STAS1 RecName: Full=Sensor protein kinase walK;       
  204::422     3e-17  30%  431 aa  PHOR_KLEPN RecName: Full=Phosphate regulon sensor protein phoR;    
  125::372     5e-17  26%  377 aa  SASA_SYNJB RecName: Full=Adaptive-response sensory-kinase sasA;    
  213::434     9e-17  30%  444 aa  CIAH_STRR6 RecName: Full=Sensor protein ciaH;         EC=2.7.13.3;
  213::434     9e-17  30%  444 aa  CIAH_STRPN RecName: Full=Sensor protein ciaH;         EC=2.7.13.3;
    3::124     1e-16  39%  222 aa  YCF29_PORYE RecName: Full=Probable transcriptional regulator ycf29;
  219::458     2e-16  28%  467 aa  BAES_ECOLI RecName: Full=Signal transduction histidine-protein
   20::144     2e-16  42%  251 aa  Y851_SYNP2 RecName: Full=Probable transcriptional regulatory
  212::375     2e-16  30%  381 aa  SASA_PROMA RecName: Full=Adaptive-response sensory-kinase sasA;    
   94::348     3e-16  26%  352 aa  SAES_STAES RecName: Full=Histidine protein kinase saeS;       
   94::348     3e-16  26%  352 aa  SAES_STAEQ RecName: Full=Histidine protein kinase saeS;       
  582::835     3e-16  29%  849 aa  LUXN_VIBHB RecName: Full=Autoinducer 1 sensor kinase/phosphatase
  582::835     3e-16  29%  849 aa  LUXN_VIBHA RecName: Full=Autoinducer 1 sensor kinase/phosphatase
    2::121     3e-16  38%  131 aa  YSO1_PLEBO RecName: Full=Uncharacterized 14.6 kDa protein in sodA1
   33::264     3e-16  27%  610 aa  WALK_STAES RecName: Full=Sensor protein kinase walK;       
   33::264     3e-16  27%  610 aa  WALK_STAEQ RecName: Full=Sensor protein kinase walK;       
  145::377     3e-16  28%  443 aa  SEX3_MYCLE RecName: Full=Sensor-like histidine kinase senX3;       
  281::516     5e-16  25%  565 aa  MTRB_MYCPA RecName: Full=Sensor histidine kinase mtrB;       
  697::1066    5e-16  30% 1197 aa  EVGS_ECO57 RecName: Full=Sensor protein evgS;       
  120::364     6e-16  27%  370 aa  SASA_PROM3 RecName: Full=Adaptive-response sensory-kinase sasA;    
  515::745     6e-16  28%  765 aa  PHYA_ANASP RecName: Full=Cyanobacterial phytochrome A;       
  528::679     6e-16  33% 1736 aa  DHKI_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  120::364     8e-16  26%  370 aa  SASA_PROMM RecName: Full=Adaptive-response sensory-kinase sasA;    
    3::119     8e-16  37%  121 aa  PILH_PSEAE RecName: Full=Protein pilH;
  281::516     8e-16  25%  562 aa  MTRB_MYCLE RecName: Full=Sensor histidine kinase mtrB;       
  227::381     1e-15  33%  387 aa  SASA_SYNE7 RecName: Full=Adaptive-response sensory-kinase sasA;    
  365::587     1e-15  28%  589 aa  RESE_BACSU RecName: Full=Sensor histidine kinase resE;       
  195::412     1e-15  32%  425 aa  PHOR_HAEIN RecName: Full=Phosphate regulon sensor protein phoR;    
    5::120     1e-15  34%  123 aa  DIVK_OCHA4 RecName: Full=Polar-differentiation response regulator
 1160::1229    1e-15  36% 2388 aa  DHKM_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  250::470     2e-15  29%  475 aa  YFHK_ECOLI RecName: Full=Putative sensor-like histidine kinase
  209::302     2e-15  29%  656 aa  YCF26_PORPU RecName: Full=Uncharacterized sensor-like histidine
  120::364     2e-15  32%  383 aa  SASA_SYNS3 RecName: Full=Adaptive-response sensory-kinase sasA;    
    4::117     2e-15  37%  454 aa  PLED_CAUCR RecName: Full=Response regulator pleD;AltName:
  199::449     2e-15  33%  451 aa  ARLS_STAS1 RecName: Full=Signal transduction histidine-protein
    5::119     3e-15  37%  241 aa  SRRA_STAAW RecName: Full=Transcriptional regulatory protein
    5::119     3e-15  37%  241 aa  SRRA_STAAU RecName: Full=Transcriptional regulatory protein
    5::119     3e-15  37%  241 aa  SRRA_STAAS RecName: Full=Transcriptional regulatory protein
    5::119     3e-15  37%  241 aa  SRRA_STAAR RecName: Full=Transcriptional regulatory protein
    5::119     3e-15  37%  241 aa  SRRA_STAAN RecName: Full=Transcriptional regulatory protein
    5::119     3e-15  37%  241 aa  SRRA_STAAM RecName: Full=Transcriptional regulatory protein
    5::119     3e-15  37%  241 aa  SRRA_STAAC RecName: Full=Transcriptional regulatory protein
    5::119     3e-15  37%  241 aa  SRRA_STAA8 RecName: Full=Transcriptional regulatory protein
  281::516     3e-15  25%  567 aa  MTRB_MYCTU RecName: Full=Sensor histidine kinase mtrB;       
  281::516     3e-15  25%  567 aa  MTRB_MYCBO RecName: Full=Sensor histidine kinase mtrB;       
  648::880     3e-15  36%  894 aa  KDPD_ECOLI RecName: Full=Sensor protein kdpD;         EC=2.7.13.3;
  338::758     3e-15  26%  766 aa  EIN4_ARATH RecName: Full=Protein EIN4;         Short=AtEIN4;       
  492::625     3e-15  35% 1378 aa  DHKH_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  567::711     4e-15  38% 1220 aa  SLN1_YEAST RecName: Full=Osmosensing histidine protein kinase SLN1;
  115::359     5e-15  26%  372 aa  SASA_PROM2 RecName: Full=Adaptive-response sensory-kinase sasA;    
  115::359     5e-15  26%  372 aa  SASA_PROM0 RecName: Full=Adaptive-response sensory-kinase sasA;    
    5::120     5e-15  34%  123 aa  DIVK_BRUSU RecName: Full=Polar-differentiation response regulator
    5::120     5e-15  34%  123 aa  DIVK_BRUSI RecName: Full=Polar-differentiation response regulator
    5::120     5e-15  34%  123 aa  DIVK_BRUO2 RecName: Full=Polar-differentiation response regulator
    5::120     5e-15  34%  123 aa  DIVK_BRUME RecName: Full=Polar-differentiation response regulator
    5::120     5e-15  34%  123 aa  DIVK_BRUC2 RecName: Full=Polar-differentiation response regulator
    5::120     5e-15  34%  123 aa  DIVK_BRUAB RecName: Full=Polar-differentiation response regulator
    5::120     5e-15  34%  123 aa  DIVK_BRUA2 RecName: Full=Polar-differentiation response regulator
    5::120     5e-15  34%  123 aa  DIVK_BRUA1 RecName: Full=Polar-differentiation response regulator
  115::359     7e-15  26%  372 aa  SASA_PROMS RecName: Full=Adaptive-response sensory-kinase sasA;    
  211::464     7e-15  26%  469 aa  RSSA_SERMA RecName: Full=Swarming motility regulation sensor
    3::125     9e-15  36%  239 aa  OMPR_SHIFL RecName: Full=Transcriptional regulatory protein ompR;
    3::125     9e-15  36%  239 aa  OMPR_SALTY RecName: Full=Transcriptional regulatory protein ompR;
    3::125     9e-15  36%  239 aa  OMPR_SALTI RecName: Full=Transcriptional regulatory protein ompR;
    3::125     9e-15  36%  239 aa  OMPR_ECOLI RecName: Full=Transcriptional regulatory protein ompR;
    3::125     9e-15  36%  239 aa  OMPR_ECOL6 RecName: Full=Transcriptional regulatory protein ompR;
    3::125     9e-15  36%  239 aa  OMPR_ECO57 RecName: Full=Transcriptional regulatory protein ompR;
    4::121     2e-14  38%  235 aa  YYCF_BACSU RecName: Full=Transcriptional regulatory protein yycF;
  115::359     2e-14  26%  372 aa  SASA_PROM9 RecName: Full=Adaptive-response sensory-kinase sasA;    
  141::359     3e-14  28%  372 aa  SASA_PROMP RecName: Full=Adaptive-response sensory-kinase sasA;    
    5::118     3e-14  33%  224 aa  HSSR_STAES RecName: Full=Heme response regulator hssR;
    5::118     3e-14  33%  224 aa  HSSR_STAEQ RecName: Full=Heme response regulator hssR;
  171::411     3e-14  32%  681 aa  CQSS_VIBHB RecName: Full=CAI-1 autoinducer sensor
  210::364     4e-14  32%  383 aa  SASA_SYNPX RecName: Full=Adaptive-response sensory-kinase sasA;    
 1787::2333    4e-14  27% 2344 aa  MAK3_SCHPO RecName: Full=Peroxide stress-activated histidine kinase
  226::458     6e-14  32%  465 aa  ZRAS_SALTY RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
    7::125     6e-14  39%  239 aa  YCF27_CYAPA RecName: Full=Probable transcriptional regulator
  200::450     6e-14  34%  453 aa  ARLS_STAHJ RecName: Full=Signal transduction histidine-protein
  226::458     7e-14  32%  465 aa  ZRAS_SALTI RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
  158::383     7e-14  28%  384 aa  SASA_MICAN RecName: Full=Adaptive-response sensory-kinase sasA;    
    3::118     7e-14  32%  224 aa  HSSR_STAHJ RecName: Full=Heme response regulator hssR;
    5::118     7e-14  33%  224 aa  HSSR_STAAR RecName: Full=Heme response regulator hssR;
    5::118     7e-14  33%  224 aa  HSSR_STAAB RecName: Full=Heme response regulator hssR;
  167::388     1e-13  28%  391 aa  SASA_CYAP8 RecName: Full=Adaptive-response sensory-kinase sasA;    
    5::118     1e-13  33%  224 aa  HSSR_STAAW RecName: Full=Heme response regulator hssR;
    5::118     1e-13  33%  224 aa  HSSR_STAAT RecName: Full=Heme response regulator hssR;
    5::118     1e-13  33%  224 aa  HSSR_STAAS RecName: Full=Heme response regulator hssR;
    5::118     1e-13  33%  224 aa  HSSR_STAAN RecName: Full=Heme response regulator hssR;
    5::118     1e-13  33%  224 aa  HSSR_STAAM RecName: Full=Heme response regulator hssR;
    5::118     1e-13  33%  224 aa  HSSR_STAA9 RecName: Full=Heme response regulator hssR;
    5::118     1e-13  33%  224 aa  HSSR_STAA8 RecName: Full=Heme response regulator hssR;
    5::118     1e-13  33%  224 aa  HSSR_STAA3 RecName: Full=Heme response regulator hssR;
    5::118     1e-13  33%  224 aa  HSSR_STAA2 RecName: Full=Heme response regulator hssR;
    5::118     1e-13  33%  224 aa  HSSR_STAA1 RecName: Full=Heme response regulator hssR;
  304::455     1e-13  36%  465 aa  ZRAS_ECOLI RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
    4::119     1e-13  37%  233 aa  WALR_STAS1 RecName: Full=Transcriptional regulatory protein walR;
  133::373     1e-13  25%  384 aa  VANS_ENTFC RecName: Full=Sensor protein vanS;       
    4::122     1e-13  34%  227 aa  PHOB_RHIME RecName: Full=Phosphate regulon transcriptional
    4::119     1e-13  37%  231 aa  PHOB_HAEIN RecName: Full=Phosphate regulon transcriptional
  200::453     1e-13  30%  456 aa  ARLS_STAES RecName: Full=Signal transduction histidine-protein
  176::438     2e-13  32%  443 aa  PHOR_PSEAE RecName: Full=Phosphate regulon sensor protein phoR;    
    5::118     2e-13  33%  224 aa  HSSR_STAAE RecName: Full=Heme response regulator hssR;
    5::118     2e-13  33%  224 aa  HSSR_STAAC RecName: Full=Heme response regulator hssR;
  175::427     2e-13  31%  686 aa  CQSS_VIBCH RecName: Full=CAI-1 autoinducer sensor
    4::119     2e-13  36%  233 aa  WALR_STAES RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAEQ RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAAW RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAAU RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAAT RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAAS RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAAR RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAAN RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAAM RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAAE RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAAC RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAAB RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAA9 RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAA8 RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAA3 RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAA2 RecName: Full=Transcriptional regulatory protein walR;
    4::119     2e-13  36%  233 aa  WALR_STAA1 RecName: Full=Transcriptional regulatory protein walR;
  206::444     3e-13  28%  454 aa  YKOH_BACSU RecName: Full=Sensor histidine kinase ykoH;       
    2::115     3e-13  32%  223 aa  YEDW_ECOLI RecName: Full=Probable transcriptional regulatory
  153::382     3e-13  31%  383 aa  SASA_SYNY3 RecName: Full=Adaptive-response sensory-kinase sasA;    
  163::392     3e-13  30%  393 aa  SASA_CYAP7 RecName: Full=Adaptive-response sensory-kinase sasA;    
    2::114     3e-13  38%  224 aa  DLTR_STRA5 RecName: Full=Transcriptional regulatory protein dltR;
    2::114     3e-13  38%  224 aa  DLTR_STRA3 RecName: Full=Transcriptional regulatory protein dltR;
    3::119     3e-13  35%  220 aa  ARLR_STAS1 RecName: Full=Response regulator arlR;
  234::467     4e-13  25%  473 aa  YCLK_BACSU RecName: Full=Sensor histidine kinase yclK;       
    7::122     4e-13  38%  243 aa  YCF27_PORPU RecName: Full=Probable transcriptional regulator
    4::119     4e-13  35%  233 aa  WALR_STAHJ RecName: Full=Transcriptional regulatory protein walR;
    5::119     4e-13  33%  242 aa  GTCR_ANEMI RecName: Full=Response regulator gtcR;
  200::453     4e-13  29%  456 aa  ARLS_STAEQ RecName: Full=Signal transduction histidine-protein
  240::450     5e-13  35%  460 aa  HSSS_STAS1 RecName: Full=Heme sensor protein hssS;       
    2::112     5e-13  36%  225 aa  CZCR_RALME RecName: Full=Transcriptional activator protein czcR;
  297::448     6e-13  34%  458 aa  ZRAS_ECO57 RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
    3::119     6e-13  34%  228 aa  YKOG_BACSU RecName: Full=Uncharacterized transcriptional regulatory
   16::131     6e-13  39%  254 aa  YCF27_GUITH RecName: Full=Probable transcriptional regulator
    8::113     8e-13  39%  443 aa  ZRAR_KLEOX RecName: Full=Transcriptional regulatory protein zraR;
    7::122     8e-13  37%  243 aa  YCF27_PORYE RecName: Full=Probable transcriptional regulator
 2438::2761    8e-13  36% 3432 aa  DHKG_DICDI RecName: Full=Hybrid signal transduction histidine kinase
   12::118     1e-12  40%  249 aa  YCF27_CYACA RecName: Full=Probable transcriptional regulator
  535::750     1e-12  32%  833 aa  VIRA_AGRT5 RecName: Full=Wide host range virA protein;       
  155::399     1e-12  26%  401 aa  SASA_NOSP7 RecName: Full=Adaptive-response sensory-kinase sasA;    
    4::127     1e-12  37%  228 aa  SAER_STAAW RecName: Full=Response regulator saeR;AltName:
    4::127     1e-12  37%  228 aa  SAER_STAAS RecName: Full=Response regulator saeR;AltName:
    4::127     1e-12  37%  228 aa  SAER_STAAR RecName: Full=Response regulator saeR;AltName:
    4::127     1e-12  37%  228 aa  SAER_STAAN RecName: Full=Response regulator saeR;AltName:
    4::127     1e-12  37%  228 aa  SAER_STAAM RecName: Full=Response regulator saeR;AltName:
    4::127     1e-12  37%  228 aa  SAER_STAAE RecName: Full=Response regulator saeR;AltName:
    4::127     1e-12  37%  228 aa  SAER_STAAC RecName: Full=Response regulator saeR;AltName:
    4::127     1e-12  37%  228 aa  SAER_STAAB RecName: Full=Response regulator saeR;AltName:
    4::127     1e-12  37%  228 aa  SAER_STAA8 RecName: Full=Response regulator saeR;AltName:
    4::127     1e-12  37%  228 aa  SAER_STAA3 RecName: Full=Response regulator saeR;AltName:
  515::745     1e-12  25%  748 aa  PHY1_SYNY3 RecName: Full=Phytochrome-like protein cph1;       
    3::123     1e-12  34%  229 aa  PHOB_PSEAE RecName: Full=Phosphate regulon transcriptional
  214::449     1e-12  26%  452 aa  YEDV_ECOLI RecName: Full=Putative sensor-like histidine kinase
    5::120     1e-12  37%  240 aa  YCF27_PORAE RecName: Full=Probable transcriptional regulator
    8::123     1e-12  37%  240 aa  RESD_BACSU RecName: Full=Transcriptional regulatory protein resD;
  210::364     2e-12  30%  383 aa  SASA_SYNS9 RecName: Full=Adaptive-response sensory-kinase sasA;    
    4::120     2e-12  33%  240 aa  PHOP_BACSU RecName: Full=Alkaline phosphatase synthesis
    2::124     2e-12  37%  255 aa  YCF27_GALSU RecName: Full=Probable transcriptional regulator
   73::304     2e-12  25%  311 aa  YCBM_BACSU RecName: Full=Sensor histidine kinase ycbM;       
    2::118     2e-12  33%  228 aa  SILR_SALTY RecName: Full=Probable transcriptional regulatory
    6::121     3e-12  37%  237 aa  YVRH_BACSU RecName: Full=Transcriptional regulatory protein yvrH;
    5::118     3e-12  29%  224 aa  HSSR_STAS1 RecName: Full=Heme response regulator hssR;
   70::343     4e-12  26%  356 aa  YVCQ_BACSU RecName: Full=Sensor histidine kinase yvcQ;       
  877::1108    4e-12  30% 1134 aa  PHY1_SELMA RecName: Full=Phytochrome 1;
    4::104     4e-12  39%  231 aa  MPRA_MYCVP RecName: Full=Response regulator mprA;AltName:
    2::118     4e-12  33%  227 aa  CUSR_ECOLI RecName: Full=Transcriptional regulatory protein cusR;
    2::118     4e-12  33%  227 aa  CUSR_ECOL6 RecName: Full=Transcriptional regulatory protein cusR;
    2::118     4e-12  33%  227 aa  CUSR_ECO57 RecName: Full=Transcriptional regulatory protein cusR;
    3::120     5e-12  33%  227 aa  CPXR_HAEIN RecName: Full=Transcriptional regulatory protein cpxR
    2::118     5e-12  32%  227 aa  COPR_PSESM RecName: Full=Transcriptional activator protein copR;
  238::455     7e-12  34%  457 aa  HSSS_STAAR RecName: Full=Heme sensor protein hssS;       
  628::1681    7e-12  35% 1699 aa  DHKE_DICDI RecName: Full=Hybrid signal transduction histidine
  371::599     7e-12  27%  608 aa  ATOS_ECOLI RecName: Full=Signal transduction histidine-protein
   17::200     9e-12  29%  767 aa  PRR73_ORYSJ RecName: Full=Two-component response regulator-like
   60::181     9e-12  36%  742 aa  PRR37_ORYSJ RecName: Full=Two-component response regulator-like
   60::181     9e-12  36%  742 aa  PRR37_ORYSI RecName: Full=Two-component response regulator-like
  238::453     9e-12  34%  457 aa  HSSS_STAAW RecName: Full=Heme sensor protein hssS;       
  238::453     9e-12  34%  457 aa  HSSS_STAAS RecName: Full=Heme sensor protein hssS;       
    3::122     1e-11  34%  209 aa  YCF29_PORPU RecName: Full=Probable transcriptional regulator ycf29;
    1::104     1e-11  35%  223 aa  YBDJ_BACSU RecName: Full=Uncharacterized transcriptional regulatory
  168::399     1e-11  28%  401 aa  SASA_ANASP RecName: Full=Adaptive-response sensory-kinase sasA;    
   78::200     1e-11  34%  767 aa  PRR73_ORYSI RecName: Full=Two-component response regulator-like
  238::453     1e-11  34%  457 aa  HSSS_STAAT RecName: Full=Heme sensor protein hssS;       
  238::453     1e-11  34%  457 aa  HSSS_STAAE RecName: Full=Heme sensor protein hssS;       
  238::453     1e-11  34%  457 aa  HSSS_STAAC RecName: Full=Heme sensor protein hssS;       
  238::453     1e-11  34%  457 aa  HSSS_STAA8 RecName: Full=Heme sensor protein hssS;       
  238::453     1e-11  34%  457 aa  HSSS_STAA3 RecName: Full=Heme sensor protein hssS;       
    2::122     1e-11  41%  349 aa  CHEB_ARCFU RecName: Full=Chemotaxis response regulator
   79::197     1e-11  34%  727 aa  APRR7_ARATH RecName: Full=Two-component response regulator-like
  168::399     2e-11  28%  401 aa  SASA_ANAVT RecName: Full=Adaptive-response sensory-kinase sasA;    
  287::514     2e-11  24%  519 aa  RPRX_BACFR RecName: Full=Sensor protein rprX;         EC=2.7.13.3;
  238::453     2e-11  34%  457 aa  HSSS_STAAN RecName: Full=Heme sensor protein hssS;       
  238::453     2e-11  34%  457 aa  HSSS_STAAM RecName: Full=Heme sensor protein hssS;       
  238::453     2e-11  34%  457 aa  HSSS_STAA9 RecName: Full=Heme sensor protein hssS;       
  238::453     2e-11  34%  457 aa  HSSS_STAA2 RecName: Full=Heme sensor protein hssS;       
  238::453     2e-11  34%  457 aa  HSSS_STAA1 RecName: Full=Heme sensor protein hssS;       
  211::474     2e-11  23%  476 aa  CZCS_RALME RecName: Full=Sensor protein czcS;       
    6::112     2e-11  36%  461 aa  ATOC_ECOLI RecName: Full=Acetoacetate metabolism regulatory protein
    2::106     2e-11  36%  130 aa  CHEY_CAMJJ RecName: Full=Chemotaxis protein cheY homolog;
    2::106     2e-11  36%  130 aa  CHEY_CAMJE RecName: Full=Chemotaxis protein cheY homolog;
    2::106     2e-11  36%  130 aa  CHEY_CAMJ8 RecName: Full=Chemotaxis protein cheY homolog;
    1::115     2e-11  46%  366 aa  CHEB_NOCSJ RecName: Full=Chemotaxis response regulator
  211::449     2e-11  25%  451 aa  ARLS_STAAW RecName: Full=Signal transduction histidine-protein
  211::449     2e-11  25%  451 aa  ARLS_STAAS RecName: Full=Signal transduction histidine-protein
  211::449     2e-11  25%  451 aa  ARLS_STAAR RecName: Full=Signal transduction histidine-protein
  211::449     2e-11  25%  451 aa  ARLS_STAAN RecName: Full=Signal transduction histidine-protein
  211::449     2e-11  25%  451 aa  ARLS_STAAM RecName: Full=Signal transduction histidine-protein
  211::449     2e-11  25%  451 aa  ARLS_STAAC RecName: Full=Signal transduction histidine-protein
  211::449     2e-11  25%  451 aa  ARLS_STAAB RecName: Full=Signal transduction histidine-protein
  211::449     2e-11  25%  451 aa  ARLS_STAA8 RecName: Full=Signal transduction histidine-protein
  211::449     2e-11  25%  451 aa  ARLS_STAA3 RecName: Full=Signal transduction histidine-protein
    3::108     3e-11  31%  226 aa  PCOR_ECOLX RecName: Full=Transcriptional regulatory protein pcoR;
  238::453     3e-11  34%  457 aa  HSSS_STAAB RecName: Full=Heme sensor protein hssS;       
   20::143     3e-11  30%  618 aa  APRR1_ARATH RecName: Full=Two-component response regulator-like
    2::120     3e-11  31%  219 aa  QSEB_ECOLI RecName: Full=Transcriptional regulatory protein qseB;
  222::467     3e-11  27%  522 aa  MPRB_MYCPA RecName: Full=Signal transduction histidine-protein
    4::104     3e-11  37%  230 aa  MPRA_MYCSS RecName: Full=Response regulator mprA;AltName:
    4::104     3e-11  37%  230 aa  MPRA_MYCSK RecName: Full=Response regulator mprA;AltName:
    4::104     3e-11  37%  230 aa  MPRA_MYCSJ RecName: Full=Response regulator mprA;AltName:
    2::117     3e-11  31%  229 aa  IRLR_BURPS RecName: Full=Transcriptional activator protein irlR;
  358::496     4e-11  33%  622 aa  SKN7_YEAST RecName: Full=Transcription factor SKN7;AltName:
  192::424     4e-11  26%  433 aa  RSTB_ECOLI RecName: Full=Sensor protein rstB;         EC=2.7.13.3;
    8::117     4e-11  31%  129 aa  CHEY_RHIEC RecName: Full=Probable chemotaxis protein cheY;
    8::113     6e-11  37%  441 aa  ZRAR_SALTY RecName: Full=Transcriptional regulatory protein zraR;
    8::113     6e-11  37%  441 aa  ZRAR_SALTI RecName: Full=Transcriptional regulatory protein zraR;
  357::575     6e-11  25%  580 aa  YVRG_BACSU RecName: Full=Sensor histidine kinase yvrG;       
    3::118     6e-11  33%  220 aa  SPAR_BACSU RecName: Full=Transcriptional regulatory protein
   19::139     6e-11  31%  378 aa  RPFG_XANC8 RecName: Full=Response regulator rpfG;
    4::118     6e-11  30%  228 aa  REGX3_MYCS2 RecName: Full=Sensory transduction protein regX3;
    2::120     6e-11  31%  219 aa  QSEB_ECO57 RecName: Full=Transcriptional regulatory protein qseB;
  249::461     6e-11  24%  466 aa  PCOS_ECOLX RecName: Full=Probable sensor protein pcoS;       
  219::479     6e-11  29%  492 aa  MPRB_MYCS2 RecName: Full=Signal transduction histidine-protein
  364::501     6e-11  38%  522 aa  MCS4_SCHPO RecName: Full=Response regulator mcs4;AltName:
  192::423     6e-11  30%  428 aa  KINC_BACSU RecName: Full=Sporulation kinase C;         EC=2.7.13.3;
  789::897     6e-11  36%  900 aa  KDPD_CLOAB RecName: Full=Sensor protein kdpD;         EC=2.7.13.3;
   25::136     6e-11  39%  144 aa  CHEY_TREPA RecName: Full=Chemotaxis protein cheY;
   25::153     8e-11  32%  257 aa  SPHR_SYNE7 RecName: Full=Alkaline phosphatase synthesis
    2::119     8e-11  28%  221 aa  QSEB_HAEIN RecName: Full=Transcriptional regulatory protein qseB;
  222::467     8e-11  28%  522 aa  MPRB_MYCA1 RecName: Full=Signal transduction histidine-protein
    4::104     8e-11  37%  232 aa  MPRA_MYCUA RecName: Full=Response regulator mprA;AltName:
   35::164     8e-11  30%  231 aa  ARR3_ARATH RecName: Full=Two-component response regulator ARR3;
   28::108     1e-10  42%  231 aa  YRKP_BACSU RecName: Full=Uncharacterized transcriptional regulatory
  498::646     1e-10  34%  712 aa  SSK1_YEAST RecName: Full=Osomolarity two-component system protein
  226::453     1e-10  30%  484 aa  MPRB_MYCVP RecName: Full=Signal transduction histidine-protein
    2::102     1e-10  36%  228 aa  MPRA_MYCLE RecName: Full=Response regulator mprA;AltName:
  319::563     1e-10  26%  577 aa  CHVG_RHIME RecName: Full=Sensor protein chvG;       
    5::115     1e-10  34%  445 aa  PILR_PSEAE RecName: Full=Type 4 fimbriae expression regulatory
  206::374     1e-10  27%  379 aa  PATA_ANASP RecName: Full=Protein patA;AltName: Full=PAT-1;
    4::104     1e-10  36%  230 aa  MPRA_MYCS2 RecName: Full=Response regulator mprA;AltName:
    2::102     1e-10  36%  228 aa  MPRA_MYCPA RecName: Full=Response regulator mprA;AltName:
    4::104     1e-10  36%  230 aa  MPRA_MYCBP RecName: Full=Response regulator mprA;AltName:
    4::104     1e-10  36%  230 aa  MPRA_MYCBO RecName: Full=Response regulator mprA;AltName:
    2::102     1e-10  36%  228 aa  MPRA_MYCA1 RecName: Full=Response regulator mprA;AltName:
   51::169     1e-10  32%  558 aa  APRR5_ARATH RecName: Full=Two-component response regulator-like
    4::118     1e-10  35%  225 aa  AFSQ1_STRCO RecName: Full=Transcriptional regulatory protein afsQ1;
    5::108     2e-10  44%  354 aa  CHEB2_CARHZ RecName: Full=Chemotaxis response regulator
    3::119     2e-10  28%  230 aa  TORR_ECOLI RecName: Full=TorCAD operon transcriptional regulatory
    4::104     2e-10  36%  230 aa  MPRA_MYCTU RecName: Full=Response regulator mprA;AltName:
    4::104     2e-10  36%  230 aa  MPRA_MYCTA RecName: Full=Response regulator mprA;AltName:
  207::454     2e-10  25%  457 aa  CPXA_ECOLI RecName: Full=Sensor protein cpxA;         EC=2.7.13.3;
  207::454     2e-10  25%  457 aa  CPXA_ECOL6 RecName: Full=Sensor protein cpxA;         EC=2.7.13.3;
  207::454     2e-10  25%  457 aa  CPXA_ECO57 RecName: Full=Sensor protein cpxA;         EC=2.7.13.3;
   36::159     2e-10  31%  259 aa  ARR4_ARATH RecName: Full=Two-component response regulator
    3::119     3e-10  27%  230 aa  TORR_ECO57 RecName: Full=TorCAD operon transcriptional regulatory
    2::102     3e-10  35%  219 aa  QSEB_SALTY RecName: Full=Transcriptional regulatory protein qseB;
    2::102     3e-10  35%  219 aa  QSEB_SALTI RecName: Full=Transcriptional regulatory protein qseB;
    4::122     3e-10  29%  229 aa  PHOB_SHIFL RecName: Full=Phosphate regulon transcriptional
    4::122     3e-10  29%  229 aa  PHOB_SHIDY RecName: Full=Phosphate regulon transcriptional
    4::122     3e-10  29%  229 aa  PHOB_ECOLI RecName: Full=Phosphate regulon transcriptional
    4::122     3e-10  29%  229 aa  PHOB_ECO57 RecName: Full=Phosphate regulon transcriptional
    4::116     3e-10  34%  241 aa  CHVI_RHISN RecName: Full=Transcriptional regulatory protein chvI;
    4::113     3e-10  34%  240 aa  CHVI_RHIME RecName: Full=Transcriptional regulatory protein chvI;
   38::156     3e-10  31%  468 aa  APRR9_ARATH RecName: Full=Two-component response regulator-like
    4::119     4e-10  34%  231 aa  VANR_ENTFC RecName: Full=Regulatory protein vanR;
    4::122     4e-10  29%  229 aa  PHOB_KLEPN RecName: Full=Phosphate regulon transcriptional
    4::116     4e-10  34%  241 aa  CHVI_RHIRD RecName: Full=Transcriptional regulatory protein chvI;
   20::131     4e-10  40%  394 aa  CHEB2_RHOCS RecName: Full=Chemotaxis response regulator
  947::1096    5e-10  36% 1124 aa  PHY_MOUSC RecName: Full=Phytochrome;
  600::841     5e-10  32%  854 aa  KDPD_RATRA RecName: Full=Sensor protein kdpD;         EC=2.7.13.3;
    2::120     5e-10  34%  124 aa  CHEY_HELPY RecName: Full=Chemotaxis protein cheY homolog;
    1::125     5e-10  34%  371 aa  CHEB3_GEOSL RecName: Full=Chemotaxis response regulator
    4::119     6e-10  32%  220 aa  VANR_ENTFA RecName: Full=Regulatory protein vanRB;
    1::120     6e-10  31%  256 aa  SP0A_MOOTA RecName: Full=Stage 0 sporulation protein A homolog;
    1::120     6e-10  31%  212 aa  SP0A_BACME RecName: Full=Stage 0 sporulation protein A;Flags:
    1::119     6e-10  34%  210 aa  SP0A_BACCI RecName: Full=Stage 0 sporulation protein A;Flags:
    6::115     6e-10  36%  469 aa  NTRC_ECOLI RecName: Full=Nitrogen regulation protein NR(I);
    6::115     6e-10  36%  469 aa  NTRC_ECO57 RecName: Full=Nitrogen regulation protein NR(I);
    5::108     6e-10  39%  352 aa  CHEB1_SYNWW RecName: Full=Chemotaxis response regulator
    1::114     8e-10  35%  226 aa  YCBL_BACSU RecName: Full=Uncharacterized transcriptional regulatory
   44::162     8e-10  32%  623 aa  PRR95_ORYSJ RecName: Full=Two-component response regulator-like
   15::131     8e-10  34%  205 aa  PDTAR_MYCTU RecName: Full=Probable transcriptional regulatory
  221::462     8e-10  23%  464 aa  IRLS_BURPS RecName: Full=Sensor protein irlS;         EC=2.7.13.3;
    2::120     8e-10  34%  124 aa  CHEY_HELPJ RecName: Full=Chemotaxis protein cheY homolog;
    4::118     1e-09  30%  227 aa  REGX3_MYCTU RecName: Full=Sensory transduction protein regX3;
    4::118     1e-09  30%  227 aa  REGX3_MYCBO RecName: Full=Sensory transduction protein regX3;
    3::106     1e-09  43%  357 aa  CHEB_BACSU RecName: Full=Chemotaxis response regulator
    1::106     1e-09  36%  360 aa  CHEB2_GEOMG RecName: Full=Chemotaxis response regulator
   27::137     1e-09  40%  394 aa  CHEB2_AZOBR RecName: Full=Chemotaxis response regulator
  119::340     1e-09  24%  356 aa  BASS_SALTY RecName: Full=Sensor protein basS;         EC=2.7.13.3;
   16::128     1e-09  31%  552 aa  ARR10_ARATH RecName: Full=Two-component response regulator
    4::119     1e-09  29%  219 aa  ARLR_STAHJ RecName: Full=Response regulator arlR;
  544::729     1e-09  35%  835 aa  VIRAL_RHIRD RecName: Full=Limited host range virA protein;       
  657::761     1e-09  33%  777 aa  FRZE_MYXXA RecName: Full=Gliding motility regulatory protein;      
  336::589     1e-09  26%  596 aa  CHVG_AGRT5 RecName: Full=Sensor protein chvG;         EC=2.7.13.3;
    4::140     1e-09  27%  225 aa  ARR8_ARATH RecName: Full=Two-component response regulator
   22::144     1e-09  29%  153 aa  ARR17_ARATH RecName: Full=Two-component response regulator ARR17;
   16::128     1e-09  31%  596 aa  ARR12_ARATH RecName: Full=Two-component response regulator ARR12;
  297::452     2e-09  33%  462 aa  ZRAS_KLEOX RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
    2::117     2e-09  29%  227 aa  YCLJ_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    2::102     2e-09  35%  224 aa  TCTD_SALTY RecName: Full=Transcriptional regulatory protein tctD;
    7::122     2e-09  28%  135 aa  PILG_PSEAE RecName: Full=Protein pilG;
  869::1093    2e-09  27% 1121 aa  PHY2_CERPU RecName: Full=Phytochrome 2;
  208::455     2e-09  25%  459 aa  SPAK_BACSU RecName: Full=Sensor histidine kinase spaK;       
    5::120     2e-09  32%  264 aa  SP0A_BACTU RecName: Full=Stage 0 sporulation protein A;
    5::120     2e-09  32%  267 aa  SP0A_BACSU RecName: Full=Stage 0 sporulation protein A;AltName:
    5::120     2e-09  32%  264 aa  SP0A_BACCR RecName: Full=Stage 0 sporulation protein A;
    9::115     2e-09  32%  236 aa  RPRY_BACFR RecName: Full=Transcriptional regulatory protein rprY;
   29::152     2e-09  30%  518 aa  PRR1_ORYSJ RecName: Full=Two-component response regulator-like
    6::115     2e-09  35%  469 aa  NTRC_SALTY RecName: Full=Nitrogen regulation protein NR(I);
    6::115     2e-09  29%  480 aa  NTRC_BRASR RecName: Full=Nitrogen assimilation regulatory protein;
  637::884     2e-09  24%  889 aa  NODV_BRAJA RecName: Full=Nodulation protein V;         EC=2.7.13.3;
  519::726     2e-09  26%  738 aa  KINE_BACSU RecName: Full=Sporulation kinase E;       
    3::117     2e-09  30%  232 aa  CPXR_SHIFL RecName: Full=Transcriptional regulatory protein cpxR;
    3::117     2e-09  30%  232 aa  CPXR_ECOLI RecName: Full=Transcriptional regulatory protein cpxR;
    3::117     2e-09  30%  232 aa  CPXR_ECO57 RecName: Full=Transcriptional regulatory protein cpxR;
  423::525     2e-09  37%  542 aa  CITS_BACSU RecName: Full=Sensor protein citS;         EC=2.7.13.3;
    5::120     3e-09  32%  264 aa  SP0A_BACAN RecName: Full=Stage 0 sporulation protein A;
  508::751     3e-09  24%  751 aa  PHYB_ANASP RecName: Full=Cyanobacterial phytochrome B;       
  161::288     3e-09  32%  793 aa  PDE2_DICDI RecName: Full=3',5'-cyclic-nucleotide phosphodiesterase
    6::115     3e-09  33%  473 aa  NTRC_PROVU RecName: Full=Nitrogen regulation protein NR(I);
  239::479     3e-09  22%  482 aa  CUSS_ECO57 RecName: Full=Sensor kinase cusS;         EC=2.7.13.3;
    3::112     3e-09  37%  120 aa  CHEY_BACSU RecName: Full=Chemotaxis protein cheY homolog;
   79::178     4e-09  33%  305 aa  PFER_PSEAE RecName: Full=Transcriptional activator protein pfeR;
  218::453     4e-09  35%  456 aa  HSSS_STAHJ RecName: Full=Heme sensor protein hssS;       
  119::340     4e-09  26%  363 aa  BASS_ECOLI RecName: Full=Sensor protein basS;         EC=2.7.13.3;
   27::143     4e-09  29%  184 aa  ARR5_ARATH RecName: Full=Two-component response regulator
    6::123     4e-09  31%  238 aa  ARCA_SHIFL RecName: Full=Aerobic respiration control protein arcA;
    6::123     4e-09  31%  238 aa  ARCA_ECOLI RecName: Full=Aerobic respiration control protein
    6::123     4e-09  31%  238 aa  ARCA_ECOL6 RecName: Full=Aerobic respiration control protein arcA;
    6::123     4e-09  31%  238 aa  ARCA_ECO57 RecName: Full=Aerobic respiration control protein arcA;
  576::691     5e-09  36%  829 aa  VIRA_AGRT9 RecName: Full=Wide host range virA protein;       
    6::115     5e-09  29%  480 aa  NTRC_AZOC5 RecName: Full=Nitrogen assimilation regulatory protein
  610::848     5e-09  26%  860 aa  KDPD_MYCTU RecName: Full=Sensor protein kdpD;         EC=2.7.13.3;
    3::118     5e-09  30%  224 aa  GRAR_STAS1 RecName: Full=Response regulator protein graR;AltName:
    4::115     5e-09  32%  226 aa  DCTR_BACSU RecName: Full=Probable C4-dicarboxylate response
  239::479     5e-09  22%  480 aa  CUSS_ECOLI RecName: Full=Sensor kinase cusS;         EC=2.7.13.3;
    2::115     5e-09  35%  120 aa  CHEY_THEMA RecName: Full=Chemotaxis protein cheY;
    1::109     5e-09  39%  372 aa  CHEB_TREDE RecName: Full=Chemotaxis response regulator
    9::142     5e-09  28%  234 aa  ARR9_ARATH RecName: Full=Two-component response regulator
   63::155     5e-09  27%  186 aa  ARR6_ARATH RecName: Full=Two-component response regulator ARR6;
   36::149     5e-09  32%  690 aa  ARR1_ARATH RecName: Full=Two-component response regulator ARR1;
    8::115     7e-09  33%  469 aa  NTRC_KLEPN RecName: Full=Nitrogen assimilation regulatory protein;
  429::549     7e-09  34%  552 aa  DPIB_ECOLI RecName: Full=Sensor kinase dpiB;       
  239::479     7e-09  22%  480 aa  CUSS_ECOL6 RecName: Full=Sensor kinase cusS;         EC=2.7.13.3;
    2::121     7e-09  29%  231 aa  BCER_BACHD RecName: Full=Sensory transduction protein bceR;
  156::348     9e-09  25%  413 aa  SPHS_SYNE7 RecName: Full=Sensor protein sphS;         EC=2.7.13.3;
  889::1092    9e-09  28% 1132 aa  PHY1_PHYPA RecName: Full=Phytochrome 1;
  227::390     9e-09  30%  400 aa  NTRB_AZOBR RecName: Full=Nitrogen regulation protein ntrB;       
    2::118     9e-09  28%  224 aa  GRAR_STAHJ RecName: Full=Response regulator protein graR;AltName:
    2::118     9e-09  27%  224 aa  GRAR_STAES RecName: Full=Response regulator protein graR;AltName:
    2::118     9e-09  27%  224 aa  GRAR_STAEQ RecName: Full=Response regulator protein graR;AltName:
  505::649     9e-09  28%  657 aa  DCTS_RHOCA RecName: Full=C4-dicarboxylate transport sensor protein
   16::89      1e-08  35%  198 aa  REGX3_MYCLE RecName: Full=Sensory transduction protein regX3;
  881::1105    1e-08  30% 1132 aa  PHYB_TOBAC RecName: Full=Phytochrome B;
   25::139     1e-08  38%  352 aa  CHEB_TRIEI RecName: Full=Chemotaxis response regulator
  664::739     1e-08  41%  755 aa  BPHY_DEIRA RecName: Full=Bacteriophytochrome;       
   83::329     1e-08  29%  334 aa  BCES_BACHD RecName: Full=Sensor protein bceS;         EC=2.7.13.3;
   19::149     1e-08  29%  664 aa  ARR2_ARATH RecName: Full=Two-component response regulator
   21::113     2e-08  35%  441 aa  ZRAR_ECOLI RecName: Full=Transcriptional regulatory protein zraR;
   21::113     2e-08  35%  441 aa  ZRAR_ECO57 RecName: Full=Transcriptional regulatory protein zraR;
  576::691     2e-08  35%  829 aa  VIRAW_RHIRD RecName: Full=Wide host range virA protein;       
  190::423     2e-08  24%  428 aa  KINB_BACSU RecName: Full=Sporulation kinase B;         EC=2.7.13.3;
    5::131     2e-08  29%  382 aa  ARR14_ARATH RecName: Full=Two-component response regulator ARR14;
    4::119     2e-08  30%  219 aa  ARLR_STAEQ RecName: Full=Response regulator arlR;
   61::183     2e-08  31%  495 aa  APRR3_ARATH RecName: Full=Two-component response regulator-like
  402::507     2e-08  38%  535 aa  AFSQ2_STRCO RecName: Full=Signal transduction histidine-protein
    5::124     2e-08  28%  124 aa  SP0F_BACSU RecName: Full=Sporulation initiation phosphotransferase
    6::120     2e-08  32%  212 aa  SP0A_BREPA RecName: Full=Stage 0 sporulation protein A;Flags:
  883::1121    2e-08  29% 1136 aa  PHY_PICAB RecName: Full=Phytochrome;
    3::118     2e-08  28%  224 aa  CIAR_STRR6 RecName: Full=Transcriptional regulatory protein ciaR;
    3::118     2e-08  28%  224 aa  CIAR_STRPN RecName: Full=Transcriptional regulatory protein ciaR;
    3::114     2e-08  33%  119 aa  CHEY_LISMO RecName: Full=Chemotaxis protein cheY;
    3::114     2e-08  33%  119 aa  CHEY_LISIN RecName: Full=Chemotaxis protein cheY;
    3::112     2e-08  39%  351 aa  CHEB_METBU RecName: Full=Chemotaxis response regulator
    3::106     2e-08  37%  357 aa  CHEB_BACLD RecName: Full=Chemotaxis response regulator
    6::109     2e-08  38%  351 aa  CHEB1_AGRT5 RecName: Full=Chemotaxis response regulator
    4::119     2e-08  30%  219 aa  ARLR_STAES RecName: Full=Response regulator arlR;
    2::118     3e-08  31%  237 aa  YVCP_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    8::122     3e-08  33%  273 aa  SP0A_CLOB8 RecName: Full=Stage 0 sporulation protein A homolog;
    6::118     3e-08  30%  475 aa  NTRXL_RICPR RecName: Full=Putative response regulator ntrX-like;
    5::125     3e-08  30%  337 aa  HNR_SHIFL RecName: Full=Protein hnr;
    5::125     3e-08  30%  337 aa  HNR_ECOLI RecName: Full=Protein hnr;
    5::125     3e-08  30%  337 aa  HNR_ECO57 RecName: Full=Protein hnr;
  252::499     3e-08  25%  504 aa  FIXL_AZOC5 RecName: Full=Sensor protein fixL;         EC=2.7.13.3;
    6::116     3e-08  34%  352 aa  CYAB_STIAU RecName: Full=Adenylate cyclase 2;       
    7::107     3e-08  36%  234 aa  CSEB_STRCO RecName: Full=Transcriptional regulatory protein cseB;
  235::462     3e-08  27%  474 aa  CREC_ECOLI RecName: Full=Sensor protein creC;         EC=2.7.13.3;
    4::106     3e-08  43%  390 aa  CHEB_ALHEH RecName: Full=Chemotaxis response regulator
   10::131     3e-08  33%  521 aa  ARR11_ARATH RecName: Full=Two-component response regulator
    3::104     3e-08  30%  219 aa  ARLR_STAAW RecName: Full=Response regulator arlR;
    3::104     3e-08  30%  219 aa  ARLR_STAAS RecName: Full=Response regulator arlR;
    3::104     3e-08  30%  219 aa  ARLR_STAAR RecName: Full=Response regulator arlR;
    3::104     3e-08  30%  214 aa  ARLR_STAAN RecName: Full=Response regulator arlR;
    3::104     3e-08  30%  219 aa  ARLR_STAAM RecName: Full=Response regulator arlR;
    3::104     3e-08  30%  219 aa  ARLR_STAAC RecName: Full=Response regulator arlR;
    3::104     3e-08  30%  219 aa  ARLR_STAAB RecName: Full=Response regulator arlR;
    3::104     3e-08  30%  219 aa  ARLR_STAA8 RecName: Full=Response regulator arlR;
    3::104     3e-08  30%  219 aa  ARLR_STAA3 RecName: Full=Response regulator arlR;
    4::118     3e-08  32%  259 aa  SP0A_BACST RecName: Full=Stage 0 sporulation protein A;
    3::119     3e-08  28%  224 aa  PHOP_SALCH RecName: Full=Virulence transcriptional regulatory
    6::118     3e-08  30%  475 aa  NTRXL_RICTY RecName: Full=Putative response regulator ntrX-like;
    6::118     3e-08  31%  475 aa  NTRXL_RICFE RecName: Full=Putative response regulator ntrX-like;
  218::497     3e-08  25%  519 aa  MPRB_MYCLE RecName: Full=Signal transduction histidine-protein
    3::110     3e-08  32%  225 aa  CSSR_BACSU RecName: Full=Transcriptional regulatory protein cssR;
    7::107     3e-08  36%  235 aa  CSEB_STRAW RecName: Full=Transcriptional regulatory protein cseB;
   16::129     5e-08  29%  253 aa  VIRG_AGRT5 RecName: Full=Regulatory protein virG;
  527::630     5e-08  24%  651 aa  RCAC_FREDI RecName: Full=Protein rcaC;
    1::115     5e-08  26%  484 aa  NTRC_RHIME RecName: Full=Nitrogen assimilation regulatory protein;
    6::115     5e-08  30%  481 aa  NTRC_AZOBR RecName: Full=Nitrogen assimilation regulatory protein;
   92::336     5e-08  25%  346 aa  GRAS_STAES RecName: Full=Sensor histidine kinase graS;       
   92::336     5e-08  25%  346 aa  GRAS_STAEQ RecName: Full=Sensor histidine kinase graS;       
    3::128     5e-08  36%  353 aa  CHEB_PELCD RecName: Full=Chemotaxis response regulator
    7::116     5e-08  38%  363 aa  CHEB2_ACIBL RecName: Full=Chemotaxis response regulator
  316::513     6e-08  27%  534 aa  LOVHK_PSE14 RecName: Full=Blue-light-activated protein;Includes:
    2::118     6e-08  26%  224 aa  GRAR_STAAW RecName: Full=Response regulator protein graR;AltName:
    2::118     6e-08  26%  224 aa  GRAR_STAAT RecName: Full=Response regulator protein graR;AltName:
    2::118     6e-08  26%  224 aa  GRAR_STAAS RecName: Full=Response regulator protein graR;AltName:
    2::118     6e-08  26%  224 aa  GRAR_STAAR RecName: Full=Response regulator protein graR;AltName:
    2::118     6e-08  26%  224 aa  GRAR_STAAN RecName: Full=Response regulator protein graR;AltName:
    2::118     6e-08  26%  224 aa  GRAR_STAAM RecName: Full=Response regulator protein graR;AltName:
    2::118     6e-08  26%  224 aa  GRAR_STAAE RecName: Full=Response regulator protein graR;AltName:
    2::118     6e-08  26%  224 aa  GRAR_STAAC RecName: Full=Response regulator protein graR;AltName:
    2::118     6e-08  26%  224 aa  GRAR_STAAB RecName: Full=Response regulator protein graR;AltName:
    2::118     6e-08  26%  224 aa  GRAR_STAA9 RecName: Full=Response regulator protein graR;AltName:
    2::118     6e-08  26%  224 aa  GRAR_STAA8 RecName: Full=Response regulator protein graR;AltName:
    2::118     6e-08  26%  224 aa  GRAR_STAA3 RecName: Full=Response regulator protein graR;AltName:
    2::118     6e-08  26%  224 aa  GRAR_STAA2 RecName: Full=Response regulator protein graR;AltName:
    2::118     6e-08  26%  224 aa  GRAR_STAA1 RecName: Full=Response regulator protein graR;AltName:
   10::116     6e-08  30%  448 aa  ALGB_PSESM RecName: Full=Alginate biosynthesis transcriptional
    6::117     8e-08  31%  474 aa  NTRXL_RICCN RecName: Full=Putative response regulator ntrX-like;
   18::136     8e-08  28%  592 aa  ARR21_ARATH RecName: Full=Putative two-component response regulator
   10::116     8e-08  30%  448 aa  ALGB_PSEPK RecName: Full=Alginate biosynthesis transcriptional
    3::111     1e-07  31%  207 aa  TRPO_PSEAE RecName: Full=Putative transcriptional regulator;
   28::116     1e-07  33%  263 aa  SP0A_BACSH RecName: Full=Stage 0 sporulation protein A;
   32::121     1e-07  31%  210 aa  FIMZ_SALTY RecName: Full=Fimbriae Z protein;
    4::115     1e-07  34%  228 aa  DCTR_BACME RecName: Full=Probable C4-dicarboxylate response
  519::616     1e-07  40%  621 aa  DCTB_RHIME RecName: Full=C4-dicarboxylate transport sensor protein
    3::111     1e-07  32%  230 aa  CITT_BACHD RecName: Full=Transcriptional regulatory protein citT;
    7::118     1e-07  36%  363 aa  CHEB3_RHOPA RecName: Full=Chemotaxis response regulator
   10::132     1e-07  38%  362 aa  CHEB1_GEOSL RecName: Full=Chemotaxis response regulator
    2::128     1e-07  31%  635 aa  ARR18_ARATH RecName: Full=Two-component response regulator ARR18;
  879::1103    1e-07  28% 1130 aa  PHYB_SOLTU RecName: Full=Phytochrome B;
  218::445     1e-07  27%  511 aa  MPRB_MYCUA RecName: Full=Signal transduction histidine-protein
  218::460     1e-07  25%  504 aa  MPRB_MYCTU RecName: Full=Signal transduction histidine-protein
  218::460     1e-07  25%  504 aa  MPRB_MYCTA RecName: Full=Signal transduction histidine-protein
  258::503     1e-07  26%  505 aa  FIXL_BRAJA RecName: Full=Sensor protein fixL;         EC=2.7.13.3;
    5::119     1e-07  37%  365 aa  CHEB_METMP RecName: Full=Chemotaxis response regulator
   10::112     1e-07  40%  392 aa  CHEB_DESHY RecName: Full=Chemotaxis response regulator
   14::136     1e-07  33%  360 aa  CHEB3_BURTA RecName: Full=Chemotaxis response regulator
   19::122     1e-07  33%  366 aa  CHEB2_RHOSH RecName: Full=Chemotaxis response regulator
   18::121     1e-07  33%  365 aa  CHEB2_RHOS4 RecName: Full=Chemotaxis response regulator
   10::116     1e-07  30%  449 aa  ALGB_PSEAE RecName: Full=Alginate biosynthesis transcriptional
   12::122     2e-07  30%  135 aa  Y2151_LEPIN RecName: Full=Uncharacterized protein LA_2151;AltName:
   12::122     2e-07  30%  135 aa  Y1769_LEPIC RecName: Full=Uncharacterized protein LIC_11769;
  234::472     2e-07  21%  497 aa  SILS_SALTY RecName: Full=Probable sensor kinase silS;       
   11::132     2e-07  25%  147 aa  RCP1_SYNY3 RecName: Full=Response regulator rcp1;
  901::1100    2e-07  25% 1131 aa  PHY_PINSY RecName: Full=Phytochrome;
  218::460     2e-07  25%  504 aa  MPRB_MYCBP RecName: Full=Signal transduction histidine-protein
  218::460     2e-07  25%  504 aa  MPRB_MYCBO RecName: Full=Signal transduction histidine-protein
  107::336     2e-07  25%  346 aa  GRAS_STAAR RecName: Full=Sensor histidine kinase graS;       
    2::112     2e-07  38%  403 aa  CHEB_TREPA RecName: Full=Chemotaxis response regulator
    3::109     2e-07  35%  379 aa  CHEB_PSEA6 RecName: Full=Chemotaxis response regulator
   10::112     2e-07  42%  357 aa  CHEB5_GEOMG RecName: Full=Chemotaxis response regulator
   18::122     2e-07  41%  387 aa  CHEB1_RHORT RecName: Full=Chemotaxis response regulator
    5::141     2e-07  25%  206 aa  ARR7_ARATH RecName: Full=Two-component response regulator ARR7;
    8::118     2e-07  36%  482 aa  HOXA_RALEH RecName: Full=Hydrogenase transcriptional regulatory
  240::315     2e-07  41%  370 aa  GTCS_ANEMI RecName: Full=Sensor protein gtcS;         EC=2.7.13.3;
   10::112     2e-07  31%  357 aa  CHEB1_METMA RecName: Full=Chemotaxis response regulator
  545::643     3e-07  36%  655 aa  Y3689_SHEFN RecName: Full=Putative sensor protein Sfri_3689;       
  941::1152    3e-07  26% 1171 aa  PHYB_ORYSJ RecName: Full=Phytochrome B;
  880::1104    3e-07  28% 1131 aa  PHYB1_SOLLC RecName: Full=Phytochrome B1;
  190::347     3e-07  29%  350 aa  NTRB_VIBAL RecName: Full=Nitrogen regulation protein ntrB;       
   64::118     3e-07  40%  225 aa  KDPE_ECOLI RecName: Full=KDP operon transcriptional regulatory
    8::130     3e-07  30%  230 aa  DCTR_BACHD RecName: Full=Probable C4-dicarboxylate response
    3::113     3e-07  31%  362 aa  CHEB_SYMTH RecName: Full=Chemotaxis response regulator
    5::109     3e-07  36%  345 aa  CHEB_CLOAB RecName: Full=Chemotaxis response regulator
    6::124     3e-07  34%  346 aa  CHEB_BACHD RecName: Full=Chemotaxis response regulator
   14::124     3e-07  38%  381 aa  CHEB1_MAGSA RecName: Full=Chemotaxis response regulator
   23::116     4e-07  37%  214 aa  YHCZ_BACSU RecName: Full=Uncharacterized transcriptional regulatory
   33::109     4e-07  38%  233 aa  PRRA_MYCLE RecName: Full=Transcriptional regulatory protein prrA;
  941::1152    4e-07  26% 1171 aa  PHYB_ORYSI RecName: Full=Phytochrome B;
  234::346     4e-07  36%  349 aa  NTRB_KLEOX RecName: Full=Nitrogen regulation protein ntrB;       
  219::464     4e-07  26%  515 aa  MPRB_MYCSS RecName: Full=Signal transduction histidine-protein
  219::464     4e-07  26%  515 aa  MPRB_MYCSK RecName: Full=Signal transduction histidine-protein
  219::464     4e-07  26%  515 aa  MPRB_MYCSJ RecName: Full=Signal transduction histidine-protein
  643::763     4e-07  30%  773 aa  ETR2_ARATH RecName: Full=Ethylene receptor 2;         Short=AtETR2;
   11::125     4e-07  27%  236 aa  DEGU_BREBE RecName: Full=Transcriptional regulatory protein degU;
    1::109     4e-07  35%  364 aa  CHEB_DESPS RecName: Full=Chemotaxis response regulator
  201::417     5e-07  25%  447 aa  VANS_ENTFA RecName: Full=Sensor protein vanSB;       
    4::101     5e-07  37%  239 aa  RSTA_ECOLI RecName: Full=Transcriptional regulatory protein rstA;
   46::118     5e-07  32%  223 aa  PHOP_SHIFL RecName: Full=Virulence transcriptional regulatory
   46::118     5e-07  32%  223 aa  PHOP_ECOLI RecName: Full=Transcriptional regulatory protein phoP;
   46::118     5e-07  32%  223 aa  PHOP_ECOL6 RecName: Full=Transcriptional regulatory protein phoP;
   16::118     5e-07  32%  478 aa  NTRXL_RICBR RecName: Full=Putative response regulator ntrX-like;
    3::120     5e-07  30%  229 aa  NISR_LACLA RecName: Full=Nisin biosynthesis regulatory protein
   10::129     5e-07  30%  341 aa  EHD1_ORYSJ RecName: Full=Two-component response regulator
   10::129     5e-07  30%  341 aa  EHD1_ORYSI RecName: Full=Two-component response regulator
  392::532     5e-07  27%  535 aa  DCTS_BACSU RecName: Full=Probable C4-dicarboxylate sensor kinase;  
    9::112     5e-07  41%  368 aa  CHEB_PYRAB RecName: Full=Chemotaxis response regulator
    1::108     5e-07  35%  352 aa  CHEB_OCEIH RecName: Full=Chemotaxis response regulator
    3::106     5e-07  39%  365 aa  CHEB1_SACD2 RecName: Full=Chemotaxis response regulator
   31::149     5e-07  29%  164 aa  ARR16_ARATH RecName: Full=Two-component response regulator ARR16;
    4::117     7e-07  27%  241 aa  VIRG_AGRRH RecName: Full=Regulatory protein virG;
   33::109     7e-07  36%  233 aa  PRRA_MYCTU RecName: Full=Transcriptional regulatory protein prrA;
   33::109     7e-07  36%  233 aa  PRRA_MYCBO RecName: Full=Transcriptional regulatory protein prrA;
  222::461     7e-07  26%  487 aa  PHOQ_SALTY RecName: Full=Virulence sensor histidine kinase phoQ;   
  222::461     7e-07  26%  487 aa  PHOQ_SALTI RecName: Full=Virulence sensor histidine kinase phoQ;   
  222::461     7e-07  26%  487 aa  PHOQ_SALPA RecName: Full=Virulence sensor histidine kinase phoQ;   
  222::461     7e-07  26%  487 aa  PHOQ_SALCH RecName: Full=Virulence sensor histidine kinase phoQ;   
    5::111     7e-07  31%  457 aa  NTRC_RHOCA RecName: Full=Nitrogen regulation protein ntrC;
   49::121     7e-07  29%  229 aa  CREB_ECOLI RecName: Full=Transcriptional regulatory protein creB;
   13::131     7e-07  35%  362 aa  CHEB5_ANADE RecName: Full=Chemotaxis response regulator
    7::118     7e-07  35%  363 aa  CHEB3_BRAJA RecName: Full=Chemotaxis response regulator
   39::157     7e-07  28%  426 aa  ARR20_ARATH RecName: Full=Putative two-component response regulator
    3::118     9e-07  27%  229 aa  YXDJ_BACSU RecName: Full=Transcriptional regulatory protein yxdJ;
    4::115     9e-07  26%  122 aa  SP0F_BACTK RecName: Full=Sporulation initiation phosphotransferase
  988::1165    9e-07  30% 1172 aa  PHYB_ARATH RecName: Full=Phytochrome B;
  234::346     9e-07  36%  349 aa  NTRB_SALTY RecName: Full=Nitrogen regulation protein NR(II);       
  234::346     9e-07  36%  349 aa  NTRB_SALTI RecName: Full=Nitrogen regulation protein NR(II);       
  316::513     9e-07  28%  534 aa  LOVHK_PSESM RecName: Full=Blue-light-activated protein;Includes:
  174::413     9e-07  29%  414 aa  CUTS_STRLI RecName: Full=Sensor protein cutS;         EC=2.7.13.3;
  174::413     9e-07  29%  414 aa  CUTS_STRCO RecName: Full=Sensor protein cutS;         EC=2.7.13.3;
  267::451     9e-07  28%  507 aa  CSEC_STRCO RecName: Full=Sensor protein cseC;         EC=2.7.13.3;
   31::132     1e-06  29%  274 aa  SP0A_CLODI RecName: Full=Stage 0 sporulation protein A homolog;
 1004::1163    1e-06  28% 1178 aa  PHYB_SORBI RecName: Full=Phytochrome B;
   46::118     1e-06  32%  223 aa  PHOP_ECO57 RecName: Full=Transcriptional regulatory protein phoP;
  249::453     1e-06  26%  487 aa  CSEC_STRAW RecName: Full=Sensor protein cseC;         EC=2.7.13.3;
  207::294     1e-06  32%  303 aa  CHEV_BACSU RecName: Full=Chemotaxis protein cheV;
    7::110     1e-06  35%  344 aa  CHEB_THEMA RecName: Full=Chemotaxis response regulator
    6::109     1e-06  31%  350 aa  CHEB1_DECAR RecName: Full=Chemotaxis response regulator
    5::110     1e-06  35%  344 aa  CHEB1_CAUCR RecName: Full=Chemotaxis response regulator
    4::119     1e-06  28%  340 aa  CHEB1_CARHZ RecName: Full=Chemotaxis response regulator
  234::346     1e-06  36%  349 aa  NTRB_SHIFL RecName: Full=Nitrogen regulation protein NR(II);       
  234::346     1e-06  36%  349 aa  NTRB_ECOLI RecName: Full=Nitrogen regulation protein NR(II);       
  234::346     1e-06  36%  349 aa  NTRB_ECO57 RecName: Full=Nitrogen regulation protein NR(II);       
    3::120     1e-06  33%  241 aa  LYTT_BACSU RecName: Full=Sensory transduction protein lytT;
  102::329     1e-06  22%  344 aa  GRAS_STAHJ RecName: Full=Sensor histidine kinase graS;       
  369::437     1e-06  35%  450 aa  ENVZ_SHIFL RecName: Full=Osmolarity sensor protein envZ;       
  369::437     1e-06  35%  450 aa  ENVZ_ECOLI RecName: Full=Osmolarity sensor protein envZ;       
  214::424     1e-06  28%  487 aa  COPS_PSESM RecName: Full=Sensor protein copS;         EC=2.7.13.3;
    3::109     1e-06  35%  367 aa  CHEB_THETN RecName: Full=Chemotaxis response regulator
    4::107     1e-06  33%  352 aa  CHEB_SULDN RecName: Full=Chemotaxis response regulator
   18::126     1e-06  34%  425 aa  CHEB_NITWN RecName: Full=Chemotaxis response regulator
   47::119     2e-06  29%  224 aa  PHOP_SALTY RecName: Full=Virulence transcriptional regulatory
   47::119     2e-06  29%  224 aa  PHOP_SALTI RecName: Full=Virulence transcriptional regulatory
   47::119     2e-06  29%  224 aa  PHOP_SALPA RecName: Full=Virulence transcriptional regulatory
    5::111     2e-06  40%  355 aa  CHEB_PYRKO RecName: Full=Chemotaxis response regulator
    9::112     2e-06  40%  368 aa  CHEB_PYRHO RecName: Full=Chemotaxis response regulator
    6::109     2e-06  36%  347 aa  CHEB1_RHIEC RecName: Full=Probable chemotaxis response regulator
    7::116     2e-06  30%  357 aa  CHEB1_LEPIN RecName: Full=Chemotaxis response regulator
    7::116     2e-06  30%  357 aa  CHEB1_LEPIC RecName: Full=Chemotaxis response regulator
    2::120     2e-06  26%  231 aa  BCER_BACSU RecName: Full=Sensory transduction protein bceR;
    4::116     3e-06  33%  218 aa  UVRY_SHIFL RecName: Full=Response regulator uvrY;
    4::116     3e-06  33%  218 aa  UVRY_ECOLI RecName: Full=Response regulator uvrY;
    8::122     3e-06  30%  281 aa  SP0A_CLOAB RecName: Full=Stage 0 sporulation protein A homolog;
  316::513     3e-06  26%  534 aa  LOVHK_PSEU2 RecName: Full=Blue-light-activated protein;Includes:
  389::496     3e-06  33%  505 aa  FIXL_RHIME RecName: Full=Sensor protein fixL;         EC=2.7.13.3;
    4::110     3e-06  31%  129 aa  CHEY_YEREN RecName: Full=Chemotaxis protein cheY;
   73::145     3e-06  26%  206 aa  ARR15_ARATH RecName: Full=Two-component response regulator ARR15;
   32::113     3e-06  34%  444 aa  YFHA_ECOLI RecName: Full=Uncharacterized protein yfhA;AltName:
   32::113     3e-06  34%  444 aa  YFHA_ECO57 RecName: Full=Uncharacterized protein yfhA;
  215::430     3e-06  26%  449 aa  QSEC_SALTY RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  215::430     3e-06  26%  449 aa  QSEC_SALTI RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  282::521     3e-06  22%  530 aa  PILS_PSEAE RecName: Full=Sensor protein pilS;         EC=2.7.13.3;
  623::768     3e-06  32%  777 aa  NTRY_AZOBR RecName: Full=Nitrogen regulation protein ntrY homolog; 
  362::536     3e-06  28%  538 aa  CITS_BACHD RecName: Full=Sensor protein citS;         EC=2.7.13.3;
    1::116     3e-06  26%  358 aa  CHEB_NITEU RecName: Full=Chemotaxis response regulator
    3::105     3e-06  40%  357 aa  CHEB_LAWIP RecName: Full=Chemotaxis response regulator
    5::105     3e-06  38%  347 aa  CHEB_HALSA RecName: Full=Chemotaxis response regulator
    6::109     3e-06  35%  347 aa  CHEB1_RHIL3 RecName: Full=Chemotaxis response regulator
   55::121     4e-06  33%  210 aa  YCF29_CYAPA RecName: Full=Probable transcriptional regulator ycf29;
  272::452     4e-06  27%  486 aa  PHOQ_SHIFL RecName: Full=Virulence sensor protein phoQ;       
  272::452     4e-06  27%  486 aa  PHOQ_ECOLI RecName: Full=Sensor protein phoQ;         EC=2.7.13.3;
  272::452     4e-06  27%  486 aa  PHOQ_ECOL6 RecName: Full=Sensor protein phoQ;         EC=2.7.13.3;
  425::528     4e-06  33%  532 aa  DCTS_BACHD RecName: Full=Probable C4-dicarboxylate sensor kinase;  
   20::124     4e-06  34%  388 aa  CHEB_RHOP2 RecName: Full=Chemotaxis response regulator
    4::109     4e-06  36%  386 aa  CHEB_IDILO RecName: Full=Chemotaxis response regulator
   11::120     4e-06  30%  369 aa  CHEB3_RHOSH RecName: Full=Chemotaxis response regulator
    5::120     4e-06  30%  236 aa  ARCA_HAEIN RecName: Full=Aerobic respiration control protein arcA
  272::452     6e-06  27%  486 aa  PHOQ_ECO57 RecName: Full=Sensor protein phoQ;         EC=2.7.13.3;
    3::120     6e-06  32%  246 aa  LYTT_BACCR RecName: Full=Sensory transduction protein lytT;
    7::124     6e-06  30%  485 aa  HOXA_BRAJA RecName: Full=Hydrogenase transcriptional regulatory
    3::105     6e-06  36%  366 aa  CHEB_SALRD RecName: Full=Chemotaxis response regulator
    3::105     6e-06  41%  349 aa  CHEB3_HAHCH RecName: Full=Chemotaxis response regulator
    2::104     6e-06  35%  349 aa  CHEB1_METAC RecName: Full=Chemotaxis response regulator
    3::114     7e-06  32%  213 aa  YDFI_BACSU RecName: Full=Transcriptional regulatory protein ydfI;
    2::116     7e-06  24%  226 aa  Y4XI_RHISN RecName: Full=Probable transcriptional regulatory
    8::122     7e-06  29%  273 aa  SP0A_CLOPA RecName: Full=Stage 0 sporulation protein A homolog;
    9::103     7e-06  44%  237 aa  PETR_RHOCA RecName: Full=Protein petR;
  227::350     7e-06  33%  356 aa  NTRB_RHOCA RecName: Full=Nitrogen regulation protein ntrB;       
  233::363     7e-06  31%  383 aa  NTRB_RHILP RecName: Full=Nitrogen regulation protein ntrB;       
  230::336     7e-06  30%  346 aa  GRAS_STAAW RecName: Full=Sensor histidine kinase graS;       
  230::336     7e-06  30%  346 aa  GRAS_STAAT RecName: Full=Sensor histidine kinase graS;       
  230::336     7e-06  30%  346 aa  GRAS_STAAS RecName: Full=Sensor histidine kinase graS;       
  230::336     7e-06  30%  346 aa  GRAS_STAAN RecName: Full=Sensor histidine kinase graS;       
  230::336     7e-06  30%  346 aa  GRAS_STAAM RecName: Full=Sensor histidine kinase graS;       
  230::336     7e-06  30%  346 aa  GRAS_STAAE RecName: Full=Sensor histidine kinase graS;       
  230::336     7e-06  30%  346 aa  GRAS_STAAC RecName: Full=Sensor histidine kinase graS;       
  230::336     7e-06  30%  346 aa  GRAS_STAAB RecName: Full=Sensor histidine kinase graS;       
  230::336     7e-06  30%  346 aa  GRAS_STAA9 RecName: Full=Sensor histidine kinase graS;       
  230::336     7e-06  30%  346 aa  GRAS_STAA8 RecName: Full=Sensor histidine kinase graS;       
  230::336     7e-06  30%  346 aa  GRAS_STAA3 RecName: Full=Sensor histidine kinase graS;       
  230::336     7e-06  30%  346 aa  GRAS_STAA2 RecName: Full=Sensor histidine kinase graS;       
  230::336     7e-06  30%  346 aa  GRAS_STAA1 RecName: Full=Sensor histidine kinase graS;       
    3::110     7e-06  34%  129 aa  CHEY_ECOL6 RecName: Full=Chemotaxis protein cheY;
    4::107     7e-06  29%  356 aa  CHEB_THIDA RecName: Full=Chemotaxis response regulator
    5::109     7e-06  34%  355 aa  CHEB_NATPD RecName: Full=Chemotaxis response regulator
   35::112     7e-06  28%  350 aa  CHEB6_ANADE RecName: Full=Chemotaxis response regulator
   10::115     7e-06  29%  359 aa  CHEB3_CHRVO RecName: Full=Chemotaxis response regulator
    3::108     7e-06  30%  365 aa  CHEB2_RHIL3 RecName: Full=Chemotaxis response regulator
   11::120     7e-06  30%  369 aa  CHEB1_RHOS4 RecName: Full=Chemotaxis response regulator
    3::107     7e-06  37%  369 aa  CHEB1_DESDG RecName: Full=Chemotaxis response regulator
    2::102     7e-06  28%  222 aa  BASR_SALTY RecName: Full=Transcriptional regulatory protein basR;
    2::102     7e-06  28%  222 aa  BASR_ECOLI RecName: Full=Transcriptional regulatory protein basR;
    4::116     1e-05  32%  218 aa  UVRY_ECOL6 RecName: Full=Response regulator uvrY;
    4::116     1e-05  32%  218 aa  UVRY_ECO57 RecName: Full=Response regulator uvrY;
  236::346     1e-05  35%  348 aa  NTRB_PROVU RecName: Full=Nitrogen regulation protein NR(II);       
    3::120     1e-05  30%  246 aa  LYTT_BACAN RecName: Full=Sensory transduction protein lytT;
  401::502     1e-05  27%  506 aa  KIND_BACSU RecName: Full=Sporulation kinase D;       
  434::539     1e-05  33%  547 aa  CITA_KLEPN RecName: Full=Sensor kinase citA;         EC=2.7.13.3;
   16::121     1e-05  34%  375 aa  CHEB_ROSDO RecName: Full=Chemotaxis response regulator
    4::107     1e-05  37%  367 aa  CHEB2_DESVH RecName: Full=Chemotaxis response regulator
    6::109     1e-05  31%  356 aa  CHEB2_DESDG RecName: Full=Chemotaxis response regulator
   20::124     1e-05  33%  389 aa  CHEB1_RHOPB RecName: Full=Chemotaxis response regulator
    4::113     1e-05  25%  209 aa  BVGA_BORPE RecName: Full=Virulence factors putative positive
    4::113     1e-05  25%  209 aa  BVGA_BORPA RecName: Full=Virulence factors putative positive
    4::113     1e-05  25%  209 aa  BVGA_BORBR RecName: Full=Virulence factors putative positive
  878::1102    1e-05  26% 1135 aa  PHYC_SORBI RecName: Full=Phytochrome C;
  231::360     1e-05  31%  377 aa  NTRB_BRASR RecName: Full=Nitrogen regulation protein ntrB;       
    7::121     1e-05  30%  215 aa  NARP_ECOLI RecName: Full=Nitrate/nitrite response regulator protein
    3::104     1e-05  36%  211 aa  LIAR_BACSU RecName: Full=Transcriptional regulatory protein liaR;
  164::367     1e-05  21%  373 aa  DEGM_BACB2 RecName: Full=Sensor protein degM;         EC=2.7.13.3;
    4::110     1e-05  30%  129 aa  CHEY_YERPE RecName: Full=Chemotaxis protein cheY;
    3::110     1e-05  32%  129 aa  CHEY_SALTY RecName: Full=Chemotaxis protein cheY;
    3::110     1e-05  32%  129 aa  CHEY_SALTI RecName: Full=Chemotaxis protein cheY;
    3::106     1e-05  31%  353 aa  CHEB3_SYNWW RecName: Full=Chemotaxis response regulator
    3::81      1e-05  40%  350 aa  CHEB2_METHJ RecName: Full=Chemotaxis response regulator
    7::113     1e-05  32%  361 aa  CHEB1_HAHCH RecName: Full=Chemotaxis response regulator
    3::111     1e-05  31%  120 aa  CCDB_BACSU RecName: Full=Protein ccdB;
  611::724     1e-05  29%  728 aa  BPHY_PSEAE RecName: Full=Bacteriophytochrome;       
   24::136     1e-05  37%  142 aa  ARR22_ARATH RecName: Full=Two-component response regulator ARR22;
    4::109     2e-05  30%  229 aa  SAER_STAES RecName: Full=Response regulator saeR;
    4::109     2e-05  30%  229 aa  SAER_STAEQ RecName: Full=Response regulator saeR;
    3::117     2e-05  29%  214 aa  GACA_PSEU2 RecName: Full=Response regulator gacA;AltName:
    1::121     2e-05  22%  210 aa  FIMZ_ECOLI RecName: Full=Fimbriae Z protein;
    1::121     2e-05  22%  210 aa  FIMZ_ECO57 RecName: Full=Fimbriae Z protein;
  369::437     2e-05  32%  450 aa  ENVZ_SALTY RecName: Full=Osmolarity sensor protein envZ;       
  369::437     2e-05  32%  450 aa  ENVZ_SALTI RecName: Full=Osmolarity sensor protein envZ;       
    3::110     2e-05  33%  129 aa  CHEY_SHIFL RecName: Full=Chemotaxis protein cheY;
    2::123     2e-05  26%  124 aa  CHEY_PSEAE RecName: Full=Chemotaxis protein cheY;
    3::110     2e-05  33%  129 aa  CHEY_ENTCL RecName: Full=Chemotaxis protein cheY;
    3::110     2e-05  33%  129 aa  CHEY_ECOLI RecName: Full=Chemotaxis protein cheY;
    3::110     2e-05  33%  129 aa  CHEY_ECO57 RecName: Full=Chemotaxis protein cheY;
   20::124     2e-05  32%  385 aa  CHEB_RHOPS RecName: Full=Chemotaxis response regulator
    1::121     2e-05  33%  354 aa  CHEB2_GEOSL RecName: Full=Chemotaxis response regulator
    3::107     2e-05  35%  350 aa  CHEB1_SYNAS RecName: Full=Chemotaxis response regulator
    9::119     2e-05  28%  373 aa  CHEB1_RHOFD RecName: Full=Chemotaxis response regulator
    6::109     2e-05  34%  349 aa  CHEB1_RHIME RecName: Full=Chemotaxis response regulator
   89::316     2e-05  23%  325 aa  YXDK_BACSU RecName: Full=Sensor histidine kinase yxdK;       
   22::128     2e-05  29%  227 aa  NODW_BRAJA RecName: Full=Nodulation protein W;
  502::619     2e-05  35%  622 aa  DCTB_RHILE RecName: Full=C4-dicarboxylate transport sensor protein
    4::106     2e-05  37%  398 aa  CHEB_SHEFN RecName: Full=Chemotaxis response regulator
   20::124     2e-05  33%  381 aa  CHEB_NITHX RecName: Full=Chemotaxis response regulator
   20::124     2e-05  30%  391 aa  CHEB2_RHOPA RecName: Full=Chemotaxis response regulator
    3::120     3e-05  28%  233 aa  YCCH_BACSU RecName: Full=Uncharacterized transcriptional regulatory
   15::124     3e-05  26%  184 aa  REGA_RHOCA RecName: Full=Photosynthetic apparatus regulatory
  674::847     3e-05  28% 1121 aa  PKHA7_HUMAN RecName: Full=Pleckstrin homology domain-containing
   48::110     3e-05  35%  235 aa  MALR_BACSU RecName: Full=Transcriptional regulatory protein
    2::106     3e-05  29%  246 aa  LYTR_STRA5 RecName: Full=Sensory transduction protein lytR;
    2::106     3e-05  29%  246 aa  LYTR_STRA3 RecName: Full=Sensory transduction protein lytR;
    2::116     3e-05  27%  205 aa  FIXJ_BRAJA RecName: Full=Transcriptional regulatory protein fixJ;
    6::119     3e-05  25%  229 aa  DEGU_BACSU RecName: Full=Transcriptional regulatory protein
    4::107     3e-05  22%  355 aa  CHEB_METFK RecName: Full=Chemotaxis response regulator
    3::113     3e-05  25%  342 aa  CHEB1_METHJ RecName: Full=Chemotaxis response regulator
  138::249     4e-05  28%  692 aa  YPH5_THIVI RecName: Full=Uncharacterized 76.5 kDa protein in phbC
   12::148     4e-05  27%  267 aa  VIRG_RHIRD RecName: Full=Regulatory protein virG;
  343::443     4e-05  37%  446 aa  PFES_PSEAE RecName: Full=Sensor protein pfeS;         EC=2.7.13.3;
   31::117     4e-05  28%  213 aa  GACA_PSEFL RecName: Full=Response regulator gacA;AltName:
    6::109     4e-05  37%  424 aa  CHEB_MOOTA RecName: Full=Chemotaxis response regulator
   12::148     5e-05  29%  267 aa  VIRG_AGRT9 RecName: Full=Regulatory protein virG;
  369::469     5e-05  30%  539 aa  PRR1_SCHPO RecName: Full=Transcription factor prr1;AltName:
  600::718     5e-05  30%  771 aa  NTRY_AZOC5 RecName: Full=Nitrogen regulation protein ntrY;       
    3::116     5e-05  30%  214 aa  GACA_PSEAE RecName: Full=Response regulator gacA;AltName:
  171::360     5e-05  24%  395 aa  DLTS_STRA5 RecName: Full=Sensor protein dltS;         EC=2.7.13.3;
  704::785     5e-05  26% 2123 aa  CYAD_DICDI RecName: Full=Adenylate cyclase,
    7::110     5e-05  25%  354 aa  CHEB_CHRSD RecName: Full=Chemotaxis response regulator
   40::109     5e-05  41%  355 aa  CHEB3_MAGSA RecName: Full=Chemotaxis response regulator
    1::121     5e-05  33%  355 aa  CHEB3_GEOMG RecName: Full=Chemotaxis response regulator
  992::1137    6e-05  24% 1164 aa  PHYD_ARATH RecName: Full=Phytochrome D;
  381::604     6e-05  33%  606 aa  KINA_BACSU RecName: Full=Sporulation kinase A;       
    7::110     6e-05  34%  364 aa  CHEB3_RHOPB RecName: Full=Chemotaxis response regulator
    3::109     6e-05  25%  364 aa  CHEB1_BURTA RecName: Full=Chemotaxis response regulator
    6::112     6e-05  25%  367 aa  CHEB1_BURPS RecName: Full=Chemotaxis response regulator
    3::109     6e-05  25%  364 aa  CHEB1_BURP1 RecName: Full=Chemotaxis response regulator
    3::109     6e-05  25%  364 aa  CHEB1_BURMA RecName: Full=Chemotaxis response regulator
   75::123     8e-05  37%  208 aa  YCF29_GUITH RecName: Full=Probable transcriptional regulator ycf29;
    3::105     8e-05  33%  370 aa  CHEB3_RHORT RecName: Full=Chemotaxis response regulator
    2::68      8e-05  42%  336 aa  CHEB3_PSESM RecName: Full=Chemotaxis response regulator
   35::116     1e-04  34%  261 aa  Y0G0_VIBCH RecName: Full=Uncharacterized response regulatory
  274::370     1e-04  26%  662 aa  MCPB_BACSU RecName: Full=Methyl-accepting chemotaxis protein
  462::524     1e-04  40%  533 aa  MALK_BACSU RecName: Full=Sensor histidine kinase malK;       
    8::111     1e-04  29%  381 aa  CHEB_RALSO RecName: Full=Chemotaxis response regulator
    4::70      1e-04  43%  391 aa  CHEB_PSEHT RecName: Full=Chemotaxis response regulator
    4::110     1e-04  32%  355 aa  CHEB_NITMU RecName: Full=Chemotaxis response regulator
    2::68      1e-04  42%  336 aa  CHEB3_PSE14 RecName: Full=Chemotaxis response regulator
    2::68      1e-04  42%  336 aa  CHEB2_PSEU2 RecName: Full=Chemotaxis response regulator
    3::107     1e-04  29%  354 aa  CHEB2_BURTA RecName: Full=Chemotaxis response regulator
    1::108     1e-04  24%  351 aa  CHEB2_BORA1 RecName: Full=Chemotaxis response regulator
    3::112     1e-04  29%  220 aa  YFIK_BACSU RecName: Full=Uncharacterized transcriptional regulatory
  361::476     1e-04  21%  485 aa  NUF2_CANAL RecName: Full=Probable kinetochore protein NUF2;
    6::119     1e-04  27%  208 aa  NARP_HAEIN RecName: Full=Nitrate/nitrite response regulator protein
    3::106     1e-04  28%  244 aa  LYTR_STRMU RecName: Full=Sensory transduction protein lytR;
   49::117     1e-04  30%  214 aa  GACA_PSEVI RecName: Full=Response regulator gacA;AltName:
  171::360     1e-04  24%  395 aa  DLTS_STRA3 RecName: Full=Sensor protein dltS;         EC=2.7.13.3;
    2::106     1e-04  34%  354 aa  CHEB_NOSP7 RecName: Full=Chemotaxis response regulator
    1::108     1e-04  35%  349 aa  CHEB_GEOKA RecName: Full=Chemotaxis response regulator
    1::108     1e-04  24%  350 aa  CHEB_BORPE RecName: Full=Chemotaxis response regulator
    1::108     1e-04  24%  350 aa  CHEB_BORPA RecName: Full=Chemotaxis response regulator
    1::108     1e-04  24%  350 aa  CHEB_BORBR RecName: Full=Chemotaxis response regulator
    2::68      1e-04  47%  335 aa  CHEB3_PSEAE RecName: Full=Chemotaxis response regulator
    8::111     1e-04  37%  358 aa  CHEB2_XANC8 RecName: Full=Chemotaxis response regulator
    3::110     1e-04  34%  341 aa  CHEB2_SYNWW RecName: Full=Chemotaxis response regulator
    8::111     1e-04  37%  358 aa  CHEB1_XANCP RecName: Full=Chemotaxis response regulator
    5::116     1e-04  35%  359 aa  CHEB1_CHRVO RecName: Full=Chemotaxis response regulator
  325::485     1e-04  30%  618 aa  CHEA_LISMO RecName: Full=Chemotaxis protein cheA;       
    3::137     1e-04  25%  407 aa  ARR19_ARATH RecName: Full=Putative two-component response regulator
   18::139     1e-04  29%  572 aa  ARR13_ARATH RecName: Full=Putative two-component response regulator
    2::118     2e-04  27%  222 aa  PMRA_PECCC RecName: Full=Transcriptional regulatory protein pmrA;
  671::803     2e-04  31% 1118 aa  PKHA7_MOUSE RecName: Full=Pleckstrin homology domain-containing
   37::115     2e-04  29%  197 aa  DCTR_RHOCA RecName: Full=C4-dicarboxylate transport transcriptional
    7::117     2e-04  29%  448 aa  DCTD_RHILE RecName: Full=C4-dicarboxylate transport transcriptional
    5::108     2e-04  30%  376 aa  CHEB_THICR RecName: Full=Chemotaxis response regulator
    2::104     2e-04  33%  358 aa  CHEB3_VIBCH RecName: Full=Chemotaxis response regulator
    8::111     2e-04  36%  358 aa  CHEB2_XANOR RecName: Full=Chemotaxis response regulator
    8::111     2e-04  36%  358 aa  CHEB2_XANOM RecName: Full=Chemotaxis response regulator
    7::110     2e-04  28%  356 aa  CHEB2_RALEJ RecName: Full=Chemotaxis response regulator
   21::125     2e-04  35%  397 aa  CHEB2_BRAJA RecName: Full=Chemotaxis response regulator
    8::111     2e-04  36%  358 aa  CHEB1_XANC5 RecName: Full=Chemotaxis response regulator
    8::111     2e-04  36%  358 aa  CHEB1_XANAC RecName: Full=Chemotaxis response regulator
    9::128     2e-04  26%  345 aa  CHEB1_MYXXD RecName: Full=Chemotaxis response regulator
    6::109     2e-04  31%  357 aa  CHEB1_DESVH RecName: Full=Chemotaxis response regulator
   42::198     2e-04  25%  557 aa  CPS_CLOTH RecName: Full=Putative sensory transducer protein;
    5::108     2e-04  24%  349 aa  CHEB_SHISS RecName: Full=Chemotaxis response regulator
    5::108     2e-04  24%  349 aa  CHEB_SHIFL RecName: Full=Chemotaxis response regulator
    5::108     2e-04  24%  312 aa  CHEB_SHIBS RecName: Full=Chemotaxis response regulator
    5::108     2e-04  24%  349 aa  CHEB_SALTY RecName: Full=Chemotaxis response regulator
    5::108     2e-04  24%  349 aa  CHEB_SALTI RecName: Full=Chemotaxis response regulator
    5::108     2e-04  24%  349 aa  CHEB_SALPA RecName: Full=Chemotaxis response regulator
    5::108     2e-04  24%  349 aa  CHEB_SALCH RecName: Full=Chemotaxis response regulator
   16::120     2e-04  31%  401 aa  CHEB_MARMM RecName: Full=Chemotaxis response regulator
    4::108     2e-04  38%  369 aa  CHEB_HALMA RecName: Full=Chemotaxis response regulator
    5::108     2e-04  24%  350 aa  CHEB_ENTCL RecName: Full=Chemotaxis response regulator
    5::108     2e-04  24%  349 aa  CHEB_ECOUT RecName: Full=Chemotaxis response regulator
    5::108     2e-04  24%  349 aa  CHEB_ECOLI RecName: Full=Chemotaxis response regulator
    5::108     2e-04  24%  349 aa  CHEB_ECOL6 RecName: Full=Chemotaxis response regulator
    5::108     2e-04  24%  349 aa  CHEB_ECOL5 RecName: Full=Chemotaxis response regulator
    5::108     2e-04  24%  349 aa  CHEB_ECO57 RecName: Full=Chemotaxis response regulator
    4::73      2e-04  45%  394 aa  CHEB2_PHOPR RecName: Full=Chemotaxis response regulator
    2::68      2e-04  44%  336 aa  CHEB1_PSEPF RecName: Full=Chemotaxis response regulator
    5::108     2e-04  27%  360 aa  CHEB1_BURCA RecName: Full=Chemotaxis response regulator
    5::109     2e-04  33%  355 aa  CHEB1_ACIBL RecName: Full=Chemotaxis response regulator
  344::538     2e-04  23%  671 aa  CHEA_THEMA RecName: Full=Chemotaxis protein cheA;       
   15::120     3e-04  27%  184 aa  REGA_RHOS4 RecName: Full=Photosynthetic apparatus regulatory
  900::1110    3e-04  24% 1122 aa  PHYA_ARATH RecName: Full=Phytochrome A;AltName: Full=Protein FAR RED
  894::1015    3e-04  22% 1388 aa  KIF15_HUMAN RecName: Full=Kinesin-like protein KIF15;AltName:
   42::115     3e-04  27%  314 aa  GLNL_BACSU RecName: Full=Transcriptional regulatory protein glnL;
    5::108     3e-04  24%  349 aa  CHEB_YERPS RecName: Full=Chemotaxis response regulator
    5::108     3e-04  24%  349 aa  CHEB_YERPN RecName: Full=Chemotaxis response regulator
    5::108     3e-04  24%  349 aa  CHEB_YERPE RecName: Full=Chemotaxis response regulator
    5::108     3e-04  24%  349 aa  CHEB_YERPA RecName: Full=Chemotaxis response regulator
    6::108     3e-04  28%  350 aa  CHEB_PHOLL RecName: Full=Chemotaxis response regulator
    5::108     3e-04  27%  362 aa  CHEB_BURXL RecName: Full=Chemotaxis response regulator
    2::105     3e-04  31%  347 aa  CHEB2_CAUCR RecName: Full=Chemotaxis response regulator
   57::112     3e-04  38%  341 aa  CHEB2_ANADE RecName: Full=Chemotaxis response regulator
    4::105     3e-04  31%  349 aa  CHEB1_ANADE RecName: Full=Chemotaxis response regulator
    5::113     4e-04  25%  454 aa  NTRX_AZOC5 RecName: Full=Nitrogen assimilation regulatory protein
  239::348     4e-04  30%  360 aa  LIAS_BACSU RecName: Full=Sensor histidine kinase liaS;       
    2::110     4e-04  27%  232 aa  CTRA_OCHA4 RecName: Full=Cell cycle response regulator ctrA;
    2::110     4e-04  27%  232 aa  CTRA_BRUSU RecName: Full=Cell cycle response regulator ctrA;
    2::110     4e-04  27%  232 aa  CTRA_BRUSI RecName: Full=Cell cycle response regulator ctrA;
    2::110     4e-04  27%  232 aa  CTRA_BRUO2 RecName: Full=Cell cycle response regulator ctrA;
    2::110     4e-04  27%  232 aa  CTRA_BRUME RecName: Full=Cell cycle response regulator ctrA;
    2::110     4e-04  27%  232 aa  CTRA_BRUC2 RecName: Full=Cell cycle response regulator ctrA;
    2::110     4e-04  27%  232 aa  CTRA_BRUAB RecName: Full=Cell cycle response regulator ctrA;
    2::110     4e-04  27%  232 aa  CTRA_BRUA2 RecName: Full=Cell cycle response regulator ctrA;
    2::110     4e-04  27%  232 aa  CTRA_BRUA1 RecName: Full=Cell cycle response regulator ctrA;
   19::105     4e-04  36%  342 aa  CHEB4_BURTA RecName: Full=Chemotaxis response regulator
    5::107     4e-04  28%  349 aa  CHEB2_PSEAE RecName: Full=Chemotaxis response regulator
   19::105     4e-04  36%  342 aa  CHEB2_BURPS RecName: Full=Chemotaxis response regulator
   19::105     4e-04  36%  342 aa  CHEB2_BURP1 RecName: Full=Chemotaxis response regulator
   19::105     4e-04  36%  342 aa  CHEB2_BURMA RecName: Full=Chemotaxis response regulator
    7::110     4e-04  24%  357 aa  CHEB1_RALME RecName: Full=Chemotaxis response regulator
  274::343     5e-04  32%  344 aa  NREB_STAAW RecName: Full=Oxygen sensor histidine kinase nreB;      
  274::343     5e-04  32%  344 aa  NREB_STAAT RecName: Full=Oxygen sensor histidine kinase nreB;      
  274::343     5e-04  32%  344 aa  NREB_STAAS RecName: Full=Oxygen sensor histidine kinase nreB;      
  274::343     5e-04  32%  344 aa  NREB_STAAR RecName: Full=Oxygen sensor histidine kinase nreB;      
  274::343     5e-04  32%  344 aa  NREB_STAAN RecName: Full=Oxygen sensor histidine kinase nreB;      
  274::343     5e-04  32%  344 aa  NREB_STAAM RecName: Full=Oxygen sensor histidine kinase nreB;      
  274::343     5e-04  32%  344 aa  NREB_STAAE RecName: Full=Oxygen sensor histidine kinase nreB;      
  274::343     5e-04  32%  344 aa  NREB_STAAC RecName: Full=Oxygen sensor histidine kinase nreB;      
  274::343     5e-04  32%  344 aa  NREB_STAAB RecName: Full=Oxygen sensor histidine kinase nreB;      
  274::343     5e-04  32%  344 aa  NREB_STAA9 RecName: Full=Oxygen sensor histidine kinase nreB;      
  274::343     5e-04  32%  344 aa  NREB_STAA8 RecName: Full=Oxygen sensor histidine kinase nreB;      
  274::343     5e-04  32%  344 aa  NREB_STAA3 RecName: Full=Oxygen sensor histidine kinase nreB;      
  274::343     5e-04  32%  344 aa  NREB_STAA2 RecName: Full=Oxygen sensor histidine kinase nreB;      
  274::343     5e-04  32%  344 aa  NREB_STAA1 RecName: Full=Oxygen sensor histidine kinase nreB;      
   38::120     5e-04  29%  216 aa  NARL_SHIFL RecName: Full=Nitrate/nitrite response regulator protein
   38::120     5e-04  29%  216 aa  NARL_ECOLI RecName: Full=Nitrate/nitrite response regulator protein
   38::120     5e-04  29%  216 aa  NARL_ECOL6 RecName: Full=Nitrate/nitrite response regulator protein
   38::120     5e-04  29%  216 aa  NARL_ECO57 RecName: Full=Nitrate/nitrite response regulator protein
    3::112     5e-04  31%  242 aa  LYTT_ENTFA RecName: Full=Sensory transduction protein lytT;
    8::118     5e-04  31%  492 aa  HUPR_RHOCA RecName: Full=Hydrogenase transcriptional regulatory
    5::108     5e-04  24%  350 aa  CHEB_ERWCT RecName: Full=Chemotaxis response regulator
    8::111     5e-04  24%  363 aa  CHEB3_BURS3 RecName: Full=Chemotaxis response regulator
   32::68      5e-04  58%  338 aa  CHEB2_RALME RecName: Full=Chemotaxis response regulator
    4::126     5e-04  32%  356 aa  CHEB2_METAC RecName: Full=Chemotaxis response regulator
    7::116     5e-04  25%  363 aa  CHEB1_GEOMG RecName: Full=Chemotaxis response regulator
  453::594     7e-04  29%  597 aa  Y899_CHLAA RecName: Full=Uncharacterized sensor-like histidine
  249::347     7e-04  33%  347 aa  NREB_STACT RecName: Full=Oxygen sensor histidine kinase nreB;      
    4::103     7e-04  28%  225 aa  MTRA_MYCTU RecName: Full=DNA-binding response regulator mtrA;
    4::103     7e-04  28%  225 aa  MTRA_MYCPA RecName: Full=DNA-binding response regulator mtrA;
    4::103     7e-04  28%  225 aa  MTRA_MYCLE RecName: Full=DNA-binding response regulator mtrA;
    4::103     7e-04  28%  225 aa  MTRA_MYCBO RecName: Full=DNA-binding response regulator mtrA;
  480::586     7e-04  37%  591 aa  LYTS_STAS1 RecName: Full=Sensor protein lytS;       
  266::348     7e-04  38%  586 aa  LMNB1_HUMAN RecName: Full=Lamin-B1;
    4::125     7e-04  27%  239 aa  DCUR_SHIFL RecName: Full=Transcriptional regulatory protein dcuR;
   32::105     7e-04  38%  339 aa  CHEB_RHILO RecName: Full=Chemotaxis response regulator
    4::110     7e-04  25%  345 aa  CHEB2_VIBVY RecName: Full=Chemotaxis response regulator
    3::109     7e-04  25%  344 aa  CHEB2_VIBVU RecName: Full=Chemotaxis response regulator
    4::108     7e-04  31%  356 aa  CHEB2_CHRVO RecName: Full=Chemotaxis response regulator
    5::106     7e-04  33%  334 aa  CHEB1_BURS3 RecName: Full=Chemotaxis response regulator
  325::485     7e-04  29%  618 aa  CHEA_LISIN RecName: Full=Chemotaxis protein cheA;       
   74::127     7e-04  35%  240 aa  BAER_ECOLI RecName: Full=Transcriptional regulatory protein baeR;
   74::127     7e-04  35%  240 aa  BAER_ECOL6 RecName: Full=Transcriptional regulatory protein baeR;
    2::106     9e-04  28%  368 aa  YESN_BACSU RecName: Full=Uncharacterized transcriptional regulatory
  156::220     9e-04  38%  307 aa  PYRB_CLOPS RecName: Full=Aspartate carbamoyltransferase;       
  156::220     9e-04  38%  307 aa  PYRB_CLOPE RecName: Full=Aspartate carbamoyltransferase;       
  156::220     9e-04  38%  307 aa  PYRB_CLOP1 RecName: Full=Aspartate carbamoyltransferase;       
  111::329     9e-04  21%  342 aa  GRAS_STAS1 RecName: Full=Sensor histidine kinase graS;       
  435::535     9e-04  39%  543 aa  DCUS_SHIFL RecName: Full=Sensor protein dcuS;         EC=2.7.13.3;
  435::535     9e-04  39%  543 aa  DCUS_ECOLI RecName: Full=Sensor protein dcuS;         EC=2.7.13.3;
  435::535     9e-04  39%  543 aa  DCUS_ECOL6 RecName: Full=Sensor protein dcuS;         EC=2.7.13.3;
  435::535     9e-04  39%  543 aa  DCUS_ECO57 RecName: Full=Sensor protein dcuS;         EC=2.7.13.3;
    4::125     9e-04  29%  239 aa  DCUR_ECOLI RecName: Full=Transcriptional regulatory protein dcuR;
    4::125     9e-04  29%  239 aa  DCUR_ECO57 RecName: Full=Transcriptional regulatory protein dcuR;
    3::106     9e-04  34%  347 aa  CHEB3_LEPIN RecName: Full=Chemotaxis response regulator
    3::106     9e-04  34%  347 aa  CHEB3_LEPIC RecName: Full=Chemotaxis response regulator
    4::107     9e-04  29%  351 aa  CHEB2_SHESR RecName: Full=Chemotaxis response regulator
    4::107     9e-04  29%  351 aa  CHEB2_SHESM RecName: Full=Chemotaxis response regulator
    6::109     9e-04  30%  363 aa  CHEB2_RHORT RecName: Full=Chemotaxis response regulator
    4::110     9e-04  29%  358 aa  CHEB2_PSESM RecName: Full=Chemotaxis response regulator
    5::106     9e-04  33%  334 aa  CHEB2_BURCA RecName: Full=Chemotaxis response regulator
    4::70      9e-04  48%  376 aa  CHEB1_VIBVY RecName: Full=Chemotaxis response regulator
    4::70      9e-04  48%  376 aa  CHEB1_VIBVU RecName: Full=Chemotaxis response regulator
    2::68      9e-04  44%  336 aa  CHEB1_PSEF5 RecName: Full=Chemotaxis response regulator
    1::916

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxAIYGMKKFNNNIEEIVKNRYQKVILVATIQFEINNASRYLRDLILE
LUXQ_VIBPA      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
LUXQ_VIBVY      ----------------------------------------------------------------------
LUXQ_VIBVU      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
ARCB_SHIFL      ----------------------------------------------------------------------
ARCB_ECOLI      ----------------------------------------------------------------------
ARCB_ECO57      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
GACS_PSESY      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
BVGS_BORPE      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
TCSA_EMENI      ----------------------------------------------------------------------
DOKA_DICDI      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
MAK2_SCHPO      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
ETR1_PASED      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
DHKL_DICDI      ----------------------------------------------------------------------
ETR1_PELHO      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
DHKF_DICDI      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
MAK1_SCHPO      ----------------------------------------------------------------------
PLEC_CAUCR      ----------------------------------------------------------------------
ERS1_ARATH      ----------------------------------------------------------------------
TORS_ECOLI      ----------------------------------------------------------------------
EVGS_ECOLI      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
ETR1_ARATH      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------
ETR1_BRAOL      ----------------------------------------------------------------------
DSPA_SYNY3      ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
PHOR_BACSU      ----------------------------------------------------------------------
SAES_STAAE      ----------------------------------------------------------------------
SAES_STAAC      ----------------------------------------------------------------------
SAES_STAA8      ----------------------------------------------------------------------
SAES_STAA3      ----------------------------------------------------------------------
ARCB_HAEIN      ----------------------------------------------------------------------
SASA_SYNJA      ----------------------------------------------------------------------
SAES_STAAR      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
DIVL_CAUCR      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SASA_CYAA5      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SAES_STAAW      ----------------------------------------------------------------------
SAES_STAAS      ----------------------------------------------------------------------
SAES_STAAN      ----------------------------------------------------------------------
SAES_STAAM      ----------------------------------------------------------------------
SAES_STAAB      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_THEEB      ----------------------------------------------------------------------
PHOR_ECOLI      ----------------------------------------------------------------------
WALK_STAHJ      ----------------------------------------------------------------------
WALK_STAAR      ----------------------------------------------------------------------
WALK_STAAW      ----------------------------------------------------------------------
WALK_STAAU      ----------------------------------------------------------------------
WALK_STAAT      ----------------------------------------------------------------------
WALK_STAAS      ----------------------------------------------------------------------
WALK_STAAN      ----------------------------------------------------------------------
WALK_STAAM      ----------------------------------------------------------------------
WALK_STAAE      ----------------------------------------------------------------------
WALK_STAAC      ----------------------------------------------------------------------
WALK_STAAB      ----------------------------------------------------------------------
WALK_STAA9      ----------------------------------------------------------------------
WALK_STAA8      ----------------------------------------------------------------------
WALK_STAA3      ----------------------------------------------------------------------
WALK_STAA2      ----------------------------------------------------------------------
WALK_STAA1      ----------------------------------------------------------------------
YCF26_PORYE     ----------------------------------------------------------------------
YYCG_BACSU      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
WALK_STASR      ----------------------------------------------------------------------
PHOR_SHIDY      ----------------------------------------------------------------------
WALK_STAS1      ----------------------------------------------------------------------
PHOR_KLEPN      ----------------------------------------------------------------------
SASA_SYNJB      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
YCF29_PORYE     ----------------------------------------------------------------------
BAES_ECOLI      ----------------------------------------------------------------------
Y851_SYNP2      ----------------------------------------------------------------------
SASA_PROMA      ----------------------------------------------------------------------
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
LUXN_VIBHB      ----------------------------------------------------------------------
LUXN_VIBHA      ----------------------------------------------------------------------
YSO1_PLEBO      ----------------------------------------------------------------------
WALK_STAES      -------------------------------FTNSLEKELLDNFKKNITQYAKQLDVNIEKVY-KDKDKG
WALK_STAEQ      -------------------------------FTNSLEKELLDNFKKNITQYAKQLDVNIEKVY-KDKDKG
SEX3_MYCLE      ----------------------------------------------------------------------
MTRB_MYCPA      ----------------------------------------------------------------------
EVGS_ECO57      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
PILH_PSEAE      ----------------------------------------------------------------------
MTRB_MYCLE      ----------------------------------------------------------------------
SASA_SYNE7      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------
PHOR_HAEIN      ----------------------------------------------------------------------
DIVK_OCHA4      ----------------------------------------------------------------------
DHKM_DICDI      ----------------------------------------------------------------------
YFHK_ECOLI      ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SASA_SYNS3      ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
ARLS_STAS1      ----------------------------------------------------------------------
SRRA_STAAW      ----------------------------------------------------------------------
SRRA_STAAU      ----------------------------------------------------------------------
SRRA_STAAS      ----------------------------------------------------------------------
SRRA_STAAR      ----------------------------------------------------------------------
SRRA_STAAN      ----------------------------------------------------------------------
SRRA_STAAM      ----------------------------------------------------------------------
SRRA_STAAC      ----------------------------------------------------------------------
SRRA_STAA8      ----------------------------------------------------------------------
MTRB_MYCTU      ----------------------------------------------------------------------
MTRB_MYCBO      ----------------------------------------------------------------------
KDPD_ECOLI      ----------------------------------------------------------------------
EIN4_ARATH      ----------------------------------------------------------------------
DHKH_DICDI      ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
DIVK_BRUSU      ----------------------------------------------------------------------
DIVK_BRUSI      ----------------------------------------------------------------------
DIVK_BRUO2      ----------------------------------------------------------------------
DIVK_BRUME      ----------------------------------------------------------------------
DIVK_BRUC2      ----------------------------------------------------------------------
DIVK_BRUAB      ----------------------------------------------------------------------
DIVK_BRUA2      ----------------------------------------------------------------------
DIVK_BRUA1      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
RSSA_SERMA      ----------------------------------------------------------------------
OMPR_SHIFL      ----------------------------------------------------------------------
OMPR_SALTY      ----------------------------------------------------------------------
OMPR_SALTI      ----------------------------------------------------------------------
OMPR_ECOLI      ----------------------------------------------------------------------
OMPR_ECOL6      ----------------------------------------------------------------------
OMPR_ECO57      ----------------------------------------------------------------------
YYCF_BACSU      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
HSSR_STAES      ----------------------------------------------------------------------
HSSR_STAEQ      ----------------------------------------------------------------------
CQSS_VIBHB      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
MAK3_SCHPO      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
YCF27_CYAPA     ----------------------------------------------------------------------
ARLS_STAHJ      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_MICAN      ----------------------------------------------------------------------
HSSR_STAHJ      ----------------------------------------------------------------------
HSSR_STAAR      ----------------------------------------------------------------------
HSSR_STAAB      ----------------------------------------------------------------------
SASA_CYAP8      ----------------------------------------------------------------------
HSSR_STAAW      ----------------------------------------------------------------------
HSSR_STAAT      ----------------------------------------------------------------------
HSSR_STAAS      ----------------------------------------------------------------------
HSSR_STAAN      ----------------------------------------------------------------------
HSSR_STAAM      ----------------------------------------------------------------------
HSSR_STAA9      ----------------------------------------------------------------------
HSSR_STAA8      ----------------------------------------------------------------------
HSSR_STAA3      ----------------------------------------------------------------------
HSSR_STAA2      ----------------------------------------------------------------------
HSSR_STAA1      ----------------------------------------------------------------------
ZRAS_ECOLI      ----------------------------------------------------------------------
WALR_STAS1      ----------------------------------------------------------------------
VANS_ENTFC      ----------------------------------------------------------------------
PHOB_RHIME      ----------------------------------------------------------------------
PHOB_HAEIN      ----------------------------------------------------------------------
ARLS_STAES      ----------------------------------------------------------------------
PHOR_PSEAE      ----------------------------------------------------------------------
HSSR_STAAE      ----------------------------------------------------------------------
HSSR_STAAC      ----------------------------------------------------------------------
CQSS_VIBCH      ----------------------------------------------------------------------
WALR_STAES      ----------------------------------------------------------------------
WALR_STAEQ      ----------------------------------------------------------------------
WALR_STAAW      ----------------------------------------------------------------------
WALR_STAAU      ----------------------------------------------------------------------
WALR_STAAT      ----------------------------------------------------------------------
WALR_STAAS      ----------------------------------------------------------------------
WALR_STAAR      ----------------------------------------------------------------------
WALR_STAAN      ----------------------------------------------------------------------
WALR_STAAM      ----------------------------------------------------------------------
WALR_STAAE      ----------------------------------------------------------------------
WALR_STAAC      ----------------------------------------------------------------------
WALR_STAAB      ----------------------------------------------------------------------
WALR_STAA9      ----------------------------------------------------------------------
WALR_STAA8      ----------------------------------------------------------------------
WALR_STAA3      ----------------------------------------------------------------------
WALR_STAA2      ----------------------------------------------------------------------
WALR_STAA1      ----------------------------------------------------------------------
YKOH_BACSU      ----------------------------------------------------------------------
YEDW_ECOLI      ----------------------------------------------------------------------
SASA_SYNY3      ----------------------------------------------------------------------
SASA_CYAP7      ----------------------------------------------------------------------
DLTR_STRA5      ----------------------------------------------------------------------
DLTR_STRA3      ----------------------------------------------------------------------
ARLR_STAS1      ----------------------------------------------------------------------
YCLK_BACSU      ----------------------------------------------------------------------
YCF27_PORPU     ----------------------------------------------------------------------
WALR_STAHJ      ----------------------------------------------------------------------
GTCR_ANEMI      ----------------------------------------------------------------------
ARLS_STAEQ      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
CZCR_RALME      ----------------------------------------------------------------------
ZRAS_ECO57      ----------------------------------------------------------------------
YKOG_BACSU      ----------------------------------------------------------------------
YCF27_GUITH     ----------------------------------------------------------------------
ZRAR_KLEOX      ----------------------------------------------------------------------
YCF27_PORYE     ----------------------------------------------------------------------
DHKG_DICDI      ----------------------------------------------------------------------
YCF27_CYACA     ----------------------------------------------------------------------
VIRA_AGRT5      ----------------------------------------------------------------------
SASA_NOSP7      ----------------------------------------------------------------------
SAER_STAAW      ----------------------------------------------------------------------
SAER_STAAS      ----------------------------------------------------------------------
SAER_STAAR      ----------------------------------------------------------------------
SAER_STAAN      ----------------------------------------------------------------------
SAER_STAAM      ----------------------------------------------------------------------
SAER_STAAE      ----------------------------------------------------------------------
SAER_STAAC      ----------------------------------------------------------------------
SAER_STAAB      ----------------------------------------------------------------------
SAER_STAA8      ----------------------------------------------------------------------
SAER_STAA3      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
PHOB_PSEAE      ----------------------------------------------------------------------
YEDV_ECOLI      ----------------------------------------------------------------------
YCF27_PORAE     ----------------------------------------------------------------------
RESD_BACSU      ----------------------------------------------------------------------
SASA_SYNS9      ----------------------------------------------------------------------
PHOP_BACSU      ----------------------------------------------------------------------
YCF27_GALSU     ----------------------------------------------------------------------
YCBM_BACSU      ----------------------------------------------------------------------
SILR_SALTY      ----------------------------------------------------------------------
YVRH_BACSU      ----------------------------------------------------------------------
HSSR_STAS1      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
PHY1_SELMA      ----------------------------------------------------------------------
MPRA_MYCVP      ----------------------------------------------------------------------
CUSR_ECOLI      ----------------------------------------------------------------------
CUSR_ECOL6      ----------------------------------------------------------------------
CUSR_ECO57      ----------------------------------------------------------------------
CPXR_HAEIN      ----------------------------------------------------------------------
COPR_PSESM      ----------------------------------------------------------------------
HSSS_STAAR      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
ATOS_ECOLI      ----------------------------------------------------------------------
PRR73_ORYSJ     ----------------------------------------------------------------------
PRR37_ORYSJ     ----------------------------------------------------------------------
PRR37_ORYSI     ----------------------------------------------------------------------
HSSS_STAAW      ----------------------------------------------------------------------
HSSS_STAAS      ----------------------------------------------------------------------
YCF29_PORPU     ----------------------------------------------------------------------
YBDJ_BACSU      ----------------------------------------------------------------------
SASA_ANASP      ----------------------------------------------------------------------
PRR73_ORYSI     ----------------------------------------------------------------------
HSSS_STAAT      ----------------------------------------------------------------------
HSSS_STAAE      ----------------------------------------------------------------------
HSSS_STAAC      ----------------------------------------------------------------------
HSSS_STAA8      ----------------------------------------------------------------------
HSSS_STAA3      ----------------------------------------------------------------------
CHEB_ARCFU      ----------------------------------------------------------------------
APRR7_ARATH     ----------------------------------------------------------------------
SASA_ANAVT      ----------------------------------------------------------------------
RPRX_BACFR      ----------------------------------------------------------------------
HSSS_STAAN      ----------------------------------------------------------------------
HSSS_STAAM      ----------------------------------------------------------------------
HSSS_STAA9      ----------------------------------------------------------------------
HSSS_STAA2      ----------------------------------------------------------------------
HSSS_STAA1      ----------------------------------------------------------------------
CZCS_RALME      ----------------------------------------------------------------------
ATOC_ECOLI      ----------------------------------------------------------------------
CHEY_CAMJJ      ----------------------------------------------------------------------
CHEY_CAMJE      ----------------------------------------------------------------------
CHEY_CAMJ8      ----------------------------------------------------------------------
CHEB_NOCSJ      ----------------------------------------------------------------------
ARLS_STAAW      ----------------------------------------------------------------------
ARLS_STAAS      ----------------------------------------------------------------------
ARLS_STAAR      ----------------------------------------------------------------------
ARLS_STAAN      ----------------------------------------------------------------------
ARLS_STAAM      ----------------------------------------------------------------------
ARLS_STAAC      ----------------------------------------------------------------------
ARLS_STAAB      ----------------------------------------------------------------------
ARLS_STAA8      ----------------------------------------------------------------------
ARLS_STAA3      ----------------------------------------------------------------------
PCOR_ECOLX      ----------------------------------------------------------------------
HSSS_STAAB      ----------------------------------------------------------------------
APRR1_ARATH     ----------------------------------------------------------------------
QSEB_ECOLI      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
MPRA_MYCSS      ----------------------------------------------------------------------
MPRA_MYCSK      ----------------------------------------------------------------------
MPRA_MYCSJ      ----------------------------------------------------------------------
IRLR_BURPS      ----------------------------------------------------------------------
SKN7_YEAST      ----------------------------------------------------------------------
RSTB_ECOLI      ----------------------------------------------------------------------
CHEY_RHIEC      ----------------------------------------------------------------------
ZRAR_SALTY      ----------------------------------------------------------------------
ZRAR_SALTI      ----------------------------------------------------------------------
YVRG_BACSU      ----------------------------------------------------------------------
SPAR_BACSU      ----------------------------------------------------------------------
RPFG_XANC8      ----------------------------------------------------------------------
REGX3_MYCS2     ----------------------------------------------------------------------
QSEB_ECO57      ----------------------------------------------------------------------
PCOS_ECOLX      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
MCS4_SCHPO      ----------------------------------------------------------------------
KINC_BACSU      ----------------------------------------------------------------------
KDPD_CLOAB      ----------------------------------------------------------------------
CHEY_TREPA      ----------------------------------------------------------------------
SPHR_SYNE7      ----------------------------------------------------------------------
QSEB_HAEIN      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
MPRA_MYCUA      ----------------------------------------------------------------------
ARR3_ARATH      ----------------------------------------------------------------------
YRKP_BACSU      ----------------------------------------------------------------------
SSK1_YEAST      ----------------------------------------------------------------------
MPRB_MYCVP      ----------------------------------------------------------------------
MPRA_MYCLE      ----------------------------------------------------------------------
CHVG_RHIME      ----------------------------------------------------------------------
PILR_PSEAE      ----------------------------------------------------------------------
PATA_ANASP      ----------------------------------------------------------------------
MPRA_MYCS2      ----------------------------------------------------------------------
MPRA_MYCPA      ----------------------------------------------------------------------
MPRA_MYCBP      ----------------------------------------------------------------------
MPRA_MYCBO      ----------------------------------------------------------------------
MPRA_MYCA1      ----------------------------------------------------------------------
APRR5_ARATH     ----------------------------------------------------------------------
AFSQ1_STRCO     ----------------------------------------------------------------------
CHEB2_CARHZ     ----------------------------------------------------------------------
TORR_ECOLI      ----------------------------------------------------------------------
MPRA_MYCTU      ----------------------------------------------------------------------
MPRA_MYCTA      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
ARR4_ARATH      ----------------------------------------------------------------------
TORR_ECO57      ----------------------------------------------------------------------
QSEB_SALTY      ----------------------------------------------------------------------
QSEB_SALTI      ----------------------------------------------------------------------
PHOB_SHIFL      ----------------------------------------------------------------------
PHOB_SHIDY      ----------------------------------------------------------------------
PHOB_ECOLI      ----------------------------------------------------------------------
PHOB_ECO57      ----------------------------------------------------------------------
CHVI_RHISN      ----------------------------------------------------------------------
CHVI_RHIME      ----------------------------------------------------------------------
APRR9_ARATH     ----------------------------------------------------------------------
VANR_ENTFC      ----------------------------------------------------------------------
PHOB_KLEPN      ----------------------------------------------------------------------
CHVI_RHIRD      ----------------------------------------------------------------------
CHEB2_RHOCS     ----------------------------------------------------------------------
PHY_MOUSC       ----------------------------------------------------------------------
KDPD_RATRA      ----------------------------------------------------------------------
CHEY_HELPY      ----------------------------------------------------------------------
CHEB3_GEOSL     ----------------------------------------------------------------------
VANR_ENTFA      ----------------------------------------------------------------------
SP0A_MOOTA      ----------------------------------------------------------------------
SP0A_BACME      ----------------------------------------------------------------------
SP0A_BACCI      ----------------------------------------------------------------------
NTRC_ECOLI      ----------------------------------------------------------------------
NTRC_ECO57      ----------------------------------------------------------------------
CHEB1_SYNWW     ----------------------------------------------------------------------
YCBL_BACSU      ----------------------------------------------------------------------
PRR95_ORYSJ     ----------------------------------------------------------------------
PDTAR_MYCTU     ----------------------------------------------------------------------
IRLS_BURPS      ----------------------------------------------------------------------
CHEY_HELPJ      ----------------------------------------------------------------------
REGX3_MYCTU     ----------------------------------------------------------------------
REGX3_MYCBO     ----------------------------------------------------------------------
CHEB_BACSU      ----------------------------------------------------------------------
CHEB2_GEOMG     ----------------------------------------------------------------------
CHEB2_AZOBR     ----------------------------------------------------------------------
BASS_SALTY      ----------------------------------------------------------------------
ARR10_ARATH     ----------------------------------------------------------------------
ARLR_STAHJ      ----------------------------------------------------------------------
VIRAL_RHIRD     ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
CHVG_AGRT5      ----------------------------------------------------------------------
ARR8_ARATH      ----------------------------------------------------------------------
ARR17_ARATH     ----------------------------------------------------------------------
ARR12_ARATH     ----------------------------------------------------------------------
ZRAS_KLEOX      ----------------------------------------------------------------------
YCLJ_BACSU      ----------------------------------------------------------------------
TCTD_SALTY      ----------------------------------------------------------------------
PILG_PSEAE      ----------------------------------------------------------------------
PHY2_CERPU      ----------------------------------------------------------------------
SPAK_BACSU      ----------------------------------------------------------------------
SP0A_BACTU      ----------------------------------------------------------------------
SP0A_BACSU      ----------------------------------------------------------------------
SP0A_BACCR      ----------------------------------------------------------------------
RPRY_BACFR      ----------------------------------------------------------------------
PRR1_ORYSJ      ----------------------------------------------------------------------
NTRC_SALTY      ----------------------------------------------------------------------
NTRC_BRASR      ----------------------------------------------------------------------
NODV_BRAJA      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
CPXR_SHIFL      ----------------------------------------------------------------------
CPXR_ECOLI      ----------------------------------------------------------------------
CPXR_ECO57      ----------------------------------------------------------------------
CITS_BACSU      ----------------------------------------------------------------------
SP0A_BACAN      ----------------------------------------------------------------------
PHYB_ANASP      ----------------------------------------------------------------------
PDE2_DICDI      ----------------------------------------------------------------------
NTRC_PROVU      ----------------------------------------------------------------------
CUSS_ECO57      ----------------------------------------------------------------------
CHEY_BACSU      ----------------------------------------------------------------------
PFER_PSEAE      ----------------------------------------------------------------------
HSSS_STAHJ      ----------------------------------------------------------------------
BASS_ECOLI      ----------------------------------------------------------------------
ARR5_ARATH      ----------------------------------------------------------------------
ARCA_SHIFL      ----------------------------------------------------------------------
ARCA_ECOLI      ----------------------------------------------------------------------
ARCA_ECOL6      ----------------------------------------------------------------------
ARCA_ECO57      ----------------------------------------------------------------------
VIRA_AGRT9      ----------------------------------------------------------------------
NTRC_AZOC5      ----------------------------------------------------------------------
KDPD_MYCTU      ----------------------------------------------------------------------
GRAR_STAS1      ----------------------------------------------------------------------
DCTR_BACSU      ----------------------------------------------------------------------
CUSS_ECOLI      ----------------------------------------------------------------------
CHEY_THEMA      ----------------------------------------------------------------------
CHEB_TREDE      ----------------------------------------------------------------------
ARR9_ARATH      ----------------------------------------------------------------------
ARR6_ARATH      ----------------------------------------------------------------------
ARR1_ARATH      ----------------------------------------------------------------------
NTRC_KLEPN      ----------------------------------------------------------------------
DPIB_ECOLI      ----------------------------------------------------------------------
CUSS_ECOL6      ----------------------------------------------------------------------
BCER_BACHD      ----------------------------------------------------------------------
SPHS_SYNE7      ----------------------------------------------------------------------
PHY1_PHYPA      ----------------------------------------------------------------------
NTRB_AZOBR      ----------------------------------------------------------------------
GRAR_STAHJ      ----------------------------------------------------------------------
GRAR_STAES      ----------------------------------------------------------------------
GRAR_STAEQ      ----------------------------------------------------------------------
DCTS_RHOCA      ----------------------------------------------------------------------
REGX3_MYCLE     ----------------------------------------------------------------------
PHYB_TOBAC      ----------------------------------------------------------------------
CHEB_TRIEI      ----------------------------------------------------------------------
BPHY_DEIRA      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
ARR2_ARATH      ----------------------------------------------------------------------
ZRAR_ECOLI      ----------------------------------------------------------------------
ZRAR_ECO57      ----------------------------------------------------------------------
VIRAW_RHIRD     ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
ARR14_ARATH     ----------------------------------------------------------------------
ARLR_STAEQ      ----------------------------------------------------------------------
APRR3_ARATH     ----------------------------------------------------------------------
AFSQ2_STRCO     ----------------------------------------------------------------------
SP0F_BACSU      ----------------------------------------------------------------------
SP0A_BREPA      ----------------------------------------------------------------------
PHY_PICAB       ----------------------------------------------------------------------
CIAR_STRR6      ----------------------------------------------------------------------
CIAR_STRPN      ----------------------------------------------------------------------
CHEY_LISMO      ----------------------------------------------------------------------
CHEY_LISIN      ----------------------------------------------------------------------
CHEB_METBU      ----------------------------------------------------------------------
CHEB_BACLD      ----------------------------------------------------------------------
CHEB1_AGRT5     ----------------------------------------------------------------------
ARLR_STAES      ----------------------------------------------------------------------
YVCP_BACSU      ----------------------------------------------------------------------
SP0A_CLOB8      ----------------------------------------------------------------------
NTRXL_RICPR     ----------------------------------------------------------------------
HNR_SHIFL       ----------------------------------------------------------------------
HNR_ECOLI       ----------------------------------------------------------------------
HNR_ECO57       ----------------------------------------------------------------------
FIXL_AZOC5      ----------------------------------------------------------------------
CYAB_STIAU      ----------------------------------------------------------------------
CSEB_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
CHEB_ALHEH      ----------------------------------------------------------------------
ARR11_ARATH     ----------------------------------------------------------------------
ARLR_STAAW      ----------------------------------------------------------------------
ARLR_STAAS      ----------------------------------------------------------------------
ARLR_STAAR      ----------------------------------------------------------------------
ARLR_STAAN      ----------------------------------------------------------------------
ARLR_STAAM      ----------------------------------------------------------------------
ARLR_STAAC      ----------------------------------------------------------------------
ARLR_STAAB      ----------------------------------------------------------------------
ARLR_STAA8      ----------------------------------------------------------------------
ARLR_STAA3      ----------------------------------------------------------------------
SP0A_BACST      ----------------------------------------------------------------------
PHOP_SALCH      ----------------------------------------------------------------------
NTRXL_RICTY     ----------------------------------------------------------------------
NTRXL_RICFE     ----------------------------------------------------------------------
MPRB_MYCLE      ----------------------------------------------------------------------
CSSR_BACSU      ----------------------------------------------------------------------
CSEB_STRAW      ----------------------------------------------------------------------
VIRG_AGRT5      ----------------------------------------------------------------------
RCAC_FREDI      ----------------------------------------------------------------------
NTRC_RHIME      ----------------------------------------------------------------------
NTRC_AZOBR      ----------------------------------------------------------------------
GRAS_STAES      ----------------------------------------------------------------------
GRAS_STAEQ      ----------------------------------------------------------------------
CHEB_PELCD      ----------------------------------------------------------------------
CHEB2_ACIBL     ----------------------------------------------------------------------
LOVHK_PSE14     ----------------------------------------------------------------------
GRAR_STAAW      ----------------------------------------------------------------------
GRAR_STAAT      ----------------------------------------------------------------------
GRAR_STAAS      ----------------------------------------------------------------------
GRAR_STAAR      ----------------------------------------------------------------------
GRAR_STAAN      ----------------------------------------------------------------------
GRAR_STAAM      ----------------------------------------------------------------------
GRAR_STAAE      ----------------------------------------------------------------------
GRAR_STAAC      ----------------------------------------------------------------------
GRAR_STAAB      ----------------------------------------------------------------------
GRAR_STAA9      ----------------------------------------------------------------------
GRAR_STAA8      ----------------------------------------------------------------------
GRAR_STAA3      ----------------------------------------------------------------------
GRAR_STAA2      ----------------------------------------------------------------------
GRAR_STAA1      ----------------------------------------------------------------------
ALGB_PSESM      ----------------------------------------------------------------------
NTRXL_RICCN     ----------------------------------------------------------------------
ARR21_ARATH     ----------------------------------------------------------------------
ALGB_PSEPK      ----------------------------------------------------------------------
TRPO_PSEAE      ----------------------------------------------------------------------
SP0A_BACSH      ----------------------------------------------------------------------
FIMZ_SALTY      ----------------------------------------------------------------------
DCTR_BACME      ----------------------------------------------------------------------
DCTB_RHIME      ----------------------------------------------------------------------
CITT_BACHD      ----------------------------------------------------------------------
CHEB3_RHOPA     ----------------------------------------------------------------------
CHEB1_GEOSL     ----------------------------------------------------------------------
ARR18_ARATH     ----------------------------------------------------------------------
PHYB_SOLTU      ----------------------------------------------------------------------
MPRB_MYCUA      ----------------------------------------------------------------------
MPRB_MYCTU      ----------------------------------------------------------------------
MPRB_MYCTA      ----------------------------------------------------------------------
FIXL_BRAJA      ----------------------------------------------------------------------
CHEB_METMP      ----------------------------------------------------------------------
CHEB_DESHY      ----------------------------------------------------------------------
CHEB3_BURTA     ----------------------------------------------------------------------
CHEB2_RHOSH     ----------------------------------------------------------------------
CHEB2_RHOS4     ----------------------------------------------------------------------
ALGB_PSEAE      ----------------------------------------------------------------------
Y2151_LEPIN     ----------------------------------------------------------------------
Y1769_LEPIC     ----------------------------------------------------------------------
SILS_SALTY      ----------------------------------------------------------------------
RCP1_SYNY3      ----------------------------------------------------------------------
PHY_PINSY       ----------------------------------------------------------------------
MPRB_MYCBP      ----------------------------------------------------------------------
MPRB_MYCBO      ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------------
CHEB_TREPA      ----------------------------------------------------------------------
CHEB_PSEA6      ----------------------------------------------------------------------
CHEB5_GEOMG     ----------------------------------------------------------------------
CHEB1_RHORT     ----------------------------------------------------------------------
ARR7_ARATH      ----------------------------------------------------------------------
HOXA_RALEH      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
CHEB1_METMA     ----------------------------------------------------------------------
Y3689_SHEFN     ----------------------------------------------------------------------
PHYB_ORYSJ      ----------------------------------------------------------------------
PHYB1_SOLLC     ----------------------------------------------------------------------
NTRB_VIBAL      ----------------------------------------------------------------------
KDPE_ECOLI      ----------------------------------------------------------------------
DCTR_BACHD      ----------------------------------------------------------------------
CHEB_SYMTH      ----------------------------------------------------------------------
CHEB_CLOAB      ----------------------------------------------------------------------
CHEB_BACHD      ----------------------------------------------------------------------
CHEB1_MAGSA     ----------------------------------------------------------------------
YHCZ_BACSU      ----------------------------------------------------------------------
PRRA_MYCLE      ----------------------------------------------------------------------
PHYB_ORYSI      ----------------------------------------------------------------------
NTRB_KLEOX      ----------------------------------------------------------------------
MPRB_MYCSS      ----------------------------------------------------------------------
MPRB_MYCSK      ----------------------------------------------------------------------
MPRB_MYCSJ      ----------------------------------------------------------------------
ETR2_ARATH      ----------------------------------------------------------------------
DEGU_BREBE      ----------------------------------------------------------------------
CHEB_DESPS      ----------------------------------------------------------------------
VANS_ENTFA      ----------------------------------------------------------------------
RSTA_ECOLI      ----------------------------------------------------------------------
PHOP_SHIFL      ----------------------------------------------------------------------
PHOP_ECOLI      ----------------------------------------------------------------------
PHOP_ECOL6      ----------------------------------------------------------------------
NTRXL_RICBR     ----------------------------------------------------------------------
NISR_LACLA      ----------------------------------------------------------------------
EHD1_ORYSJ      ----------------------------------------------------------------------
EHD1_ORYSI      ----------------------------------------------------------------------
DCTS_BACSU      ----------------------------------------------------------------------
CHEB_PYRAB      ----------------------------------------------------------------------
CHEB_OCEIH      ----------------------------------------------------------------------
CHEB1_SACD2     ----------------------------------------------------------------------
ARR16_ARATH     ----------------------------------------------------------------------
VIRG_AGRRH      ----------------------------------------------------------------------
PRRA_MYCTU      ----------------------------------------------------------------------
PRRA_MYCBO      ----------------------------------------------------------------------
PHOQ_SALTY      ----------------------------------------------------------------------
PHOQ_SALTI      ----------------------------------------------------------------------
PHOQ_SALPA      ----------------------------------------------------------------------
PHOQ_SALCH      ----------------------------------------------------------------------
NTRC_RHOCA      ----------------------------------------------------------------------
CREB_ECOLI      ----------------------------------------------------------------------
CHEB5_ANADE     ----------------------------------------------------------------------
CHEB3_BRAJA     ----------------------------------------------------------------------
ARR20_ARATH     ----------------------------------------------------------------------
YXDJ_BACSU      ----------------------------------------------------------------------
SP0F_BACTK      ----------------------------------------------------------------------
PHYB_ARATH      ----------------------------------------------------------------------
NTRB_SALTY      ----------------------------------------------------------------------
NTRB_SALTI      ----------------------------------------------------------------------
LOVHK_PSESM     ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CSEC_STRCO      ----------------------------------------------------------------------
SP0A_CLODI      ----------------------------------------------------------------------
PHYB_SORBI      ----------------------------------------------------------------------
PHOP_ECO57      ----------------------------------------------------------------------
CSEC_STRAW      ----------------------------------------------------------------------
CHEV_BACSU      ----------------------------------------------------------------------
CHEB_THEMA      ----------------------------------------------------------------------
CHEB1_DECAR     ----------------------------------------------------------------------
CHEB1_CAUCR     ----------------------------------------------------------------------
CHEB1_CARHZ     ----------------------------------------------------------------------
NTRB_SHIFL      ----------------------------------------------------------------------
NTRB_ECOLI      ----------------------------------------------------------------------
NTRB_ECO57      ----------------------------------------------------------------------
LYTT_BACSU      ----------------------------------------------------------------------
GRAS_STAHJ      ----------------------------------------------------------------------
ENVZ_SHIFL      ----------------------------------------------------------------------
ENVZ_ECOLI      ----------------------------------------------------------------------
COPS_PSESM      ----------------------------------------------------------------------
CHEB_THETN      ----------------------------------------------------------------------
CHEB_SULDN      ----------------------------------------------------------------------
CHEB_NITWN      ----------------------------------------------------------------------
PHOP_SALTY      ----------------------------------------------------------------------
PHOP_SALTI      ----------------------------------------------------------------------
PHOP_SALPA      ----------------------------------------------------------------------
CHEB_PYRKO      ----------------------------------------------------------------------
CHEB_PYRHO      ----------------------------------------------------------------------
CHEB1_RHIEC     ----------------------------------------------------------------------
CHEB1_LEPIN     ----------------------------------------------------------------------
CHEB1_LEPIC     ----------------------------------------------------------------------
BCER_BACSU      ----------------------------------------------------------------------
UVRY_SHIFL      ----------------------------------------------------------------------
UVRY_ECOLI      ----------------------------------------------------------------------
SP0A_CLOAB      ----------------------------------------------------------------------
LOVHK_PSEU2     ----------------------------------------------------------------------
FIXL_RHIME      ----------------------------------------------------------------------
CHEY_YEREN      ----------------------------------------------------------------------
ARR15_ARATH     ----------------------------------------------------------------------
YFHA_ECOLI      ----------------------------------------------------------------------
YFHA_ECO57      ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
PILS_PSEAE      ----------------------------------------------------------------------
NTRY_AZOBR      ----------------------------------------------------------------------
CITS_BACHD      ----------------------------------------------------------------------
CHEB_NITEU      ----------------------------------------------------------------------
CHEB_LAWIP      ----------------------------------------------------------------------
CHEB_HALSA      ----------------------------------------------------------------------
CHEB1_RHIL3     ----------------------------------------------------------------------
YCF29_CYAPA     ----------------------------------------------------------------------
PHOQ_SHIFL      ----------------------------------------------------------------------
PHOQ_ECOLI      ----------------------------------------------------------------------
PHOQ_ECOL6      ----------------------------------------------------------------------
DCTS_BACHD      ----------------------------------------------------------------------
CHEB_RHOP2      ----------------------------------------------------------------------
CHEB_IDILO      ----------------------------------------------------------------------
CHEB3_RHOSH     ----------------------------------------------------------------------
ARCA_HAEIN      ----------------------------------------------------------------------
PHOQ_ECO57      ----------------------------------------------------------------------
LYTT_BACCR      ----------------------------------------------------------------------
HOXA_BRAJA      ----------------------------------------------------------------------
CHEB_SALRD      ----------------------------------------------------------------------
CHEB3_HAHCH     ----------------------------------------------------------------------
CHEB1_METAC     ----------------------------------------------------------------------
YDFI_BACSU      ----------------------------------------------------------------------
Y4XI_RHISN      ----------------------------------------------------------------------
SP0A_CLOPA      ----------------------------------------------------------------------
PETR_RHOCA      ----------------------------------------------------------------------
NTRB_RHOCA      ----------------------------------------------------------------------
NTRB_RHILP      ----------------------------------------------------------------------
GRAS_STAAW      ----------------------------------------------------------------------
GRAS_STAAT      ----------------------------------------------------------------------
GRAS_STAAS      ----------------------------------------------------------------------
GRAS_STAAN      ----------------------------------------------------------------------
GRAS_STAAM      ----------------------------------------------------------------------
GRAS_STAAE      ----------------------------------------------------------------------
GRAS_STAAC      ----------------------------------------------------------------------
GRAS_STAAB      ----------------------------------------------------------------------
GRAS_STAA9      ----------------------------------------------------------------------
GRAS_STAA8      ----------------------------------------------------------------------
GRAS_STAA3      ----------------------------------------------------------------------
GRAS_STAA2      ----------------------------------------------------------------------
GRAS_STAA1      ----------------------------------------------------------------------
CHEY_ECOL6      ----------------------------------------------------------------------
CHEB_THIDA      ----------------------------------------------------------------------
CHEB_NATPD      ----------------------------------------------------------------------
CHEB6_ANADE     ----------------------------------------------------------------------
CHEB3_CHRVO     ----------------------------------------------------------------------
CHEB2_RHIL3     ----------------------------------------------------------------------
CHEB1_RHOS4     ----------------------------------------------------------------------
CHEB1_DESDG     ----------------------------------------------------------------------
BASR_SALTY      ----------------------------------------------------------------------
BASR_ECOLI      ----------------------------------------------------------------------
UVRY_ECOL6      ----------------------------------------------------------------------
UVRY_ECO57      ----------------------------------------------------------------------
NTRB_PROVU      ----------------------------------------------------------------------
LYTT_BACAN      ----------------------------------------------------------------------
KIND_BACSU      ----------------------------------------------------------------------
CITA_KLEPN      ----------------------------------------------------------------------
CHEB_ROSDO      ----------------------------------------------------------------------
CHEB2_DESVH     ----------------------------------------------------------------------
CHEB2_DESDG     ----------------------------------------------------------------------
CHEB1_RHOPB     ----------------------------------------------------------------------
BVGA_BORPE      ----------------------------------------------------------------------
BVGA_BORPA      ----------------------------------------------------------------------
BVGA_BORBR      ----------------------------------------------------------------------
PHYC_SORBI      ----------------------------------------------------------------------
NTRB_BRASR      ----------------------------------------------------------------------
NARP_ECOLI      ----------------------------------------------------------------------
LIAR_BACSU      ----------------------------------------------------------------------
DEGM_BACB2      ----------------------------------------------------------------------
CHEY_YERPE      ----------------------------------------------------------------------
CHEY_SALTY      ----------------------------------------------------------------------
CHEY_SALTI      ----------------------------------------------------------------------
CHEB3_SYNWW     ----------------------------------------------------------------------
CHEB2_METHJ     ----------------------------------------------------------------------
CHEB1_HAHCH     ----------------------------------------------------------------------
CCDB_BACSU      ----------------------------------------------------------------------
BPHY_PSEAE      ----------------------------------------------------------------------
ARR22_ARATH     ----------------------------------------------------------------------
SAER_STAES      ----------------------------------------------------------------------
SAER_STAEQ      ----------------------------------------------------------------------
GACA_PSEU2      ----------------------------------------------------------------------
FIMZ_ECOLI      ----------------------------------------------------------------------
FIMZ_ECO57      ----------------------------------------------------------------------
ENVZ_SALTY      ----------------------------------------------------------------------
ENVZ_SALTI      ----------------------------------------------------------------------
CHEY_SHIFL      ----------------------------------------------------------------------
CHEY_PSEAE      ----------------------------------------------------------------------
CHEY_ENTCL      ----------------------------------------------------------------------
CHEY_ECOLI      ----------------------------------------------------------------------
CHEY_ECO57      ----------------------------------------------------------------------
CHEB_RHOPS      ----------------------------------------------------------------------
CHEB2_GEOSL     ----------------------------------------------------------------------
CHEB1_SYNAS     ----------------------------------------------------------------------
CHEB1_RHOFD     ----------------------------------------------------------------------
CHEB1_RHIME     ----------------------------------------------------------------------
YXDK_BACSU      ----------------------------------------------------------------------
NODW_BRAJA      ----------------------------------------------------------------------
DCTB_RHILE      ----------------------------------------------------------------------
CHEB_SHEFN      ----------------------------------------------------------------------
CHEB_NITHX      ----------------------------------------------------------------------
CHEB2_RHOPA     ----------------------------------------------------------------------
YCCH_BACSU      ----------------------------------------------------------------------
REGA_RHOCA      ----------------------------------------------------------------------
PKHA7_HUMAN     -------------------------------------DLLKDRSLKPVKIAESDTDVKEQDRVLQDLALK
MALR_BACSU      ----------------------------------------------------------------------
LYTR_STRA5      ----------------------------------------------------------------------
LYTR_STRA3      ----------------------------------------------------------------------
FIXJ_BRAJA      ----------------------------------------------------------------------
DEGU_BACSU      ----------------------------------------------------------------------
CHEB_METFK      ----------------------------------------------------------------------
CHEB1_METHJ     ----------------------------------------------------------------------
YPH5_THIVI      ----------------------------------------------------------------------
VIRG_RHIRD      ----------------------------------------------------------------------
PFES_PSEAE      ----------------------------------------------------------------------
GACA_PSEFL      ----------------------------------------------------------------------
CHEB_MOOTA      ----------------------------------------------------------------------
VIRG_AGRT9      ----------------------------------------------------------------------
PRR1_SCHPO      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
GACA_PSEAE      ----------------------------------------------------------------------
DLTS_STRA5      ----------------------------------------------------------------------
CYAD_DICDI      ----------------------------------------------------------------------
CHEB_CHRSD      ----------------------------------------------------------------------
CHEB3_MAGSA     ----------------------------------------------------------------------
CHEB3_GEOMG     ----------------------------------------------------------------------
PHYD_ARATH      ----------------------------------------------------------------------
KINA_BACSU      ----------------------------------------------------------------------
CHEB3_RHOPB     ----------------------------------------------------------------------
CHEB1_BURTA     ----------------------------------------------------------------------
CHEB1_BURPS     ----------------------------------------------------------------------
CHEB1_BURP1     ----------------------------------------------------------------------
CHEB1_BURMA     ----------------------------------------------------------------------
YCF29_GUITH     ----------------------------------------------------------------------
CHEB3_RHORT     ----------------------------------------------------------------------
CHEB3_PSESM     ----------------------------------------------------------------------
Y0G0_VIBCH      ----------------------------------------------------------------------
MCPB_BACSU      ----------------------------------------------------------------------
MALK_BACSU      ----------------------------------------------------------------------
CHEB_RALSO      ----------------------------------------------------------------------
CHEB_PSEHT      ----------------------------------------------------------------------
CHEB_NITMU      ----------------------------------------------------------------------
CHEB3_PSE14     ----------------------------------------------------------------------
CHEB2_PSEU2     ----------------------------------------------------------------------
CHEB2_BURTA     ----------------------------------------------------------------------
CHEB2_BORA1     ----------------------------------------------------------------------
YFIK_BACSU      ----------------------------------------------------------------------
NUF2_CANAL      ----------------------------LKDNQDNLDELTRKQMELEGQILIVQNQLNKSNKKYQDLIVQ
NARP_HAEIN      ----------------------------------------------------------------------
LYTR_STRMU      ----------------------------------------------------------------------
GACA_PSEVI      ----------------------------------------------------------------------
DLTS_STRA3      ----------------------------------------------------------------------
CHEB_NOSP7      ----------------------------------------------------------------------
CHEB_GEOKA      ----------------------------------------------------------------------
CHEB_BORPE      ----------------------------------------------------------------------
CHEB_BORPA      ----------------------------------------------------------------------
CHEB_BORBR      ----------------------------------------------------------------------
CHEB3_PSEAE     ----------------------------------------------------------------------
CHEB2_XANC8     ----------------------------------------------------------------------
CHEB2_SYNWW     ----------------------------------------------------------------------
CHEB1_XANCP     ----------------------------------------------------------------------
CHEB1_CHRVO     ----------------------------------------------------------------------
CHEA_LISMO      ----------------------------------------------------------------------
ARR19_ARATH     ----------------------------------------------------------------------
ARR13_ARATH     ----------------------------------------------------------------------
PMRA_PECCC      ----------------------------------------------------------------------
PKHA7_MOUSE     -------------------------------------DLLKDRSLKPMKIAESDIDVKLSIFCEQDRILQ
DCTR_RHOCA      ----------------------------------------------------------------------
DCTD_RHILE      ----------------------------------------------------------------------
CHEB_THICR      ----------------------------------------------------------------------
CHEB3_VIBCH     ----------------------------------------------------------------------
CHEB2_XANOR     ----------------------------------------------------------------------
CHEB2_XANOM     ----------------------------------------------------------------------
CHEB2_RALEJ     ----------------------------------------------------------------------
CHEB2_BRAJA     ----------------------------------------------------------------------
CHEB1_XANC5     ----------------------------------------------------------------------
CHEB1_XANAC     ----------------------------------------------------------------------
CHEB1_MYXXD     ----------------------------------------------------------------------
CHEB1_DESVH     ----------------------------------------------------------------------
CPS_CLOTH       ----------------------------------------------------------------------
CHEB_SHISS      ----------------------------------------------------------------------
CHEB_SHIFL      ----------------------------------------------------------------------
CHEB_SHIBS      ----------------------------------------------------------------------
CHEB_SALTY      ----------------------------------------------------------------------
CHEB_SALTI      ----------------------------------------------------------------------
CHEB_SALPA      ----------------------------------------------------------------------
CHEB_SALCH      ----------------------------------------------------------------------
CHEB_MARMM      ----------------------------------------------------------------------
CHEB_HALMA      ----------------------------------------------------------------------
CHEB_ENTCL      ----------------------------------------------------------------------
CHEB_ECOUT      ----------------------------------------------------------------------
CHEB_ECOLI      ----------------------------------------------------------------------
CHEB_ECOL6      ----------------------------------------------------------------------
CHEB_ECOL5      ----------------------------------------------------------------------
CHEB_ECO57      ----------------------------------------------------------------------
CHEB2_PHOPR     ----------------------------------------------------------------------
CHEB1_PSEPF     ----------------------------------------------------------------------
CHEB1_BURCA     ----------------------------------------------------------------------
CHEB1_ACIBL     ----------------------------------------------------------------------
CHEA_THEMA      ----------------------------------------------------------------------
REGA_RHOS4      ----------------------------------------------------------------------
PHYA_ARATH      ----------------------------------------------------------------------
KIF15_HUMAN     ---------------------------------------------------TLKSDLNNLMELLEAEKER
GLNL_BACSU      ----------------------------------------------------------------------
CHEB_YERPS      ----------------------------------------------------------------------
CHEB_YERPN      ----------------------------------------------------------------------
CHEB_YERPE      ----------------------------------------------------------------------
CHEB_YERPA      ----------------------------------------------------------------------
CHEB_PHOLL      ----------------------------------------------------------------------
CHEB_BURXL      ----------------------------------------------------------------------
CHEB2_CAUCR     ----------------------------------------------------------------------
CHEB2_ANADE     ----------------------------------------------------------------------
CHEB1_ANADE     ----------------------------------------------------------------------
NTRX_AZOC5      ----------------------------------------------------------------------
LIAS_BACSU      ----------------------------------------------------------------------
CTRA_OCHA4      ----------------------------------------------------------------------
CTRA_BRUSU      ----------------------------------------------------------------------
CTRA_BRUSI      ----------------------------------------------------------------------
CTRA_BRUO2      ----------------------------------------------------------------------
CTRA_BRUME      ----------------------------------------------------------------------
CTRA_BRUC2      ----------------------------------------------------------------------
CTRA_BRUAB      ----------------------------------------------------------------------
CTRA_BRUA2      ----------------------------------------------------------------------
CTRA_BRUA1      ----------------------------------------------------------------------
CHEB4_BURTA     ----------------------------------------------------------------------
CHEB2_PSEAE     ----------------------------------------------------------------------
CHEB2_BURPS     ----------------------------------------------------------------------
CHEB2_BURP1     ----------------------------------------------------------------------
CHEB2_BURMA     ----------------------------------------------------------------------
CHEB1_RALME     ----------------------------------------------------------------------
NREB_STAAW      ----------------------------------------------------------------------
NREB_STAAT      ----------------------------------------------------------------------
NREB_STAAS      ----------------------------------------------------------------------
NREB_STAAR      ----------------------------------------------------------------------
NREB_STAAN      ----------------------------------------------------------------------
NREB_STAAM      ----------------------------------------------------------------------
NREB_STAAE      ----------------------------------------------------------------------
NREB_STAAC      ----------------------------------------------------------------------
NREB_STAAB      ----------------------------------------------------------------------
NREB_STAA9      ----------------------------------------------------------------------
NREB_STAA8      ----------------------------------------------------------------------
NREB_STAA3      ----------------------------------------------------------------------
NREB_STAA2      ----------------------------------------------------------------------
NREB_STAA1      ----------------------------------------------------------------------
NARL_SHIFL      ----------------------------------------------------------------------
NARL_ECOLI      ----------------------------------------------------------------------
NARL_ECOL6      ----------------------------------------------------------------------
NARL_ECO57      ----------------------------------------------------------------------
LYTT_ENTFA      ----------------------------------------------------------------------
HUPR_RHOCA      ----------------------------------------------------------------------
CHEB_ERWCT      ----------------------------------------------------------------------
CHEB3_BURS3     ----------------------------------------------------------------------
CHEB2_RALME     ----------------------------------------------------------------------
CHEB2_METAC     ----------------------------------------------------------------------
CHEB1_GEOMG     ----------------------------------------------------------------------
Y899_CHLAA      ----------------------------------------------------------------------
NREB_STACT      ----------------------------------------------------------------------
MTRA_MYCTU      ----------------------------------------------------------------------
MTRA_MYCPA      ----------------------------------------------------------------------
MTRA_MYCLE      ----------------------------------------------------------------------
MTRA_MYCBO      ----------------------------------------------------------------------
LYTS_STAS1      ----------------------------------------------------------------------
LMNB1_HUMAN     ----------------------------------------------------------------------
DCUR_SHIFL      ----------------------------------------------------------------------
CHEB_RHILO      ----------------------------------------------------------------------
CHEB2_VIBVY     ----------------------------------------------------------------------
CHEB2_VIBVU     ----------------------------------------------------------------------
CHEB2_CHRVO     ----------------------------------------------------------------------
CHEB1_BURS3     ----------------------------------------------------------------------
CHEA_LISIN      ----------------------------------------------------------------------
BAER_ECOLI      ----------------------------------------------------------------------
BAER_ECOL6      ----------------------------------------------------------------------
YESN_BACSU      ----------------------------------------------------------------------
PYRB_CLOPS      ------------------------ALCGDLKFGRTVHSLIKSRYKKFILISPIELRIPN---YIREQILE
PYRB_CLOPE      ------------------------ALCGDLKFGRTVHSLIKSRYKKFILISPIELRIPN---YIREQILE
PYRB_CLOP1      ------------------------ALCGDLKFGRTVHSLIKSRYKKFILISPIELRIPN---YIREQILE
GRAS_STAS1      ----------------------------------------------------------------------
DCUS_SHIFL      ----------------------------------------------------------------------
DCUS_ECOLI      ----------------------------------------------------------------------
DCUS_ECOL6      ----------------------------------------------------------------------
DCUS_ECO57      ----------------------------------------------------------------------
DCUR_ECOLI      ----------------------------------------------------------------------
DCUR_ECO57      ----------------------------------------------------------------------
CHEB3_LEPIN     ----------------------------------------------------------------------
CHEB3_LEPIC     ----------------------------------------------------------------------
CHEB2_SHESR     ----------------------------------------------------------------------
CHEB2_SHESM     ----------------------------------------------------------------------
CHEB2_RHORT     ----------------------------------------------------------------------
CHEB2_PSESM     ----------------------------------------------------------------------
CHEB2_BURCA     ----------------------------------------------------------------------
CHEB1_VIBVY     ----------------------------------------------------------------------
CHEB1_VIBVU     ----------------------------------------------------------------------
CHEB1_PSEF5     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DNNTDLEIYNKMEESNKQILGAISALEKVSEVDELKQLTTEVKTAFNEYLKIEKTIYSLVQAGRRDEAKA
LUXQ_VIBPA      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
LUXQ_VIBVY      ----------------------------------------------------------------------
LUXQ_VIBVU      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
ARCB_SHIFL      ----------------------------------------------------------------------
ARCB_ECOLI      ----------------------------------------------------------------------
ARCB_ECO57      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
GACS_PSESY      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
BVGS_BORPE      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
TCSA_EMENI      ----------------------------------------------------------------------
DOKA_DICDI      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
MAK2_SCHPO      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
ETR1_PASED      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
DHKL_DICDI      ----------------------------------------------------------------------
ETR1_PELHO      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
DHKF_DICDI      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
MAK1_SCHPO      ----------------------------------------------------------------------
PLEC_CAUCR      ----------------------------------------------------------------------
ERS1_ARATH      ----------------------------------------------------------------------
TORS_ECOLI      ----------------------------------------------------------------------
EVGS_ECOLI      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
ETR1_ARATH      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------
ETR1_BRAOL      ----------------------------------------------------------------------
DSPA_SYNY3      ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
PHOR_BACSU      ----------------------------------------------------------------------
SAES_STAAE      ----------------------------------------------------------------------
SAES_STAAC      ----------------------------------------------------------------------
SAES_STAA8      ----------------------------------------------------------------------
SAES_STAA3      ----------------------------------------------------------------------
ARCB_HAEIN      ----------------------------------------------------------------------
SASA_SYNJA      ----------------------------------------------------------------------
SAES_STAAR      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
DIVL_CAUCR      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SASA_CYAA5      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SAES_STAAW      ----------------------------------------------------------------------
SAES_STAAS      ----------------------------------------------------------------------
SAES_STAAN      ----------------------------------------------------------------------
SAES_STAAM      ----------------------------------------------------------------------
SAES_STAAB      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_THEEB      ----------------------------------------------------------------------
PHOR_ECOLI      ----------------------------------------------------------------------
WALK_STAHJ      ----------------------------------------------------------------------
WALK_STAAR      ----------------------------------------------------------------------
WALK_STAAW      ----------------------------------------------------------------------
WALK_STAAU      ----------------------------------------------------------------------
WALK_STAAT      ----------------------------------------------------------------------
WALK_STAAS      ----------------------------------------------------------------------
WALK_STAAN      ----------------------------------------------------------------------
WALK_STAAM      ----------------------------------------------------------------------
WALK_STAAE      ----------------------------------------------------------------------
WALK_STAAC      ----------------------------------------------------------------------
WALK_STAAB      ----------------------------------------------------------------------
WALK_STAA9      ----------------------------------------------------------------------
WALK_STAA8      ----------------------------------------------------------------------
WALK_STAA3      ----------------------------------------------------------------------
WALK_STAA2      ----------------------------------------------------------------------
WALK_STAA1      ----------------------------------------------------------------------
YCF26_PORYE     ----------------------------------------------------------------------
YYCG_BACSU      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
WALK_STASR      ----------------------------------------------------------------------
PHOR_SHIDY      ----------------------------------------------------------------------
WALK_STAS1      -------------------------IEKVYDEDNAINAQKEVQNLLNEYAEIEEIRFQIIMATSKQSTRS
PHOR_KLEPN      ----------------------------------------------------------------------
SASA_SYNJB      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
YCF29_PORYE     ----------------------------------------------------------------------
BAES_ECOLI      ----------------------------------------------------------------------
Y851_SYNP2      ----------------------------------------------------------------------
SASA_PROMA      ----------------------------------------------------------------------
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
LUXN_VIBHB      ----------------------------------------------------------------------
LUXN_VIBHA      ----------------------------------------------------------------------
YSO1_PLEBO      ----------------------------------------------------------------------
WALK_STAES      SVNAQKDIQDLLNEANRQEIGEIRFIDK----DQIIMATTKQSNRGLINQKVDGSVQKALSLGQTNDHMV
WALK_STAEQ      SVNAQKDIQDLLNEANRQEIGEIRFIDK----DQIIMATTKQSNRGLINQKVDGSVQKALSLGQTNDHMV
SEX3_MYCLE      ----------------------------------------------------------------------
MTRB_MYCPA      ----------------------------------------------------------------------
EVGS_ECO57      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
PILH_PSEAE      ----------------------------------------------------------------------
MTRB_MYCLE      ----------------------------------------------------------------------
SASA_SYNE7      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------
PHOR_HAEIN      ----------------------------------------------------------------------
DIVK_OCHA4      ----------------------------------------------------------------------
DHKM_DICDI      ----------------------------------------------------------------------
YFHK_ECOLI      ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SASA_SYNS3      ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
ARLS_STAS1      ----------------------------------------------------------------------
SRRA_STAAW      ----------------------------------------------------------------------
SRRA_STAAU      ----------------------------------------------------------------------
SRRA_STAAS      ----------------------------------------------------------------------
SRRA_STAAR      ----------------------------------------------------------------------
SRRA_STAAN      ----------------------------------------------------------------------
SRRA_STAAM      ----------------------------------------------------------------------
SRRA_STAAC      ----------------------------------------------------------------------
SRRA_STAA8      ----------------------------------------------------------------------
MTRB_MYCTU      ----------------------------------------------------------------------
MTRB_MYCBO      ----------------------------------------------------------------------
KDPD_ECOLI      ----------------------------------------------------------------------
EIN4_ARATH      ----------------------------------------------------------------------
DHKH_DICDI      ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
DIVK_BRUSU      ----------------------------------------------------------------------
DIVK_BRUSI      ----------------------------------------------------------------------
DIVK_BRUO2      ----------------------------------------------------------------------
DIVK_BRUME      ----------------------------------------------------------------------
DIVK_BRUC2      ----------------------------------------------------------------------
DIVK_BRUAB      ----------------------------------------------------------------------
DIVK_BRUA2      ----------------------------------------------------------------------
DIVK_BRUA1      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
RSSA_SERMA      ----------------------------------------------------------------------
OMPR_SHIFL      ----------------------------------------------------------------------
OMPR_SALTY      ----------------------------------------------------------------------
OMPR_SALTI      ----------------------------------------------------------------------
OMPR_ECOLI      ----------------------------------------------------------------------
OMPR_ECOL6      ----------------------------------------------------------------------
OMPR_ECO57      ----------------------------------------------------------------------
YYCF_BACSU      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
HSSR_STAES      ----------------------------------------------------------------------
HSSR_STAEQ      ----------------------------------------------------------------------
CQSS_VIBHB      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
MAK3_SCHPO      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
YCF27_CYAPA     ----------------------------------------------------------------------
ARLS_STAHJ      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_MICAN      ----------------------------------------------------------------------
HSSR_STAHJ      ----------------------------------------------------------------------
HSSR_STAAR      ----------------------------------------------------------------------
HSSR_STAAB      ----------------------------------------------------------------------
SASA_CYAP8      ----------------------------------------------------------------------
HSSR_STAAW      ----------------------------------------------------------------------
HSSR_STAAT      ----------------------------------------------------------------------
HSSR_STAAS      ----------------------------------------------------------------------
HSSR_STAAN      ----------------------------------------------------------------------
HSSR_STAAM      ----------------------------------------------------------------------
HSSR_STAA9      ----------------------------------------------------------------------
HSSR_STAA8      ----------------------------------------------------------------------
HSSR_STAA3      ----------------------------------------------------------------------
HSSR_STAA2      ----------------------------------------------------------------------
HSSR_STAA1      ----------------------------------------------------------------------
ZRAS_ECOLI      ----------------------------------------------------------------------
WALR_STAS1      ----------------------------------------------------------------------
VANS_ENTFC      ----------------------------------------------------------------------
PHOB_RHIME      ----------------------------------------------------------------------
PHOB_HAEIN      ----------------------------------------------------------------------
ARLS_STAES      ----------------------------------------------------------------------
PHOR_PSEAE      ----------------------------------------------------------------------
HSSR_STAAE      ----------------------------------------------------------------------
HSSR_STAAC      ----------------------------------------------------------------------
CQSS_VIBCH      ----------------------------------------------------------------------
WALR_STAES      ----------------------------------------------------------------------
WALR_STAEQ      ----------------------------------------------------------------------
WALR_STAAW      ----------------------------------------------------------------------
WALR_STAAU      ----------------------------------------------------------------------
WALR_STAAT      ----------------------------------------------------------------------
WALR_STAAS      ----------------------------------------------------------------------
WALR_STAAR      ----------------------------------------------------------------------
WALR_STAAN      ----------------------------------------------------------------------
WALR_STAAM      ----------------------------------------------------------------------
WALR_STAAE      ----------------------------------------------------------------------
WALR_STAAC      ----------------------------------------------------------------------
WALR_STAAB      ----------------------------------------------------------------------
WALR_STAA9      ----------------------------------------------------------------------
WALR_STAA8      ----------------------------------------------------------------------
WALR_STAA3      ----------------------------------------------------------------------
WALR_STAA2      ----------------------------------------------------------------------
WALR_STAA1      ----------------------------------------------------------------------
YKOH_BACSU      ----------------------------------------------------------------------
YEDW_ECOLI      ----------------------------------------------------------------------
SASA_SYNY3      ----------------------------------------------------------------------
SASA_CYAP7      ----------------------------------------------------------------------
DLTR_STRA5      ----------------------------------------------------------------------
DLTR_STRA3      ----------------------------------------------------------------------
ARLR_STAS1      ----------------------------------------------------------------------
YCLK_BACSU      ----------------------------------------------------------------------
YCF27_PORPU     ----------------------------------------------------------------------
WALR_STAHJ      ----------------------------------------------------------------------
GTCR_ANEMI      ----------------------------------------------------------------------
ARLS_STAEQ      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
CZCR_RALME      ----------------------------------------------------------------------
ZRAS_ECO57      ----------------------------------------------------------------------
YKOG_BACSU      ----------------------------------------------------------------------
YCF27_GUITH     ----------------------------------------------------------------------
ZRAR_KLEOX      ----------------------------------------------------------------------
YCF27_PORYE     ----------------------------------------------------------------------
DHKG_DICDI      ----------------------------------------------------------------------
YCF27_CYACA     ----------------------------------------------------------------------
VIRA_AGRT5      ----------------------------------------------------------------------
SASA_NOSP7      ----------------------------------------------------------------------
SAER_STAAW      ----------------------------------------------------------------------
SAER_STAAS      ----------------------------------------------------------------------
SAER_STAAR      ----------------------------------------------------------------------
SAER_STAAN      ----------------------------------------------------------------------
SAER_STAAM      ----------------------------------------------------------------------
SAER_STAAE      ----------------------------------------------------------------------
SAER_STAAC      ----------------------------------------------------------------------
SAER_STAAB      ----------------------------------------------------------------------
SAER_STAA8      ----------------------------------------------------------------------
SAER_STAA3      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
PHOB_PSEAE      ----------------------------------------------------------------------
YEDV_ECOLI      ----------------------------------------------------------------------
YCF27_PORAE     ----------------------------------------------------------------------
RESD_BACSU      ----------------------------------------------------------------------
SASA_SYNS9      ----------------------------------------------------------------------
PHOP_BACSU      ----------------------------------------------------------------------
YCF27_GALSU     ----------------------------------------------------------------------
YCBM_BACSU      ----------------------------------------------------------------------
SILR_SALTY      ----------------------------------------------------------------------
YVRH_BACSU      ----------------------------------------------------------------------
HSSR_STAS1      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
PHY1_SELMA      ----------------------------------------------------------------------
MPRA_MYCVP      ----------------------------------------------------------------------
CUSR_ECOLI      ----------------------------------------------------------------------
CUSR_ECOL6      ----------------------------------------------------------------------
CUSR_ECO57      ----------------------------------------------------------------------
CPXR_HAEIN      ----------------------------------------------------------------------
COPR_PSESM      ----------------------------------------------------------------------
HSSS_STAAR      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
ATOS_ECOLI      ----------------------------------------------------------------------
PRR73_ORYSJ     ----------------------------------------------------------------------
PRR37_ORYSJ     ----------------------------------------------------------------------
PRR37_ORYSI     ----------------------------------------------------------------------
HSSS_STAAW      ----------------------------------------------------------------------
HSSS_STAAS      ----------------------------------------------------------------------
YCF29_PORPU     ----------------------------------------------------------------------
YBDJ_BACSU      ----------------------------------------------------------------------
SASA_ANASP      ----------------------------------------------------------------------
PRR73_ORYSI     ----------------------------------------------------------------------
HSSS_STAAT      ----------------------------------------------------------------------
HSSS_STAAE      ----------------------------------------------------------------------
HSSS_STAAC      ----------------------------------------------------------------------
HSSS_STAA8      ----------------------------------------------------------------------
HSSS_STAA3      ----------------------------------------------------------------------
CHEB_ARCFU      ----------------------------------------------------------------------
APRR7_ARATH     ----------------------------------------------------------------------
SASA_ANAVT      ----------------------------------------------------------------------
RPRX_BACFR      ----------------------------------------------------------------------
HSSS_STAAN      ----------------------------------------------------------------------
HSSS_STAAM      ----------------------------------------------------------------------
HSSS_STAA9      ----------------------------------------------------------------------
HSSS_STAA2      ----------------------------------------------------------------------
HSSS_STAA1      ----------------------------------------------------------------------
CZCS_RALME      ----------------------------------------------------------------------
ATOC_ECOLI      ----------------------------------------------------------------------
CHEY_CAMJJ      ----------------------------------------------------------------------
CHEY_CAMJE      ----------------------------------------------------------------------
CHEY_CAMJ8      ----------------------------------------------------------------------
CHEB_NOCSJ      ----------------------------------------------------------------------
ARLS_STAAW      ----------------------------------------------------------------------
ARLS_STAAS      ----------------------------------------------------------------------
ARLS_STAAR      ----------------------------------------------------------------------
ARLS_STAAN      ----------------------------------------------------------------------
ARLS_STAAM      ----------------------------------------------------------------------
ARLS_STAAC      ----------------------------------------------------------------------
ARLS_STAAB      ----------------------------------------------------------------------
ARLS_STAA8      ----------------------------------------------------------------------
ARLS_STAA3      ----------------------------------------------------------------------
PCOR_ECOLX      ----------------------------------------------------------------------
HSSS_STAAB      ----------------------------------------------------------------------
APRR1_ARATH     ----------------------------------------------------------------------
QSEB_ECOLI      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
MPRA_MYCSS      ----------------------------------------------------------------------
MPRA_MYCSK      ----------------------------------------------------------------------
MPRA_MYCSJ      ----------------------------------------------------------------------
IRLR_BURPS      ----------------------------------------------------------------------
SKN7_YEAST      ----------------------------------------------------------------------
RSTB_ECOLI      ----------------------------------------------------------------------
CHEY_RHIEC      ----------------------------------------------------------------------
ZRAR_SALTY      ----------------------------------------------------------------------
ZRAR_SALTI      ----------------------------------------------------------------------
YVRG_BACSU      ----------------------------------------------------------------------
SPAR_BACSU      ----------------------------------------------------------------------
RPFG_XANC8      ----------------------------------------------------------------------
REGX3_MYCS2     ----------------------------------------------------------------------
QSEB_ECO57      ----------------------------------------------------------------------
PCOS_ECOLX      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
MCS4_SCHPO      ----------------------------------------------------------------------
KINC_BACSU      ----------------------------------------------------------------------
KDPD_CLOAB      ----------------------------------------------------------------------
CHEY_TREPA      ----------------------------------------------------------------------
SPHR_SYNE7      ----------------------------------------------------------------------
QSEB_HAEIN      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
MPRA_MYCUA      ----------------------------------------------------------------------
ARR3_ARATH      ----------------------------------------------------------------------
YRKP_BACSU      ----------------------------------------------------------------------
SSK1_YEAST      ----------------------------------------------------------------------
MPRB_MYCVP      ----------------------------------------------------------------------
MPRA_MYCLE      ----------------------------------------------------------------------
CHVG_RHIME      ----------------------------------------------------------------------
PILR_PSEAE      ----------------------------------------------------------------------
PATA_ANASP      ----------------------------------------------------------------------
MPRA_MYCS2      ----------------------------------------------------------------------
MPRA_MYCPA      ----------------------------------------------------------------------
MPRA_MYCBP      ----------------------------------------------------------------------
MPRA_MYCBO      ----------------------------------------------------------------------
MPRA_MYCA1      ----------------------------------------------------------------------
APRR5_ARATH     ----------------------------------------------------------------------
AFSQ1_STRCO     ----------------------------------------------------------------------
CHEB2_CARHZ     ----------------------------------------------------------------------
TORR_ECOLI      ----------------------------------------------------------------------
MPRA_MYCTU      ----------------------------------------------------------------------
MPRA_MYCTA      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
ARR4_ARATH      ----------------------------------------------------------------------
TORR_ECO57      ----------------------------------------------------------------------
QSEB_SALTY      ----------------------------------------------------------------------
QSEB_SALTI      ----------------------------------------------------------------------
PHOB_SHIFL      ----------------------------------------------------------------------
PHOB_SHIDY      ----------------------------------------------------------------------
PHOB_ECOLI      ----------------------------------------------------------------------
PHOB_ECO57      ----------------------------------------------------------------------
CHVI_RHISN      ----------------------------------------------------------------------
CHVI_RHIME      ----------------------------------------------------------------------
APRR9_ARATH     ----------------------------------------------------------------------
VANR_ENTFC      ----------------------------------------------------------------------
PHOB_KLEPN      ----------------------------------------------------------------------
CHVI_RHIRD      ----------------------------------------------------------------------
CHEB2_RHOCS     ----------------------------------------------------------------------
PHY_MOUSC       ----------------------------------------------------------------------
KDPD_RATRA      ----------------------------------------------------------------------
CHEY_HELPY      ----------------------------------------------------------------------
CHEB3_GEOSL     ----------------------------------------------------------------------
VANR_ENTFA      ----------------------------------------------------------------------
SP0A_MOOTA      ----------------------------------------------------------------------
SP0A_BACME      ----------------------------------------------------------------------
SP0A_BACCI      ----------------------------------------------------------------------
NTRC_ECOLI      ----------------------------------------------------------------------
NTRC_ECO57      ----------------------------------------------------------------------
CHEB1_SYNWW     ----------------------------------------------------------------------
YCBL_BACSU      ----------------------------------------------------------------------
PRR95_ORYSJ     ----------------------------------------------------------------------
PDTAR_MYCTU     ----------------------------------------------------------------------
IRLS_BURPS      ----------------------------------------------------------------------
CHEY_HELPJ      ----------------------------------------------------------------------
REGX3_MYCTU     ----------------------------------------------------------------------
REGX3_MYCBO     ----------------------------------------------------------------------
CHEB_BACSU      ----------------------------------------------------------------------
CHEB2_GEOMG     ----------------------------------------------------------------------
CHEB2_AZOBR     ----------------------------------------------------------------------
BASS_SALTY      ----------------------------------------------------------------------
ARR10_ARATH     ----------------------------------------------------------------------
ARLR_STAHJ      ----------------------------------------------------------------------
VIRAL_RHIRD     ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
CHVG_AGRT5      ----------------------------------------------------------------------
ARR8_ARATH      ----------------------------------------------------------------------
ARR17_ARATH     ----------------------------------------------------------------------
ARR12_ARATH     ----------------------------------------------------------------------
ZRAS_KLEOX      ----------------------------------------------------------------------
YCLJ_BACSU      ----------------------------------------------------------------------
TCTD_SALTY      ----------------------------------------------------------------------
PILG_PSEAE      ----------------------------------------------------------------------
PHY2_CERPU      ----------------------------------------------------------------------
SPAK_BACSU      ----------------------------------------------------------------------
SP0A_BACTU      ----------------------------------------------------------------------
SP0A_BACSU      ----------------------------------------------------------------------
SP0A_BACCR      ----------------------------------------------------------------------
RPRY_BACFR      ----------------------------------------------------------------------
PRR1_ORYSJ      ----------------------------------------------------------------------
NTRC_SALTY      ----------------------------------------------------------------------
NTRC_BRASR      ----------------------------------------------------------------------
NODV_BRAJA      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
CPXR_SHIFL      ----------------------------------------------------------------------
CPXR_ECOLI      ----------------------------------------------------------------------
CPXR_ECO57      ----------------------------------------------------------------------
CITS_BACSU      ----------------------------------------------------------------------
SP0A_BACAN      ----------------------------------------------------------------------
PHYB_ANASP      ----------------------------------------------------------------------
PDE2_DICDI      ----------------------------------------------------------------------
NTRC_PROVU      ----------------------------------------------------------------------
CUSS_ECO57      ----------------------------------------------------------------------
CHEY_BACSU      ----------------------------------------------------------------------
PFER_PSEAE      ----------------------------------------------------------------------
HSSS_STAHJ      ----------------------------------------------------------------------
BASS_ECOLI      ----------------------------------------------------------------------
ARR5_ARATH      ----------------------------------------------------------------------
ARCA_SHIFL      ----------------------------------------------------------------------
ARCA_ECOLI      ----------------------------------------------------------------------
ARCA_ECOL6      ----------------------------------------------------------------------
ARCA_ECO57      ----------------------------------------------------------------------
VIRA_AGRT9      ----------------------------------------------------------------------
NTRC_AZOC5      ----------------------------------------------------------------------
KDPD_MYCTU      ----------------------------------------------------------------------
GRAR_STAS1      ----------------------------------------------------------------------
DCTR_BACSU      ----------------------------------------------------------------------
CUSS_ECOLI      ----------------------------------------------------------------------
CHEY_THEMA      ----------------------------------------------------------------------
CHEB_TREDE      ----------------------------------------------------------------------
ARR9_ARATH      ----------------------------------------------------------------------
ARR6_ARATH      ----------------------------------------------------------------------
ARR1_ARATH      ----------------------------------------------------------------------
NTRC_KLEPN      ----------------------------------------------------------------------
DPIB_ECOLI      ----------------------------------------------------------------------
CUSS_ECOL6      ----------------------------------------------------------------------
BCER_BACHD      ----------------------------------------------------------------------
SPHS_SYNE7      ----------------------------------------------------------------------
PHY1_PHYPA      ----------------------------------------------------------------------
NTRB_AZOBR      ----------------------------------------------------------------------
GRAR_STAHJ      ----------------------------------------------------------------------
GRAR_STAES      ----------------------------------------------------------------------
GRAR_STAEQ      ----------------------------------------------------------------------
DCTS_RHOCA      ----------------------------------------------------------------------
REGX3_MYCLE     ----------------------------------------------------------------------
PHYB_TOBAC      ----------------------------------------------------------------------
CHEB_TRIEI      ----------------------------------------------------------------------
BPHY_DEIRA      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
ARR2_ARATH      ----------------------------------------------------------------------
ZRAR_ECOLI      ----------------------------------------------------------------------
ZRAR_ECO57      ----------------------------------------------------------------------
VIRAW_RHIRD     ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
ARR14_ARATH     ----------------------------------------------------------------------
ARLR_STAEQ      ----------------------------------------------------------------------
APRR3_ARATH     ----------------------------------------------------------------------
AFSQ2_STRCO     ----------------------------------------------------------------------
SP0F_BACSU      ----------------------------------------------------------------------
SP0A_BREPA      ----------------------------------------------------------------------
PHY_PICAB       ----------------------------------------------------------------------
CIAR_STRR6      ----------------------------------------------------------------------
CIAR_STRPN      ----------------------------------------------------------------------
CHEY_LISMO      ----------------------------------------------------------------------
CHEY_LISIN      ----------------------------------------------------------------------
CHEB_METBU      ----------------------------------------------------------------------
CHEB_BACLD      ----------------------------------------------------------------------
CHEB1_AGRT5     ----------------------------------------------------------------------
ARLR_STAES      ----------------------------------------------------------------------
YVCP_BACSU      ----------------------------------------------------------------------
SP0A_CLOB8      ----------------------------------------------------------------------
NTRXL_RICPR     ----------------------------------------------------------------------
HNR_SHIFL       ----------------------------------------------------------------------
HNR_ECOLI       ----------------------------------------------------------------------
HNR_ECO57       ----------------------------------------------------------------------
FIXL_AZOC5      ----------------------------------------------------------------------
CYAB_STIAU      ----------------------------------------------------------------------
CSEB_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
CHEB_ALHEH      ----------------------------------------------------------------------
ARR11_ARATH     ----------------------------------------------------------------------
ARLR_STAAW      ----------------------------------------------------------------------
ARLR_STAAS      ----------------------------------------------------------------------
ARLR_STAAR      ----------------------------------------------------------------------
ARLR_STAAN      ----------------------------------------------------------------------
ARLR_STAAM      ----------------------------------------------------------------------
ARLR_STAAC      ----------------------------------------------------------------------
ARLR_STAAB      ----------------------------------------------------------------------
ARLR_STAA8      ----------------------------------------------------------------------
ARLR_STAA3      ----------------------------------------------------------------------
SP0A_BACST      ----------------------------------------------------------------------
PHOP_SALCH      ----------------------------------------------------------------------
NTRXL_RICTY     ----------------------------------------------------------------------
NTRXL_RICFE     ----------------------------------------------------------------------
MPRB_MYCLE      ----------------------------------------------------------------------
CSSR_BACSU      ----------------------------------------------------------------------
CSEB_STRAW      ----------------------------------------------------------------------
VIRG_AGRT5      ----------------------------------------------------------------------
RCAC_FREDI      ----------------------------------------------------------------------
NTRC_RHIME      ----------------------------------------------------------------------
NTRC_AZOBR      ----------------------------------------------------------------------
GRAS_STAES      ----------------------------------------------------------------------
GRAS_STAEQ      ----------------------------------------------------------------------
CHEB_PELCD      ----------------------------------------------------------------------
CHEB2_ACIBL     ----------------------------------------------------------------------
LOVHK_PSE14     ----------------------------------------------------------------------
GRAR_STAAW      ----------------------------------------------------------------------
GRAR_STAAT      ----------------------------------------------------------------------
GRAR_STAAS      ----------------------------------------------------------------------
GRAR_STAAR      ----------------------------------------------------------------------
GRAR_STAAN      ----------------------------------------------------------------------
GRAR_STAAM      ----------------------------------------------------------------------
GRAR_STAAE      ----------------------------------------------------------------------
GRAR_STAAC      ----------------------------------------------------------------------
GRAR_STAAB      ----------------------------------------------------------------------
GRAR_STAA9      ----------------------------------------------------------------------
GRAR_STAA8      ----------------------------------------------------------------------
GRAR_STAA3      ----------------------------------------------------------------------
GRAR_STAA2      ----------------------------------------------------------------------
GRAR_STAA1      ----------------------------------------------------------------------
ALGB_PSESM      ----------------------------------------------------------------------
NTRXL_RICCN     ----------------------------------------------------------------------
ARR21_ARATH     ----------------------------------------------------------------------
ALGB_PSEPK      ----------------------------------------------------------------------
TRPO_PSEAE      ----------------------------------------------------------------------
SP0A_BACSH      ----------------------------------------------------------------------
FIMZ_SALTY      ----------------------------------------------------------------------
DCTR_BACME      ----------------------------------------------------------------------
DCTB_RHIME      ----------------------------------------------------------------------
CITT_BACHD      ----------------------------------------------------------------------
CHEB3_RHOPA     ----------------------------------------------------------------------
CHEB1_GEOSL     ----------------------------------------------------------------------
ARR18_ARATH     ----------------------------------------------------------------------
PHYB_SOLTU      ----------------------------------------------------------------------
MPRB_MYCUA      ----------------------------------------------------------------------
MPRB_MYCTU      ----------------------------------------------------------------------
MPRB_MYCTA      ----------------------------------------------------------------------
FIXL_BRAJA      ----------------------------------------------------------------------
CHEB_METMP      ----------------------------------------------------------------------
CHEB_DESHY      ----------------------------------------------------------------------
CHEB3_BURTA     ----------------------------------------------------------------------
CHEB2_RHOSH     ----------------------------------------------------------------------
CHEB2_RHOS4     ----------------------------------------------------------------------
ALGB_PSEAE      ----------------------------------------------------------------------
Y2151_LEPIN     ----------------------------------------------------------------------
Y1769_LEPIC     ----------------------------------------------------------------------
SILS_SALTY      ----------------------------------------------------------------------
RCP1_SYNY3      ----------------------------------------------------------------------
PHY_PINSY       ----------------------------------------------------------------------
MPRB_MYCBP      ----------------------------------------------------------------------
MPRB_MYCBO      ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------------
CHEB_TREPA      ----------------------------------------------------------------------
CHEB_PSEA6      ----------------------------------------------------------------------
CHEB5_GEOMG     ----------------------------------------------------------------------
CHEB1_RHORT     ----------------------------------------------------------------------
ARR7_ARATH      ----------------------------------------------------------------------
HOXA_RALEH      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
CHEB1_METMA     ----------------------------------------------------------------------
Y3689_SHEFN     ----------------------------------------------------------------------
PHYB_ORYSJ      ----------------------------------------------------------------------
PHYB1_SOLLC     ----------------------------------------------------------------------
NTRB_VIBAL      ----------------------------------------------------------------------
KDPE_ECOLI      ----------------------------------------------------------------------
DCTR_BACHD      ----------------------------------------------------------------------
CHEB_SYMTH      ----------------------------------------------------------------------
CHEB_CLOAB      ----------------------------------------------------------------------
CHEB_BACHD      ----------------------------------------------------------------------
CHEB1_MAGSA     ----------------------------------------------------------------------
YHCZ_BACSU      ----------------------------------------------------------------------
PRRA_MYCLE      ----------------------------------------------------------------------
PHYB_ORYSI      ----------------------------------------------------------------------
NTRB_KLEOX      ----------------------------------------------------------------------
MPRB_MYCSS      ----------------------------------------------------------------------
MPRB_MYCSK      ----------------------------------------------------------------------
MPRB_MYCSJ      ----------------------------------------------------------------------
ETR2_ARATH      ----------------------------------------------------------------------
DEGU_BREBE      ----------------------------------------------------------------------
CHEB_DESPS      ----------------------------------------------------------------------
VANS_ENTFA      ----------------------------------------------------------------------
RSTA_ECOLI      ----------------------------------------------------------------------
PHOP_SHIFL      ----------------------------------------------------------------------
PHOP_ECOLI      ----------------------------------------------------------------------
PHOP_ECOL6      ----------------------------------------------------------------------
NTRXL_RICBR     ----------------------------------------------------------------------
NISR_LACLA      ----------------------------------------------------------------------
EHD1_ORYSJ      ----------------------------------------------------------------------
EHD1_ORYSI      ----------------------------------------------------------------------
DCTS_BACSU      ----------------------------------------------------------------------
CHEB_PYRAB      ----------------------------------------------------------------------
CHEB_OCEIH      ----------------------------------------------------------------------
CHEB1_SACD2     ----------------------------------------------------------------------
ARR16_ARATH     ----------------------------------------------------------------------
VIRG_AGRRH      ----------------------------------------------------------------------
PRRA_MYCTU      ----------------------------------------------------------------------
PRRA_MYCBO      ----------------------------------------------------------------------
PHOQ_SALTY      ----------------------------------------------------------------------
PHOQ_SALTI      ----------------------------------------------------------------------
PHOQ_SALPA      ----------------------------------------------------------------------
PHOQ_SALCH      ----------------------------------------------------------------------
NTRC_RHOCA      ----------------------------------------------------------------------
CREB_ECOLI      ----------------------------------------------------------------------
CHEB5_ANADE     ----------------------------------------------------------------------
CHEB3_BRAJA     ----------------------------------------------------------------------
ARR20_ARATH     ----------------------------------------------------------------------
YXDJ_BACSU      ----------------------------------------------------------------------
SP0F_BACTK      ----------------------------------------------------------------------
PHYB_ARATH      ----------------------------------------------------------------------
NTRB_SALTY      ----------------------------------------------------------------------
NTRB_SALTI      ----------------------------------------------------------------------
LOVHK_PSESM     ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CSEC_STRCO      ----------------------------------------------------------------------
SP0A_CLODI      ----------------------------------------------------------------------
PHYB_SORBI      ----------------------------------------------------------------------
PHOP_ECO57      ----------------------------------------------------------------------
CSEC_STRAW      ----------------------------------------------------------------------
CHEV_BACSU      ----------------------------------------------------------------------
CHEB_THEMA      ----------------------------------------------------------------------
CHEB1_DECAR     ----------------------------------------------------------------------
CHEB1_CAUCR     ----------------------------------------------------------------------
CHEB1_CARHZ     ----------------------------------------------------------------------
NTRB_SHIFL      ----------------------------------------------------------------------
NTRB_ECOLI      ----------------------------------------------------------------------
NTRB_ECO57      ----------------------------------------------------------------------
LYTT_BACSU      ----------------------------------------------------------------------
GRAS_STAHJ      ----------------------------------------------------------------------
ENVZ_SHIFL      ----------------------------------------------------------------------
ENVZ_ECOLI      ----------------------------------------------------------------------
COPS_PSESM      ----------------------------------------------------------------------
CHEB_THETN      ----------------------------------------------------------------------
CHEB_SULDN      ----------------------------------------------------------------------
CHEB_NITWN      ----------------------------------------------------------------------
PHOP_SALTY      ----------------------------------------------------------------------
PHOP_SALTI      ----------------------------------------------------------------------
PHOP_SALPA      ----------------------------------------------------------------------
CHEB_PYRKO      ----------------------------------------------------------------------
CHEB_PYRHO      ----------------------------------------------------------------------
CHEB1_RHIEC     ----------------------------------------------------------------------
CHEB1_LEPIN     ----------------------------------------------------------------------
CHEB1_LEPIC     ----------------------------------------------------------------------
BCER_BACSU      ----------------------------------------------------------------------
UVRY_SHIFL      ----------------------------------------------------------------------
UVRY_ECOLI      ----------------------------------------------------------------------
SP0A_CLOAB      ----------------------------------------------------------------------
LOVHK_PSEU2     ----------------------------------------------------------------------
FIXL_RHIME      ----------------------------------------------------------------------
CHEY_YEREN      ----------------------------------------------------------------------
ARR15_ARATH     ----------------------------------------------------------------------
YFHA_ECOLI      ----------------------------------------------------------------------
YFHA_ECO57      ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
PILS_PSEAE      ----------------------------------------------------------------------
NTRY_AZOBR      ----------------------------------------------------------------------
CITS_BACHD      ----------------------------------------------------------------------
CHEB_NITEU      ----------------------------------------------------------------------
CHEB_LAWIP      ----------------------------------------------------------------------
CHEB_HALSA      ----------------------------------------------------------------------
CHEB1_RHIL3     ----------------------------------------------------------------------
YCF29_CYAPA     ----------------------------------------------------------------------
PHOQ_SHIFL      ----------------------------------------------------------------------
PHOQ_ECOLI      ----------------------------------------------------------------------
PHOQ_ECOL6      ----------------------------------------------------------------------
DCTS_BACHD      ----------------------------------------------------------------------
CHEB_RHOP2      ----------------------------------------------------------------------
CHEB_IDILO      ----------------------------------------------------------------------
CHEB3_RHOSH     ----------------------------------------------------------------------
ARCA_HAEIN      ----------------------------------------------------------------------
PHOQ_ECO57      ----------------------------------------------------------------------
LYTT_BACCR      ----------------------------------------------------------------------
HOXA_BRAJA      ----------------------------------------------------------------------
CHEB_SALRD      ----------------------------------------------------------------------
CHEB3_HAHCH     ----------------------------------------------------------------------
CHEB1_METAC     ----------------------------------------------------------------------
YDFI_BACSU      ----------------------------------------------------------------------
Y4XI_RHISN      ----------------------------------------------------------------------
SP0A_CLOPA      ----------------------------------------------------------------------
PETR_RHOCA      ----------------------------------------------------------------------
NTRB_RHOCA      ----------------------------------------------------------------------
NTRB_RHILP      ----------------------------------------------------------------------
GRAS_STAAW      ----------------------------------------------------------------------
GRAS_STAAT      ----------------------------------------------------------------------
GRAS_STAAS      ----------------------------------------------------------------------
GRAS_STAAN      ----------------------------------------------------------------------
GRAS_STAAM      ----------------------------------------------------------------------
GRAS_STAAE      ----------------------------------------------------------------------
GRAS_STAAC      ----------------------------------------------------------------------
GRAS_STAAB      ----------------------------------------------------------------------
GRAS_STAA9      ----------------------------------------------------------------------
GRAS_STAA8      ----------------------------------------------------------------------
GRAS_STAA3      ----------------------------------------------------------------------
GRAS_STAA2      ----------------------------------------------------------------------
GRAS_STAA1      ----------------------------------------------------------------------
CHEY_ECOL6      ----------------------------------------------------------------------
CHEB_THIDA      ----------------------------------------------------------------------
CHEB_NATPD      ----------------------------------------------------------------------
CHEB6_ANADE     ----------------------------------------------------------------------
CHEB3_CHRVO     ----------------------------------------------------------------------
CHEB2_RHIL3     ----------------------------------------------------------------------
CHEB1_RHOS4     ----------------------------------------------------------------------
CHEB1_DESDG     ----------------------------------------------------------------------
BASR_SALTY      ----------------------------------------------------------------------
BASR_ECOLI      ----------------------------------------------------------------------
UVRY_ECOL6      ----------------------------------------------------------------------
UVRY_ECO57      ----------------------------------------------------------------------
NTRB_PROVU      ----------------------------------------------------------------------
LYTT_BACAN      ----------------------------------------------------------------------
KIND_BACSU      ----------------------------------------------------------------------
CITA_KLEPN      ----------------------------------------------------------------------
CHEB_ROSDO      ----------------------------------------------------------------------
CHEB2_DESVH     ----------------------------------------------------------------------
CHEB2_DESDG     ----------------------------------------------------------------------
CHEB1_RHOPB     ----------------------------------------------------------------------
BVGA_BORPE      ----------------------------------------------------------------------
BVGA_BORPA      ----------------------------------------------------------------------
BVGA_BORBR      ----------------------------------------------------------------------
PHYC_SORBI      ----------------------------------------------------------------------
NTRB_BRASR      ----------------------------------------------------------------------
NARP_ECOLI      ----------------------------------------------------------------------
LIAR_BACSU      ----------------------------------------------------------------------
DEGM_BACB2      ----------------------------------------------------------------------
CHEY_YERPE      ----------------------------------------------------------------------
CHEY_SALTY      ----------------------------------------------------------------------
CHEY_SALTI      ----------------------------------------------------------------------
CHEB3_SYNWW     ----------------------------------------------------------------------
CHEB2_METHJ     ----------------------------------------------------------------------
CHEB1_HAHCH     ----------------------------------------------------------------------
CCDB_BACSU      ----------------------------------------------------------------------
BPHY_PSEAE      ----------------------------------------------------------------------
ARR22_ARATH     ----------------------------------------------------------------------
SAER_STAES      ----------------------------------------------------------------------
SAER_STAEQ      ----------------------------------------------------------------------
GACA_PSEU2      ----------------------------------------------------------------------
FIMZ_ECOLI      ----------------------------------------------------------------------
FIMZ_ECO57      ----------------------------------------------------------------------
ENVZ_SALTY      ----------------------------------------------------------------------
ENVZ_SALTI      ----------------------------------------------------------------------
CHEY_SHIFL      ----------------------------------------------------------------------
CHEY_PSEAE      ----------------------------------------------------------------------
CHEY_ENTCL      ----------------------------------------------------------------------
CHEY_ECOLI      ----------------------------------------------------------------------
CHEY_ECO57      ----------------------------------------------------------------------
CHEB_RHOPS      ----------------------------------------------------------------------
CHEB2_GEOSL     ----------------------------------------------------------------------
CHEB1_SYNAS     ----------------------------------------------------------------------
CHEB1_RHOFD     ----------------------------------------------------------------------
CHEB1_RHIME     ----------------------------------------------------------------------
YXDK_BACSU      ----------------------------------------------------------------------
NODW_BRAJA      ----------------------------------------------------------------------
DCTB_RHILE      ----------------------------------------------------------------------
CHEB_SHEFN      ----------------------------------------------------------------------
CHEB_NITHX      ----------------------------------------------------------------------
CHEB2_RHOPA     ----------------------------------------------------------------------
YCCH_BACSU      ----------------------------------------------------------------------
REGA_RHOCA      ----------------------------------------------------------------------
PKHA7_HUMAN     ENKDQLELHRQMEQDQPQHLEKIAYQQKLLQEDELSRESTEMENAWNEYLKLENDVEQLKQTLQEQHRRA
MALR_BACSU      ----------------------------------------------------------------------
LYTR_STRA5      ----------------------------------------------------------------------
LYTR_STRA3      ----------------------------------------------------------------------
FIXJ_BRAJA      ----------------------------------------------------------------------
DEGU_BACSU      ----------------------------------------------------------------------
CHEB_METFK      ----------------------------------------------------------------------
CHEB1_METHJ     ----------------------------------------------------------------------
YPH5_THIVI      ----------------------------------------------------------------------
VIRG_RHIRD      ----------------------------------------------------------------------
PFES_PSEAE      ----------------------------------------------------------------------
GACA_PSEFL      ----------------------------------------------------------------------
CHEB_MOOTA      ----------------------------------------------------------------------
VIRG_AGRT9      ----------------------------------------------------------------------
PRR1_SCHPO      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
GACA_PSEAE      ----------------------------------------------------------------------
DLTS_STRA5      ----------------------------------------------------------------------
CYAD_DICDI      ----------------------------------------------------------------------
CHEB_CHRSD      ----------------------------------------------------------------------
CHEB3_MAGSA     ----------------------------------------------------------------------
CHEB3_GEOMG     ----------------------------------------------------------------------
PHYD_ARATH      ----------------------------------------------------------------------
KINA_BACSU      ----------------------------------------------------------------------
CHEB3_RHOPB     ----------------------------------------------------------------------
CHEB1_BURTA     ----------------------------------------------------------------------
CHEB1_BURPS     ----------------------------------------------------------------------
CHEB1_BURP1     ----------------------------------------------------------------------
CHEB1_BURMA     ----------------------------------------------------------------------
YCF29_GUITH     ----------------------------------------------------------------------
CHEB3_RHORT     ----------------------------------------------------------------------
CHEB3_PSESM     ----------------------------------------------------------------------
Y0G0_VIBCH      ----------------------------------------------------------------------
MCPB_BACSU      ----------------------------------------------------------------------
MALK_BACSU      ----------------------------------------------------------------------
CHEB_RALSO      ----------------------------------------------------------------------
CHEB_PSEHT      ----------------------------------------------------------------------
CHEB_NITMU      ----------------------------------------------------------------------
CHEB3_PSE14     ----------------------------------------------------------------------
CHEB2_PSEU2     ----------------------------------------------------------------------
CHEB2_BURTA     ----------------------------------------------------------------------
CHEB2_BORA1     ----------------------------------------------------------------------
YFIK_BACSU      ----------------------------------------------------------------------
NUF2_CANAL      ADKKESAVKLKLEETKQEFNDILSEKEKMDQIVKIQQETTAIQDAFKESKEVELKLINLMSIIKR-----
NARP_HAEIN      ----------------------------------------------------------------------
LYTR_STRMU      ----------------------------------------------------------------------
GACA_PSEVI      ----------------------------------------------------------------------
DLTS_STRA3      ----------------------------------------------------------------------
CHEB_NOSP7      ----------------------------------------------------------------------
CHEB_GEOKA      ----------------------------------------------------------------------
CHEB_BORPE      ----------------------------------------------------------------------
CHEB_BORPA      ----------------------------------------------------------------------
CHEB_BORBR      ----------------------------------------------------------------------
CHEB3_PSEAE     ----------------------------------------------------------------------
CHEB2_XANC8     ----------------------------------------------------------------------
CHEB2_SYNWW     ----------------------------------------------------------------------
CHEB1_XANCP     ----------------------------------------------------------------------
CHEB1_CHRVO     ----------------------------------------------------------------------
CHEA_LISMO      ----------------------------------------------------------------------
ARR19_ARATH     ----------------------------------------------------------------------
ARR13_ARATH     ----------------------------------------------------------------------
PMRA_PECCC      ----------------------------------------------------------------------
PKHA7_MOUSE     DENKDLEVLHRQTEQYRQHLEKITCQQRLLQEDELCRESTEMENAWNEYLKLEKDVEQLKQTLQEQHRRA
DCTR_RHOCA      ----------------------------------------------------------------------
DCTD_RHILE      ----------------------------------------------------------------------
CHEB_THICR      ----------------------------------------------------------------------
CHEB3_VIBCH     ----------------------------------------------------------------------
CHEB2_XANOR     ----------------------------------------------------------------------
CHEB2_XANOM     ----------------------------------------------------------------------
CHEB2_RALEJ     ----------------------------------------------------------------------
CHEB2_BRAJA     ----------------------------------------------------------------------
CHEB1_XANC5     ----------------------------------------------------------------------
CHEB1_XANAC     ----------------------------------------------------------------------
CHEB1_MYXXD     ----------------------------------------------------------------------
CHEB1_DESVH     ----------------------------------------------------------------------
CPS_CLOTH       ----------------------------INETDRIQ--LQELKALWEKYKSLVDKEVELVKSGKTEEARQ
CHEB_SHISS      ----------------------------------------------------------------------
CHEB_SHIFL      ----------------------------------------------------------------------
CHEB_SHIBS      ----------------------------------------------------------------------
CHEB_SALTY      ----------------------------------------------------------------------
CHEB_SALTI      ----------------------------------------------------------------------
CHEB_SALPA      ----------------------------------------------------------------------
CHEB_SALCH      ----------------------------------------------------------------------
CHEB_MARMM      ----------------------------------------------------------------------
CHEB_HALMA      ----------------------------------------------------------------------
CHEB_ENTCL      ----------------------------------------------------------------------
CHEB_ECOUT      ----------------------------------------------------------------------
CHEB_ECOLI      ----------------------------------------------------------------------
CHEB_ECOL6      ----------------------------------------------------------------------
CHEB_ECOL5      ----------------------------------------------------------------------
CHEB_ECO57      ----------------------------------------------------------------------
CHEB2_PHOPR     ----------------------------------------------------------------------
CHEB1_PSEPF     ----------------------------------------------------------------------
CHEB1_BURCA     ----------------------------------------------------------------------
CHEB1_ACIBL     ----------------------------------------------------------------------
CHEA_THEMA      ----------------------------------------------------------------------
REGA_RHOS4      ----------------------------------------------------------------------
PHYA_ARATH      ----------------------------------------------------------------------
KIF15_HUMAN     NNKLSLQFEEDKENSSKEILKVLEAVEKQKETAKCEQQMAKVQKLEESLLATEKVISSLEKSRDSDKKVV
GLNL_BACSU      ----------------------------------------------------------------------
CHEB_YERPS      ----------------------------------------------------------------------
CHEB_YERPN      ----------------------------------------------------------------------
CHEB_YERPE      ----------------------------------------------------------------------
CHEB_YERPA      ----------------------------------------------------------------------
CHEB_PHOLL      ----------------------------------------------------------------------
CHEB_BURXL      ----------------------------------------------------------------------
CHEB2_CAUCR     ----------------------------------------------------------------------
CHEB2_ANADE     ----------------------------------------------------------------------
CHEB1_ANADE     ----------------------------------------------------------------------
NTRX_AZOC5      ----------------------------------------------------------------------
LIAS_BACSU      ----------------------------------------------------------------------
CTRA_OCHA4      ----------------------------------------------------------------------
CTRA_BRUSU      ----------------------------------------------------------------------
CTRA_BRUSI      ----------------------------------------------------------------------
CTRA_BRUO2      ----------------------------------------------------------------------
CTRA_BRUME      ----------------------------------------------------------------------
CTRA_BRUC2      ----------------------------------------------------------------------
CTRA_BRUAB      ----------------------------------------------------------------------
CTRA_BRUA2      ----------------------------------------------------------------------
CTRA_BRUA1      ----------------------------------------------------------------------
CHEB4_BURTA     ----------------------------------------------------------------------
CHEB2_PSEAE     ----------------------------------------------------------------------
CHEB2_BURPS     ----------------------------------------------------------------------
CHEB2_BURP1     ----------------------------------------------------------------------
CHEB2_BURMA     ----------------------------------------------------------------------
CHEB1_RALME     ----------------------------------------------------------------------
NREB_STAAW      ----------------------------------------------------------------------
NREB_STAAT      ----------------------------------------------------------------------
NREB_STAAS      ----------------------------------------------------------------------
NREB_STAAR      ----------------------------------------------------------------------
NREB_STAAN      ----------------------------------------------------------------------
NREB_STAAM      ----------------------------------------------------------------------
NREB_STAAE      ----------------------------------------------------------------------
NREB_STAAC      ----------------------------------------------------------------------
NREB_STAAB      ----------------------------------------------------------------------
NREB_STAA9      ----------------------------------------------------------------------
NREB_STAA8      ----------------------------------------------------------------------
NREB_STAA3      ----------------------------------------------------------------------
NREB_STAA2      ----------------------------------------------------------------------
NREB_STAA1      ----------------------------------------------------------------------
NARL_SHIFL      ----------------------------------------------------------------------
NARL_ECOLI      ----------------------------------------------------------------------
NARL_ECOL6      ----------------------------------------------------------------------
NARL_ECO57      ----------------------------------------------------------------------
LYTT_ENTFA      ----------------------------------------------------------------------
HUPR_RHOCA      ----------------------------------------------------------------------
CHEB_ERWCT      ----------------------------------------------------------------------
CHEB3_BURS3     ----------------------------------------------------------------------
CHEB2_RALME     ----------------------------------------------------------------------
CHEB2_METAC     ----------------------------------------------------------------------
CHEB1_GEOMG     ----------------------------------------------------------------------
Y899_CHLAA      ----------------------------------------------------------------------
NREB_STACT      ----------------------------------------------------------------------
MTRA_MYCTU      ----------------------------------------------------------------------
MTRA_MYCPA      ----------------------------------------------------------------------
MTRA_MYCLE      ----------------------------------------------------------------------
MTRA_MYCBO      ----------------------------------------------------------------------
LYTS_STAS1      ----------------------------------------------------------------------
LMNB1_HUMAN     ----------------------------------------------------------------------
DCUR_SHIFL      ----------------------------------------------------------------------
CHEB_RHILO      ----------------------------------------------------------------------
CHEB2_VIBVY     ----------------------------------------------------------------------
CHEB2_VIBVU     ----------------------------------------------------------------------
CHEB2_CHRVO     ----------------------------------------------------------------------
CHEB1_BURS3     ----------------------------------------------------------------------
CHEA_LISIN      ----------------------------------------------------------------------
BAER_ECOLI      ----------------------------------------------------------------------
BAER_ECOL6      ----------------------------------------------------------------------
YESN_BACSU      ----------------------------------------------------------------------
PYRB_CLOPS      KNNIEYKEITSLEEGIKE----------------------------------------------------
PYRB_CLOPE      KNNIEYKEITSLEEGIKE----------------------------------------------------
PYRB_CLOP1      KNNIEYKEITSLEEGIKE----------------------------------------------------
GRAS_STAS1      ----------------------------------------------------------------------
DCUS_SHIFL      ----------------------------------------------------------------------
DCUS_ECOLI      ----------------------------------------------------------------------
DCUS_ECOL6      ----------------------------------------------------------------------
DCUS_ECO57      ----------------------------------------------------------------------
DCUR_ECOLI      ----------------------------------------------------------------------
DCUR_ECO57      ----------------------------------------------------------------------
CHEB3_LEPIN     ----------------------------------------------------------------------
CHEB3_LEPIC     ----------------------------------------------------------------------
CHEB2_SHESR     ----------------------------------------------------------------------
CHEB2_SHESM     ----------------------------------------------------------------------
CHEB2_RHORT     ----------------------------------------------------------------------
CHEB2_PSESM     ----------------------------------------------------------------------
CHEB2_BURCA     ----------------------------------------------------------------------
CHEB1_VIBVY     ----------------------------------------------------------------------
CHEB1_VIBVU     ----------------------------------------------------------------------
CHEB1_PSEF5     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VLYQNASVQTRLKLVQMIDDVGSIQQKQMELTVAQSKDVYNNIVFIFISLVLIGMVLGSGIVVWLIQNIV
LUXQ_VIBPA      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
LUXQ_VIBVY      ----------------------------------------------------------------------
LUXQ_VIBVU      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
ARCB_SHIFL      ----------------------------------------------------------------------
ARCB_ECOLI      ----------------------------------------------------------------------
ARCB_ECO57      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
GACS_PSESY      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
BVGS_BORPE      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
TCSA_EMENI      ----------------------------------------------------------------------
DOKA_DICDI      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
MAK2_SCHPO      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
ETR1_PASED      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
DHKL_DICDI      ----------------------------------------------------------------------
ETR1_PELHO      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
DHKF_DICDI      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
MAK1_SCHPO      ----------------------------------------------------------------------
PLEC_CAUCR      ----------------------------------------------------------------------
ERS1_ARATH      ----------------------------------------------------------------------
TORS_ECOLI      ----------------------------------------------------------------------
EVGS_ECOLI      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
ETR1_ARATH      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------
ETR1_BRAOL      ----------------------------------------------------------------------
DSPA_SYNY3      ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
PHOR_BACSU      ----------------------------------------------------------------------
SAES_STAAE      ----------------------------------------------------------------------
SAES_STAAC      ----------------------------------------------------------------------
SAES_STAA8      ----------------------------------------------------------------------
SAES_STAA3      ----------------------------------------------------------------------
ARCB_HAEIN      ----------------------------------------------------------------------
SASA_SYNJA      ----------------------------------------------------------------------
SAES_STAAR      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
DIVL_CAUCR      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SASA_CYAA5      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SAES_STAAW      ----------------------------------------------------------------------
SAES_STAAS      ----------------------------------------------------------------------
SAES_STAAN      ----------------------------------------------------------------------
SAES_STAAM      ----------------------------------------------------------------------
SAES_STAAB      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_THEEB      ----------------------------------------------------------------------
PHOR_ECOLI      ----------------------------------------------------------------------
WALK_STAHJ      ----------------------------------------------------------------------
WALK_STAAR      ----------------------------------------------------------------------
WALK_STAAW      ----------------------------------------------------------------------
WALK_STAAU      ----------------------------------------------------------------------
WALK_STAAT      ----------------------------------------------------------------------
WALK_STAAS      ----------------------------------------------------------------------
WALK_STAAN      ----------------------------------------------------------------------
WALK_STAAM      ----------------------------------------------------------------------
WALK_STAAE      ----------------------------------------------------------------------
WALK_STAAC      ----------------------------------------------------------------------
WALK_STAAB      ----------------------------------------------------------------------
WALK_STAA9      ----------------------------------------------------------------------
WALK_STAA8      ----------------------------------------------------------------------
WALK_STAA3      ----------------------------------------------------------------------
WALK_STAA2      ----------------------------------------------------------------------
WALK_STAA1      ----------------------------------------------------------------------
YCF26_PORYE     ----------------------------------------------------------------------
YYCG_BACSU      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
WALK_STASR      ----------------------------------------------------------------------
PHOR_SHIDY      ----------------------------------------------------------------------
WALK_STAS1      LINQKASIQKALSLGEILKDYGNGKQRVWNLPVKTSNDVYINDVYNQLSNINQIFIVGTGISL-LITVIL
PHOR_KLEPN      ----------------------------------------------------------------------
SASA_SYNJB      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
YCF29_PORYE     ----------------------------------------------------------------------
BAES_ECOLI      ----------------------------------------------------------------------
Y851_SYNP2      ----------------------------------------------------------------------
SASA_PROMA      ----------------------------------------------------------------------
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
LUXN_VIBHB      ----------------------------------------------------------------------
LUXN_VIBHA      ----------------------------------------------------------------------
YSO1_PLEBO      ----------------------------------------------------------------------
WALK_STAES      LKYGSGKERVWVYNIPVKVDKQTIGDIYIESKINDVYNQLNNINQIFI----VGTAISLFITVILGFFIA
WALK_STAEQ      LKYGSGKERVWVYNIPVKVDKQTIGDIYIESKINDVYNQLNNINQIFI----VGTAISLFITVILGFFIA
SEX3_MYCLE      ----------------------------------------------------------------------
MTRB_MYCPA      ----------------------------------------------------------------------
EVGS_ECO57      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
PILH_PSEAE      ----------------------------------------------------------------------
MTRB_MYCLE      ----------------------------------------------------------------------
SASA_SYNE7      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------
PHOR_HAEIN      ----------------------------------------------------------------------
DIVK_OCHA4      ----------------------------------------------------------------------
DHKM_DICDI      ----------------------------------------------------------------------
YFHK_ECOLI      ----------------------------------------------------------------------
YCF26_PORPU     -------------------------------------------VAVFISIWLM-VILGAAFNAFTITRPI
SASA_SYNS3      ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
ARLS_STAS1      ----------------------------------------------------------------------
SRRA_STAAW      ----------------------------------------------------------------------
SRRA_STAAU      ----------------------------------------------------------------------
SRRA_STAAS      ----------------------------------------------------------------------
SRRA_STAAR      ----------------------------------------------------------------------
SRRA_STAAN      ----------------------------------------------------------------------
SRRA_STAAM      ----------------------------------------------------------------------
SRRA_STAAC      ----------------------------------------------------------------------
SRRA_STAA8      ----------------------------------------------------------------------
MTRB_MYCTU      ----------------------------------------------------------------------
MTRB_MYCBO      ----------------------------------------------------------------------
KDPD_ECOLI      ----------------------------------------------------------------------
EIN4_ARATH      ----------------------------------------------------------------------
DHKH_DICDI      ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
DIVK_BRUSU      ----------------------------------------------------------------------
DIVK_BRUSI      ----------------------------------------------------------------------
DIVK_BRUO2      ----------------------------------------------------------------------
DIVK_BRUME      ----------------------------------------------------------------------
DIVK_BRUC2      ----------------------------------------------------------------------
DIVK_BRUAB      ----------------------------------------------------------------------
DIVK_BRUA2      ----------------------------------------------------------------------
DIVK_BRUA1      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
RSSA_SERMA      ----------------------------------------------------------------------
OMPR_SHIFL      ----------------------------------------------------------------------
OMPR_SALTY      ----------------------------------------------------------------------
OMPR_SALTI      ----------------------------------------------------------------------
OMPR_ECOLI      ----------------------------------------------------------------------
OMPR_ECOL6      ----------------------------------------------------------------------
OMPR_ECO57      ----------------------------------------------------------------------
YYCF_BACSU      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
HSSR_STAES      ----------------------------------------------------------------------
HSSR_STAEQ      ----------------------------------------------------------------------
CQSS_VIBHB      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
MAK3_SCHPO      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
YCF27_CYAPA     ----------------------------------------------------------------------
ARLS_STAHJ      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_MICAN      ----------------------------------------------------------------------
HSSR_STAHJ      ----------------------------------------------------------------------
HSSR_STAAR      ----------------------------------------------------------------------
HSSR_STAAB      ----------------------------------------------------------------------
SASA_CYAP8      ----------------------------------------------------------------------
HSSR_STAAW      ----------------------------------------------------------------------
HSSR_STAAT      ----------------------------------------------------------------------
HSSR_STAAS      ----------------------------------------------------------------------
HSSR_STAAN      ----------------------------------------------------------------------
HSSR_STAAM      ----------------------------------------------------------------------
HSSR_STAA9      ----------------------------------------------------------------------
HSSR_STAA8      ----------------------------------------------------------------------
HSSR_STAA3      ----------------------------------------------------------------------
HSSR_STAA2      ----------------------------------------------------------------------
HSSR_STAA1      ----------------------------------------------------------------------
ZRAS_ECOLI      ----------------------------------------------------------------------
WALR_STAS1      ----------------------------------------------------------------------
VANS_ENTFC      ----------------------------------------------------------------------
PHOB_RHIME      ----------------------------------------------------------------------
PHOB_HAEIN      ----------------------------------------------------------------------
ARLS_STAES      ----------------------------------------------------------------------
PHOR_PSEAE      ----------------------------------------------------------------------
HSSR_STAAE      ----------------------------------------------------------------------
HSSR_STAAC      ----------------------------------------------------------------------
CQSS_VIBCH      ----------------------------------------------------------------------
WALR_STAES      ----------------------------------------------------------------------
WALR_STAEQ      ----------------------------------------------------------------------
WALR_STAAW      ----------------------------------------------------------------------
WALR_STAAU      ----------------------------------------------------------------------
WALR_STAAT      ----------------------------------------------------------------------
WALR_STAAS      ----------------------------------------------------------------------
WALR_STAAR      ----------------------------------------------------------------------
WALR_STAAN      ----------------------------------------------------------------------
WALR_STAAM      ----------------------------------------------------------------------
WALR_STAAE      ----------------------------------------------------------------------
WALR_STAAC      ----------------------------------------------------------------------
WALR_STAAB      ----------------------------------------------------------------------
WALR_STAA9      ----------------------------------------------------------------------
WALR_STAA8      ----------------------------------------------------------------------
WALR_STAA3      ----------------------------------------------------------------------
WALR_STAA2      ----------------------------------------------------------------------
WALR_STAA1      ----------------------------------------------------------------------
YKOH_BACSU      ----------------------------------------------------------------------
YEDW_ECOLI      ----------------------------------------------------------------------
SASA_SYNY3      ----------------------------------------------------------------------
SASA_CYAP7      ----------------------------------------------------------------------
DLTR_STRA5      ----------------------------------------------------------------------
DLTR_STRA3      ----------------------------------------------------------------------
ARLR_STAS1      ----------------------------------------------------------------------
YCLK_BACSU      ----------------------------------------------------------------------
YCF27_PORPU     ----------------------------------------------------------------------
WALR_STAHJ      ----------------------------------------------------------------------
GTCR_ANEMI      ----------------------------------------------------------------------
ARLS_STAEQ      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
CZCR_RALME      ----------------------------------------------------------------------
ZRAS_ECO57      ----------------------------------------------------------------------
YKOG_BACSU      ----------------------------------------------------------------------
YCF27_GUITH     ----------------------------------------------------------------------
ZRAR_KLEOX      ----------------------------------------------------------------------
YCF27_PORYE     ----------------------------------------------------------------------
DHKG_DICDI      ----------------------------------------------------------------------
YCF27_CYACA     ----------------------------------------------------------------------
VIRA_AGRT5      ----------------------------------------------------------------------
SASA_NOSP7      ----------------------------------------------------------------------
SAER_STAAW      ----------------------------------------------------------------------
SAER_STAAS      ----------------------------------------------------------------------
SAER_STAAR      ----------------------------------------------------------------------
SAER_STAAN      ----------------------------------------------------------------------
SAER_STAAM      ----------------------------------------------------------------------
SAER_STAAE      ----------------------------------------------------------------------
SAER_STAAC      ----------------------------------------------------------------------
SAER_STAAB      ----------------------------------------------------------------------
SAER_STAA8      ----------------------------------------------------------------------
SAER_STAA3      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
PHOB_PSEAE      ----------------------------------------------------------------------
YEDV_ECOLI      ----------------------------------------------------------------------
YCF27_PORAE     ----------------------------------------------------------------------
RESD_BACSU      ----------------------------------------------------------------------
SASA_SYNS9      ----------------------------------------------------------------------
PHOP_BACSU      ----------------------------------------------------------------------
YCF27_GALSU     ----------------------------------------------------------------------
YCBM_BACSU      ----------------------------------------------------------------------
SILR_SALTY      ----------------------------------------------------------------------
YVRH_BACSU      ----------------------------------------------------------------------
HSSR_STAS1      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
PHY1_SELMA      ----------------------------------------------------------------------
MPRA_MYCVP      ----------------------------------------------------------------------
CUSR_ECOLI      ----------------------------------------------------------------------
CUSR_ECOL6      ----------------------------------------------------------------------
CUSR_ECO57      ----------------------------------------------------------------------
CPXR_HAEIN      ----------------------------------------------------------------------
COPR_PSESM      ----------------------------------------------------------------------
HSSS_STAAR      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
ATOS_ECOLI      ----------------------------------------------------------------------
PRR73_ORYSJ     ----------------------------------------------------------------------
PRR37_ORYSJ     ----------------------------------------------------------------------
PRR37_ORYSI     ----------------------------------------------------------------------
HSSS_STAAW      ----------------------------------------------------------------------
HSSS_STAAS      ----------------------------------------------------------------------
YCF29_PORPU     ----------------------------------------------------------------------
YBDJ_BACSU      ----------------------------------------------------------------------
SASA_ANASP      ----------------------------------------------------------------------
PRR73_ORYSI     ----------------------------------------------------------------------
HSSS_STAAT      ----------------------------------------------------------------------
HSSS_STAAE      ----------------------------------------------------------------------
HSSS_STAAC      ----------------------------------------------------------------------
HSSS_STAA8      ----------------------------------------------------------------------
HSSS_STAA3      ----------------------------------------------------------------------
CHEB_ARCFU      ----------------------------------------------------------------------
APRR7_ARATH     ----------------------------------------------------------------------
SASA_ANAVT      ----------------------------------------------------------------------
RPRX_BACFR      ----------------------------------------------------------------------
HSSS_STAAN      ----------------------------------------------------------------------
HSSS_STAAM      ----------------------------------------------------------------------
HSSS_STAA9      ----------------------------------------------------------------------
HSSS_STAA2      ----------------------------------------------------------------------
HSSS_STAA1      ----------------------------------------------------------------------
CZCS_RALME      ----------------------------------------------------------------------
ATOC_ECOLI      ----------------------------------------------------------------------
CHEY_CAMJJ      ----------------------------------------------------------------------
CHEY_CAMJE      ----------------------------------------------------------------------
CHEY_CAMJ8      ----------------------------------------------------------------------
CHEB_NOCSJ      ----------------------------------------------------------------------
ARLS_STAAW      ----------------------------------------------------------------------
ARLS_STAAS      ----------------------------------------------------------------------
ARLS_STAAR      ----------------------------------------------------------------------
ARLS_STAAN      ----------------------------------------------------------------------
ARLS_STAAM      ----------------------------------------------------------------------
ARLS_STAAC      ----------------------------------------------------------------------
ARLS_STAAB      ----------------------------------------------------------------------
ARLS_STAA8      ----------------------------------------------------------------------
ARLS_STAA3      ----------------------------------------------------------------------
PCOR_ECOLX      ----------------------------------------------------------------------
HSSS_STAAB      ----------------------------------------------------------------------
APRR1_ARATH     ----------------------------------------------------------------------
QSEB_ECOLI      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
MPRA_MYCSS      ----------------------------------------------------------------------
MPRA_MYCSK      ----------------------------------------------------------------------
MPRA_MYCSJ      ----------------------------------------------------------------------
IRLR_BURPS      ----------------------------------------------------------------------
SKN7_YEAST      ----------------------------------------------------------------------
RSTB_ECOLI      ----------------------------------------------------------------------
CHEY_RHIEC      ----------------------------------------------------------------------
ZRAR_SALTY      ----------------------------------------------------------------------
ZRAR_SALTI      ----------------------------------------------------------------------
YVRG_BACSU      ----------------------------------------------------------------------
SPAR_BACSU      ----------------------------------------------------------------------
RPFG_XANC8      ----------------------------------------------------------------------
REGX3_MYCS2     ----------------------------------------------------------------------
QSEB_ECO57      ----------------------------------------------------------------------
PCOS_ECOLX      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
MCS4_SCHPO      ----------------------------------------------------------------------
KINC_BACSU      ----------------------------------------------------------------------
KDPD_CLOAB      ----------------------------------------------------------------------
CHEY_TREPA      ----------------------------------------------------------------------
SPHR_SYNE7      ----------------------------------------------------------------------
QSEB_HAEIN      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
MPRA_MYCUA      ----------------------------------------------------------------------
ARR3_ARATH      ----------------------------------------------------------------------
YRKP_BACSU      ----------------------------------------------------------------------
SSK1_YEAST      ----------------------------------------------------------------------
MPRB_MYCVP      ----------------------------------------------------------------------
MPRA_MYCLE      ----------------------------------------------------------------------
CHVG_RHIME      ----------------------------------------------------------------------
PILR_PSEAE      ----------------------------------------------------------------------
PATA_ANASP      ----------------------------------------------------------------------
MPRA_MYCS2      ----------------------------------------------------------------------
MPRA_MYCPA      ----------------------------------------------------------------------
MPRA_MYCBP      ----------------------------------------------------------------------
MPRA_MYCBO      ----------------------------------------------------------------------
MPRA_MYCA1      ----------------------------------------------------------------------
APRR5_ARATH     ----------------------------------------------------------------------
AFSQ1_STRCO     ----------------------------------------------------------------------
CHEB2_CARHZ     ----------------------------------------------------------------------
TORR_ECOLI      ----------------------------------------------------------------------
MPRA_MYCTU      ----------------------------------------------------------------------
MPRA_MYCTA      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
ARR4_ARATH      ----------------------------------------------------------------------
TORR_ECO57      ----------------------------------------------------------------------
QSEB_SALTY      ----------------------------------------------------------------------
QSEB_SALTI      ----------------------------------------------------------------------
PHOB_SHIFL      ----------------------------------------------------------------------
PHOB_SHIDY      ----------------------------------------------------------------------
PHOB_ECOLI      ----------------------------------------------------------------------
PHOB_ECO57      ----------------------------------------------------------------------
CHVI_RHISN      ----------------------------------------------------------------------
CHVI_RHIME      ----------------------------------------------------------------------
APRR9_ARATH     ----------------------------------------------------------------------
VANR_ENTFC      ----------------------------------------------------------------------
PHOB_KLEPN      ----------------------------------------------------------------------
CHVI_RHIRD      ----------------------------------------------------------------------
CHEB2_RHOCS     ----------------------------------------------------------------------
PHY_MOUSC       ----------------------------------------------------------------------
KDPD_RATRA      ----------------------------------------------------------------------
CHEY_HELPY      ----------------------------------------------------------------------
CHEB3_GEOSL     ----------------------------------------------------------------------
VANR_ENTFA      ----------------------------------------------------------------------
SP0A_MOOTA      ----------------------------------------------------------------------
SP0A_BACME      ----------------------------------------------------------------------
SP0A_BACCI      ----------------------------------------------------------------------
NTRC_ECOLI      ----------------------------------------------------------------------
NTRC_ECO57      ----------------------------------------------------------------------
CHEB1_SYNWW     ----------------------------------------------------------------------
YCBL_BACSU      ----------------------------------------------------------------------
PRR95_ORYSJ     ----------------------------------------------------------------------
PDTAR_MYCTU     ----------------------------------------------------------------------
IRLS_BURPS      ----------------------------------------------------------------------
CHEY_HELPJ      ----------------------------------------------------------------------
REGX3_MYCTU     ----------------------------------------------------------------------
REGX3_MYCBO     ----------------------------------------------------------------------
CHEB_BACSU      ----------------------------------------------------------------------
CHEB2_GEOMG     ----------------------------------------------------------------------
CHEB2_AZOBR     ----------------------------------------------------------------------
BASS_SALTY      ----------------------------------------------------------------------
ARR10_ARATH     ----------------------------------------------------------------------
ARLR_STAHJ      ----------------------------------------------------------------------
VIRAL_RHIRD     ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
CHVG_AGRT5      ----------------------------------------------------------------------
ARR8_ARATH      ----------------------------------------------------------------------
ARR17_ARATH     ----------------------------------------------------------------------
ARR12_ARATH     ----------------------------------------------------------------------
ZRAS_KLEOX      ----------------------------------------------------------------------
YCLJ_BACSU      ----------------------------------------------------------------------
TCTD_SALTY      ----------------------------------------------------------------------
PILG_PSEAE      ----------------------------------------------------------------------
PHY2_CERPU      ----------------------------------------------------------------------
SPAK_BACSU      ----------------------------------------------------------------------
SP0A_BACTU      ----------------------------------------------------------------------
SP0A_BACSU      ----------------------------------------------------------------------
SP0A_BACCR      ----------------------------------------------------------------------
RPRY_BACFR      ----------------------------------------------------------------------
PRR1_ORYSJ      ----------------------------------------------------------------------
NTRC_SALTY      ----------------------------------------------------------------------
NTRC_BRASR      ----------------------------------------------------------------------
NODV_BRAJA      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
CPXR_SHIFL      ----------------------------------------------------------------------
CPXR_ECOLI      ----------------------------------------------------------------------
CPXR_ECO57      ----------------------------------------------------------------------
CITS_BACSU      ----------------------------------------------------------------------
SP0A_BACAN      ----------------------------------------------------------------------
PHYB_ANASP      ----------------------------------------------------------------------
PDE2_DICDI      ----------------------------------------------------------------------
NTRC_PROVU      ----------------------------------------------------------------------
CUSS_ECO57      ----------------------------------------------------------------------
CHEY_BACSU      ----------------------------------------------------------------------
PFER_PSEAE      ----------------------------------------------------------------------
HSSS_STAHJ      ----------------------------------------------------------------------
BASS_ECOLI      ----------------------------------------------------------------------
ARR5_ARATH      ----------------------------------------------------------------------
ARCA_SHIFL      ----------------------------------------------------------------------
ARCA_ECOLI      ----------------------------------------------------------------------
ARCA_ECOL6      ----------------------------------------------------------------------
ARCA_ECO57      ----------------------------------------------------------------------
VIRA_AGRT9      ----------------------------------------------------------------------
NTRC_AZOC5      ----------------------------------------------------------------------
KDPD_MYCTU      ----------------------------------------------------------------------
GRAR_STAS1      ----------------------------------------------------------------------
DCTR_BACSU      ----------------------------------------------------------------------
CUSS_ECOLI      ----------------------------------------------------------------------
CHEY_THEMA      ----------------------------------------------------------------------
CHEB_TREDE      ----------------------------------------------------------------------
ARR9_ARATH      ----------------------------------------------------------------------
ARR6_ARATH      ----------------------------------------------------------------------
ARR1_ARATH      ----------------------------------------------------------------------
NTRC_KLEPN      ----------------------------------------------------------------------
DPIB_ECOLI      ----------------------------------------------------------------------
CUSS_ECOL6      ----------------------------------------------------------------------
BCER_BACHD      ----------------------------------------------------------------------
SPHS_SYNE7      ----------------------------------------------------------------------
PHY1_PHYPA      ----------------------------------------------------------------------
NTRB_AZOBR      ----------------------------------------------------------------------
GRAR_STAHJ      ----------------------------------------------------------------------
GRAR_STAES      ----------------------------------------------------------------------
GRAR_STAEQ      ----------------------------------------------------------------------
DCTS_RHOCA      ----------------------------------------------------------------------
REGX3_MYCLE     ----------------------------------------------------------------------
PHYB_TOBAC      ----------------------------------------------------------------------
CHEB_TRIEI      ----------------------------------------------------------------------
BPHY_DEIRA      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
ARR2_ARATH      ----------------------------------------------------------------------
ZRAR_ECOLI      ----------------------------------------------------------------------
ZRAR_ECO57      ----------------------------------------------------------------------
VIRAW_RHIRD     ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
ARR14_ARATH     ----------------------------------------------------------------------
ARLR_STAEQ      ----------------------------------------------------------------------
APRR3_ARATH     ----------------------------------------------------------------------
AFSQ2_STRCO     ----------------------------------------------------------------------
SP0F_BACSU      ----------------------------------------------------------------------
SP0A_BREPA      ----------------------------------------------------------------------
PHY_PICAB       ----------------------------------------------------------------------
CIAR_STRR6      ----------------------------------------------------------------------
CIAR_STRPN      ----------------------------------------------------------------------
CHEY_LISMO      ----------------------------------------------------------------------
CHEY_LISIN      ----------------------------------------------------------------------
CHEB_METBU      ----------------------------------------------------------------------
CHEB_BACLD      ----------------------------------------------------------------------
CHEB1_AGRT5     ----------------------------------------------------------------------
ARLR_STAES      ----------------------------------------------------------------------
YVCP_BACSU      ----------------------------------------------------------------------
SP0A_CLOB8      ----------------------------------------------------------------------
NTRXL_RICPR     ----------------------------------------------------------------------
HNR_SHIFL       ----------------------------------------------------------------------
HNR_ECOLI       ----------------------------------------------------------------------
HNR_ECO57       ----------------------------------------------------------------------
FIXL_AZOC5      ----------------------------------------------------------------------
CYAB_STIAU      ----------------------------------------------------------------------
CSEB_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
CHEB_ALHEH      ----------------------------------------------------------------------
ARR11_ARATH     ----------------------------------------------------------------------
ARLR_STAAW      ----------------------------------------------------------------------
ARLR_STAAS      ----------------------------------------------------------------------
ARLR_STAAR      ----------------------------------------------------------------------
ARLR_STAAN      ----------------------------------------------------------------------
ARLR_STAAM      ----------------------------------------------------------------------
ARLR_STAAC      ----------------------------------------------------------------------
ARLR_STAAB      ----------------------------------------------------------------------
ARLR_STAA8      ----------------------------------------------------------------------
ARLR_STAA3      ----------------------------------------------------------------------
SP0A_BACST      ----------------------------------------------------------------------
PHOP_SALCH      ----------------------------------------------------------------------
NTRXL_RICTY     ----------------------------------------------------------------------
NTRXL_RICFE     ----------------------------------------------------------------------
MPRB_MYCLE      ----------------------------------------------------------------------
CSSR_BACSU      ----------------------------------------------------------------------
CSEB_STRAW      ----------------------------------------------------------------------
VIRG_AGRT5      ----------------------------------------------------------------------
RCAC_FREDI      ----------------------------------------------------------------------
NTRC_RHIME      ----------------------------------------------------------------------
NTRC_AZOBR      ----------------------------------------------------------------------
GRAS_STAES      ----------------------------------------------------------------------
GRAS_STAEQ      ----------------------------------------------------------------------
CHEB_PELCD      ----------------------------------------------------------------------
CHEB2_ACIBL     ----------------------------------------------------------------------
LOVHK_PSE14     ----------------------------------------------------------------------
GRAR_STAAW      ----------------------------------------------------------------------
GRAR_STAAT      ----------------------------------------------------------------------
GRAR_STAAS      ----------------------------------------------------------------------
GRAR_STAAR      ----------------------------------------------------------------------
GRAR_STAAN      ----------------------------------------------------------------------
GRAR_STAAM      ----------------------------------------------------------------------
GRAR_STAAE      ----------------------------------------------------------------------
GRAR_STAAC      ----------------------------------------------------------------------
GRAR_STAAB      ----------------------------------------------------------------------
GRAR_STAA9      ----------------------------------------------------------------------
GRAR_STAA8      ----------------------------------------------------------------------
GRAR_STAA3      ----------------------------------------------------------------------
GRAR_STAA2      ----------------------------------------------------------------------
GRAR_STAA1      ----------------------------------------------------------------------
ALGB_PSESM      ----------------------------------------------------------------------
NTRXL_RICCN     ----------------------------------------------------------------------
ARR21_ARATH     ----------------------------------------------------------------------
ALGB_PSEPK      ----------------------------------------------------------------------
TRPO_PSEAE      ----------------------------------------------------------------------
SP0A_BACSH      ----------------------------------------------------------------------
FIMZ_SALTY      ----------------------------------------------------------------------
DCTR_BACME      ----------------------------------------------------------------------
DCTB_RHIME      ----------------------------------------------------------------------
CITT_BACHD      ----------------------------------------------------------------------
CHEB3_RHOPA     ----------------------------------------------------------------------
CHEB1_GEOSL     ----------------------------------------------------------------------
ARR18_ARATH     ----------------------------------------------------------------------
PHYB_SOLTU      ----------------------------------------------------------------------
MPRB_MYCUA      ----------------------------------------------------------------------
MPRB_MYCTU      ----------------------------------------------------------------------
MPRB_MYCTA      ----------------------------------------------------------------------
FIXL_BRAJA      ----------------------------------------------------------------------
CHEB_METMP      ----------------------------------------------------------------------
CHEB_DESHY      ----------------------------------------------------------------------
CHEB3_BURTA     ----------------------------------------------------------------------
CHEB2_RHOSH     ----------------------------------------------------------------------
CHEB2_RHOS4     ----------------------------------------------------------------------
ALGB_PSEAE      ----------------------------------------------------------------------
Y2151_LEPIN     ----------------------------------------------------------------------
Y1769_LEPIC     ----------------------------------------------------------------------
SILS_SALTY      ----------------------------------------------------------------------
RCP1_SYNY3      ----------------------------------------------------------------------
PHY_PINSY       ----------------------------------------------------------------------
MPRB_MYCBP      ----------------------------------------------------------------------
MPRB_MYCBO      ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------------
CHEB_TREPA      ----------------------------------------------------------------------
CHEB_PSEA6      ----------------------------------------------------------------------
CHEB5_GEOMG     ----------------------------------------------------------------------
CHEB1_RHORT     ----------------------------------------------------------------------
ARR7_ARATH      ----------------------------------------------------------------------
HOXA_RALEH      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
CHEB1_METMA     ----------------------------------------------------------------------
Y3689_SHEFN     ----------------------------------------------------------------------
PHYB_ORYSJ      ----------------------------------------------------------------------
PHYB1_SOLLC     ----------------------------------------------------------------------
NTRB_VIBAL      ----------------------------------------------------------------------
KDPE_ECOLI      ----------------------------------------------------------------------
DCTR_BACHD      ----------------------------------------------------------------------
CHEB_SYMTH      ----------------------------------------------------------------------
CHEB_CLOAB      ----------------------------------------------------------------------
CHEB_BACHD      ----------------------------------------------------------------------
CHEB1_MAGSA     ----------------------------------------------------------------------
YHCZ_BACSU      ----------------------------------------------------------------------
PRRA_MYCLE      ----------------------------------------------------------------------
PHYB_ORYSI      ----------------------------------------------------------------------
NTRB_KLEOX      ----------------------------------------------------------------------
MPRB_MYCSS      ----------------------------------------------------------------------
MPRB_MYCSK      ----------------------------------------------------------------------
MPRB_MYCSJ      ----------------------------------------------------------------------
ETR2_ARATH      ----------------------------------------------------------------------
DEGU_BREBE      ----------------------------------------------------------------------
CHEB_DESPS      ----------------------------------------------------------------------
VANS_ENTFA      ----------------------------------------------------------------------
RSTA_ECOLI      ----------------------------------------------------------------------
PHOP_SHIFL      ----------------------------------------------------------------------
PHOP_ECOLI      ----------------------------------------------------------------------
PHOP_ECOL6      ----------------------------------------------------------------------
NTRXL_RICBR     ----------------------------------------------------------------------
NISR_LACLA      ----------------------------------------------------------------------
EHD1_ORYSJ      ----------------------------------------------------------------------
EHD1_ORYSI      ----------------------------------------------------------------------
DCTS_BACSU      ----------------------------------------------------------------------
CHEB_PYRAB      ----------------------------------------------------------------------
CHEB_OCEIH      ----------------------------------------------------------------------
CHEB1_SACD2     ----------------------------------------------------------------------
ARR16_ARATH     ----------------------------------------------------------------------
VIRG_AGRRH      ----------------------------------------------------------------------
PRRA_MYCTU      ----------------------------------------------------------------------
PRRA_MYCBO      ----------------------------------------------------------------------
PHOQ_SALTY      ----------------------------------------------------------------------
PHOQ_SALTI      ----------------------------------------------------------------------
PHOQ_SALPA      ----------------------------------------------------------------------
PHOQ_SALCH      ----------------------------------------------------------------------
NTRC_RHOCA      ----------------------------------------------------------------------
CREB_ECOLI      ----------------------------------------------------------------------
CHEB5_ANADE     ----------------------------------------------------------------------
CHEB3_BRAJA     ----------------------------------------------------------------------
ARR20_ARATH     ----------------------------------------------------------------------
YXDJ_BACSU      ----------------------------------------------------------------------
SP0F_BACTK      ----------------------------------------------------------------------
PHYB_ARATH      ----------------------------------------------------------------------
NTRB_SALTY      ----------------------------------------------------------------------
NTRB_SALTI      ----------------------------------------------------------------------
LOVHK_PSESM     ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CSEC_STRCO      ----------------------------------------------------------------------
SP0A_CLODI      ----------------------------------------------------------------------
PHYB_SORBI      ----------------------------------------------------------------------
PHOP_ECO57      ----------------------------------------------------------------------
CSEC_STRAW      ----------------------------------------------------------------------
CHEV_BACSU      ----------------------------------------------------------------------
CHEB_THEMA      ----------------------------------------------------------------------
CHEB1_DECAR     ----------------------------------------------------------------------
CHEB1_CAUCR     ----------------------------------------------------------------------
CHEB1_CARHZ     ----------------------------------------------------------------------
NTRB_SHIFL      ----------------------------------------------------------------------
NTRB_ECOLI      ----------------------------------------------------------------------
NTRB_ECO57      ----------------------------------------------------------------------
LYTT_BACSU      ----------------------------------------------------------------------
GRAS_STAHJ      ----------------------------------------------------------------------
ENVZ_SHIFL      ----------------------------------------------------------------------
ENVZ_ECOLI      ----------------------------------------------------------------------
COPS_PSESM      ----------------------------------------------------------------------
CHEB_THETN      ----------------------------------------------------------------------
CHEB_SULDN      ----------------------------------------------------------------------
CHEB_NITWN      ----------------------------------------------------------------------
PHOP_SALTY      ----------------------------------------------------------------------
PHOP_SALTI      ----------------------------------------------------------------------
PHOP_SALPA      ----------------------------------------------------------------------
CHEB_PYRKO      ----------------------------------------------------------------------
CHEB_PYRHO      ----------------------------------------------------------------------
CHEB1_RHIEC     ----------------------------------------------------------------------
CHEB1_LEPIN     ----------------------------------------------------------------------
CHEB1_LEPIC     ----------------------------------------------------------------------
BCER_BACSU      ----------------------------------------------------------------------
UVRY_SHIFL      ----------------------------------------------------------------------
UVRY_ECOLI      ----------------------------------------------------------------------
SP0A_CLOAB      ----------------------------------------------------------------------
LOVHK_PSEU2     ----------------------------------------------------------------------
FIXL_RHIME      ----------------------------------------------------------------------
CHEY_YEREN      ----------------------------------------------------------------------
ARR15_ARATH     ----------------------------------------------------------------------
YFHA_ECOLI      ----------------------------------------------------------------------
YFHA_ECO57      ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
PILS_PSEAE      ----------------------------------------------------------------------
NTRY_AZOBR      ----------------------------------------------------------------------
CITS_BACHD      ----------------------------------------------------------------------
CHEB_NITEU      ----------------------------------------------------------------------
CHEB_LAWIP      ----------------------------------------------------------------------
CHEB_HALSA      ----------------------------------------------------------------------
CHEB1_RHIL3     ----------------------------------------------------------------------
YCF29_CYAPA     ----------------------------------------------------------------------
PHOQ_SHIFL      ----------------------------------------------------------------------
PHOQ_ECOLI      ----------------------------------------------------------------------
PHOQ_ECOL6      ----------------------------------------------------------------------
DCTS_BACHD      ----------------------------------------------------------------------
CHEB_RHOP2      ----------------------------------------------------------------------
CHEB_IDILO      ----------------------------------------------------------------------
CHEB3_RHOSH     ----------------------------------------------------------------------
ARCA_HAEIN      ----------------------------------------------------------------------
PHOQ_ECO57      ----------------------------------------------------------------------
LYTT_BACCR      ----------------------------------------------------------------------
HOXA_BRAJA      ----------------------------------------------------------------------
CHEB_SALRD      ----------------------------------------------------------------------
CHEB3_HAHCH     ----------------------------------------------------------------------
CHEB1_METAC     ----------------------------------------------------------------------
YDFI_BACSU      ----------------------------------------------------------------------
Y4XI_RHISN      ----------------------------------------------------------------------
SP0A_CLOPA      ----------------------------------------------------------------------
PETR_RHOCA      ----------------------------------------------------------------------
NTRB_RHOCA      ----------------------------------------------------------------------
NTRB_RHILP      ----------------------------------------------------------------------
GRAS_STAAW      ----------------------------------------------------------------------
GRAS_STAAT      ----------------------------------------------------------------------
GRAS_STAAS      ----------------------------------------------------------------------
GRAS_STAAN      ----------------------------------------------------------------------
GRAS_STAAM      ----------------------------------------------------------------------
GRAS_STAAE      ----------------------------------------------------------------------
GRAS_STAAC      ----------------------------------------------------------------------
GRAS_STAAB      ----------------------------------------------------------------------
GRAS_STAA9      ----------------------------------------------------------------------
GRAS_STAA8      ----------------------------------------------------------------------
GRAS_STAA3      ----------------------------------------------------------------------
GRAS_STAA2      ----------------------------------------------------------------------
GRAS_STAA1      ----------------------------------------------------------------------
CHEY_ECOL6      ----------------------------------------------------------------------
CHEB_THIDA      ----------------------------------------------------------------------
CHEB_NATPD      ----------------------------------------------------------------------
CHEB6_ANADE     ----------------------------------------------------------------------
CHEB3_CHRVO     ----------------------------------------------------------------------
CHEB2_RHIL3     ----------------------------------------------------------------------
CHEB1_RHOS4     ----------------------------------------------------------------------
CHEB1_DESDG     ----------------------------------------------------------------------
BASR_SALTY      ----------------------------------------------------------------------
BASR_ECOLI      ----------------------------------------------------------------------
UVRY_ECOL6      ----------------------------------------------------------------------
UVRY_ECO57      ----------------------------------------------------------------------
NTRB_PROVU      ----------------------------------------------------------------------
LYTT_BACAN      ----------------------------------------------------------------------
KIND_BACSU      ----------------------------------------------------------------------
CITA_KLEPN      ----------------------------------------------------------------------
CHEB_ROSDO      ----------------------------------------------------------------------
CHEB2_DESVH     ----------------------------------------------------------------------
CHEB2_DESDG     ----------------------------------------------------------------------
CHEB1_RHOPB     ----------------------------------------------------------------------
BVGA_BORPE      ----------------------------------------------------------------------
BVGA_BORPA      ----------------------------------------------------------------------
BVGA_BORBR      ----------------------------------------------------------------------
PHYC_SORBI      ----------------------------------------------------------------------
NTRB_BRASR      ----------------------------------------------------------------------
NARP_ECOLI      ----------------------------------------------------------------------
LIAR_BACSU      ----------------------------------------------------------------------
DEGM_BACB2      ----------------------------------------------------------------------
CHEY_YERPE      ----------------------------------------------------------------------
CHEY_SALTY      ----------------------------------------------------------------------
CHEY_SALTI      ----------------------------------------------------------------------
CHEB3_SYNWW     ----------------------------------------------------------------------
CHEB2_METHJ     ----------------------------------------------------------------------
CHEB1_HAHCH     ----------------------------------------------------------------------
CCDB_BACSU      ----------------------------------------------------------------------
BPHY_PSEAE      ----------------------------------------------------------------------
ARR22_ARATH     ----------------------------------------------------------------------
SAER_STAES      ----------------------------------------------------------------------
SAER_STAEQ      ----------------------------------------------------------------------
GACA_PSEU2      ----------------------------------------------------------------------
FIMZ_ECOLI      ----------------------------------------------------------------------
FIMZ_ECO57      ----------------------------------------------------------------------
ENVZ_SALTY      ----------------------------------------------------------------------
ENVZ_SALTI      ----------------------------------------------------------------------
CHEY_SHIFL      ----------------------------------------------------------------------
CHEY_PSEAE      ----------------------------------------------------------------------
CHEY_ENTCL      ----------------------------------------------------------------------
CHEY_ECOLI      ----------------------------------------------------------------------
CHEY_ECO57      ----------------------------------------------------------------------
CHEB_RHOPS      ----------------------------------------------------------------------
CHEB2_GEOSL     ----------------------------------------------------------------------
CHEB1_SYNAS     ----------------------------------------------------------------------
CHEB1_RHOFD     ----------------------------------------------------------------------
CHEB1_RHIME     ----------------------------------------------------------------------
YXDK_BACSU      ----------------------------------------------------------------------
NODW_BRAJA      ----------------------------------------------------------------------
DCTB_RHILE      ----------------------------------------------------------------------
CHEB_SHEFN      ----------------------------------------------------------------------
CHEB_NITHX      ----------------------------------------------------------------------
CHEB2_RHOPA     ----------------------------------------------------------------------
YCCH_BACSU      ----------------------------------------------------------------------
REGA_RHOCA      ----------------------------------------------------------------------
PKHA7_HUMAN     FFFQEKSIQKDLWRIEDVTAGLSANKENFRILVESVKNPERKTVPLF-----------------------
MALR_BACSU      ----------------------------------------------------------------------
LYTR_STRA5      ----------------------------------------------------------------------
LYTR_STRA3      ----------------------------------------------------------------------
FIXJ_BRAJA      ----------------------------------------------------------------------
DEGU_BACSU      ----------------------------------------------------------------------
CHEB_METFK      ----------------------------------------------------------------------
CHEB1_METHJ     ----------------------------------------------------------------------
YPH5_THIVI      ----------------------------------------------------------------------
VIRG_RHIRD      ----------------------------------------------------------------------
PFES_PSEAE      ----------------------------------------------------------------------
GACA_PSEFL      ----------------------------------------------------------------------
CHEB_MOOTA      ----------------------------------------------------------------------
VIRG_AGRT9      ----------------------------------------------------------------------
PRR1_SCHPO      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
GACA_PSEAE      ----------------------------------------------------------------------
DLTS_STRA5      ----------------------------------------------------------------------
CYAD_DICDI      ----------------------------------------------------------------------
CHEB_CHRSD      ----------------------------------------------------------------------
CHEB3_MAGSA     ----------------------------------------------------------------------
CHEB3_GEOMG     ----------------------------------------------------------------------
PHYD_ARATH      ----------------------------------------------------------------------
KINA_BACSU      ----------------------------------------------------------------------
CHEB3_RHOPB     ----------------------------------------------------------------------
CHEB1_BURTA     ----------------------------------------------------------------------
CHEB1_BURPS     ----------------------------------------------------------------------
CHEB1_BURP1     ----------------------------------------------------------------------
CHEB1_BURMA     ----------------------------------------------------------------------
YCF29_GUITH     ----------------------------------------------------------------------
CHEB3_RHORT     ----------------------------------------------------------------------
CHEB3_PSESM     ----------------------------------------------------------------------
Y0G0_VIBCH      ----------------------------------------------------------------------
MCPB_BACSU      ------------------------------------KDASKSVLTTGMIVLIASIVAGGILILFIVRSIT
MALK_BACSU      ----------------------------------------------------------------------
CHEB_RALSO      ----------------------------------------------------------------------
CHEB_PSEHT      ----------------------------------------------------------------------
CHEB_NITMU      ----------------------------------------------------------------------
CHEB3_PSE14     ----------------------------------------------------------------------
CHEB2_PSEU2     ----------------------------------------------------------------------
CHEB2_BURTA     ----------------------------------------------------------------------
CHEB2_BORA1     ----------------------------------------------------------------------
YFIK_BACSU      ----------------------------------------------------------------------
NUF2_CANAL      ----------------------------------------------------------------------
NARP_HAEIN      ----------------------------------------------------------------------
LYTR_STRMU      ----------------------------------------------------------------------
GACA_PSEVI      ----------------------------------------------------------------------
DLTS_STRA3      ----------------------------------------------------------------------
CHEB_NOSP7      ----------------------------------------------------------------------
CHEB_GEOKA      ----------------------------------------------------------------------
CHEB_BORPE      ----------------------------------------------------------------------
CHEB_BORPA      ----------------------------------------------------------------------
CHEB_BORBR      ----------------------------------------------------------------------
CHEB3_PSEAE     ----------------------------------------------------------------------
CHEB2_XANC8     ----------------------------------------------------------------------
CHEB2_SYNWW     ----------------------------------------------------------------------
CHEB1_XANCP     ----------------------------------------------------------------------
CHEB1_CHRVO     ----------------------------------------------------------------------
CHEA_LISMO      ----------------------------------------------------------------------
ARR19_ARATH     ----------------------------------------------------------------------
ARR13_ARATH     ----------------------------------------------------------------------
PMRA_PECCC      ----------------------------------------------------------------------
PKHA7_MOUSE     FFFQEKS---------------------------------------------------------------
DCTR_RHOCA      ----------------------------------------------------------------------
DCTD_RHILE      ----------------------------------------------------------------------
CHEB_THICR      ----------------------------------------------------------------------
CHEB3_VIBCH     ----------------------------------------------------------------------
CHEB2_XANOR     ----------------------------------------------------------------------
CHEB2_XANOM     ----------------------------------------------------------------------
CHEB2_RALEJ     ----------------------------------------------------------------------
CHEB2_BRAJA     ----------------------------------------------------------------------
CHEB1_XANC5     ----------------------------------------------------------------------
CHEB1_XANAC     ----------------------------------------------------------------------
CHEB1_MYXXD     ----------------------------------------------------------------------
CHEB1_DESVH     ----------------------------------------------------------------------
CPS_CLOTH       LLLSD------------IDDIGDTLRDYFEAFVEENKQVASTASTVMIVVIFVGILIAIALGVFISRIIS
CHEB_SHISS      ----------------------------------------------------------------------
CHEB_SHIFL      ----------------------------------------------------------------------
CHEB_SHIBS      ----------------------------------------------------------------------
CHEB_SALTY      ----------------------------------------------------------------------
CHEB_SALTI      ----------------------------------------------------------------------
CHEB_SALPA      ----------------------------------------------------------------------
CHEB_SALCH      ----------------------------------------------------------------------
CHEB_MARMM      ----------------------------------------------------------------------
CHEB_HALMA      ----------------------------------------------------------------------
CHEB_ENTCL      ----------------------------------------------------------------------
CHEB_ECOUT      ----------------------------------------------------------------------
CHEB_ECOLI      ----------------------------------------------------------------------
CHEB_ECOL6      ----------------------------------------------------------------------
CHEB_ECOL5      ----------------------------------------------------------------------
CHEB_ECO57      ----------------------------------------------------------------------
CHEB2_PHOPR     ----------------------------------------------------------------------
CHEB1_PSEPF     ----------------------------------------------------------------------
CHEB1_BURCA     ----------------------------------------------------------------------
CHEB1_ACIBL     ----------------------------------------------------------------------
CHEA_THEMA      ----------------------------------------------------------------------
REGA_RHOS4      ----------------------------------------------------------------------
PHYA_ARATH      ----------------------------------------------------------------------
KIF15_HUMAN     ADLMNQIQELRTSVCEKTETIDTLKQELKDI---------------------------------------
GLNL_BACSU      ----------------------------------------------------------------------
CHEB_YERPS      ----------------------------------------------------------------------
CHEB_YERPN      ----------------------------------------------------------------------
CHEB_YERPE      ----------------------------------------------------------------------
CHEB_YERPA      ----------------------------------------------------------------------
CHEB_PHOLL      ----------------------------------------------------------------------
CHEB_BURXL      ----------------------------------------------------------------------
CHEB2_CAUCR     ----------------------------------------------------------------------
CHEB2_ANADE     ----------------------------------------------------------------------
CHEB1_ANADE     ----------------------------------------------------------------------
NTRX_AZOC5      ----------------------------------------------------------------------
LIAS_BACSU      ----------------------------------------------------------------------
CTRA_OCHA4      ----------------------------------------------------------------------
CTRA_BRUSU      ----------------------------------------------------------------------
CTRA_BRUSI      ----------------------------------------------------------------------
CTRA_BRUO2      ----------------------------------------------------------------------
CTRA_BRUME      ----------------------------------------------------------------------
CTRA_BRUC2      ----------------------------------------------------------------------
CTRA_BRUAB      ----------------------------------------------------------------------
CTRA_BRUA2      ----------------------------------------------------------------------
CTRA_BRUA1      ----------------------------------------------------------------------
CHEB4_BURTA     ----------------------------------------------------------------------
CHEB2_PSEAE     ----------------------------------------------------------------------
CHEB2_BURPS     ----------------------------------------------------------------------
CHEB2_BURP1     ----------------------------------------------------------------------
CHEB2_BURMA     ----------------------------------------------------------------------
CHEB1_RALME     ----------------------------------------------------------------------
NREB_STAAW      ----------------------------------------------------------------------
NREB_STAAT      ----------------------------------------------------------------------
NREB_STAAS      ----------------------------------------------------------------------
NREB_STAAR      ----------------------------------------------------------------------
NREB_STAAN      ----------------------------------------------------------------------
NREB_STAAM      ----------------------------------------------------------------------
NREB_STAAE      ----------------------------------------------------------------------
NREB_STAAC      ----------------------------------------------------------------------
NREB_STAAB      ----------------------------------------------------------------------
NREB_STAA9      ----------------------------------------------------------------------
NREB_STAA8      ----------------------------------------------------------------------
NREB_STAA3      ----------------------------------------------------------------------
NREB_STAA2      ----------------------------------------------------------------------
NREB_STAA1      ----------------------------------------------------------------------
NARL_SHIFL      ----------------------------------------------------------------------
NARL_ECOLI      ----------------------------------------------------------------------
NARL_ECOL6      ----------------------------------------------------------------------
NARL_ECO57      ----------------------------------------------------------------------
LYTT_ENTFA      ----------------------------------------------------------------------
HUPR_RHOCA      ----------------------------------------------------------------------
CHEB_ERWCT      ----------------------------------------------------------------------
CHEB3_BURS3     ----------------------------------------------------------------------
CHEB2_RALME     ----------------------------------------------------------------------
CHEB2_METAC     ----------------------------------------------------------------------
CHEB1_GEOMG     ----------------------------------------------------------------------
Y899_CHLAA      ----------------------------------------------------------------------
NREB_STACT      ----------------------------------------------------------------------
MTRA_MYCTU      ----------------------------------------------------------------------
MTRA_MYCPA      ----------------------------------------------------------------------
MTRA_MYCLE      ----------------------------------------------------------------------
MTRA_MYCBO      ----------------------------------------------------------------------
LYTS_STAS1      ----------------------------------------------------------------------
LMNB1_HUMAN     ----------------------------------------------------------------------
DCUR_SHIFL      ----------------------------------------------------------------------
CHEB_RHILO      ----------------------------------------------------------------------
CHEB2_VIBVY     ----------------------------------------------------------------------
CHEB2_VIBVU     ----------------------------------------------------------------------
CHEB2_CHRVO     ----------------------------------------------------------------------
CHEB1_BURS3     ----------------------------------------------------------------------
CHEA_LISIN      ----------------------------------------------------------------------
BAER_ECOLI      ----------------------------------------------------------------------
BAER_ECOL6      ----------------------------------------------------------------------
YESN_BACSU      ----------------------------------------------------------------------
PYRB_CLOPS      ----------------------------------------------------------------------
PYRB_CLOPE      ----------------------------------------------------------------------
PYRB_CLOP1      ----------------------------------------------------------------------
GRAS_STAS1      ----------------------------------------------------------------------
DCUS_SHIFL      ----------------------------------------------------------------------
DCUS_ECOLI      ----------------------------------------------------------------------
DCUS_ECOL6      ----------------------------------------------------------------------
DCUS_ECO57      ----------------------------------------------------------------------
DCUR_ECOLI      ----------------------------------------------------------------------
DCUR_ECO57      ----------------------------------------------------------------------
CHEB3_LEPIN     ----------------------------------------------------------------------
CHEB3_LEPIC     ----------------------------------------------------------------------
CHEB2_SHESR     ----------------------------------------------------------------------
CHEB2_SHESM     ----------------------------------------------------------------------
CHEB2_RHORT     ----------------------------------------------------------------------
CHEB2_PSESM     ----------------------------------------------------------------------
CHEB2_BURCA     ----------------------------------------------------------------------
CHEB1_VIBVY     ----------------------------------------------------------------------
CHEB1_VIBVU     ----------------------------------------------------------------------
CHEB1_PSEF5     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GNLHRVTLAMKSVSSHKDKTFLPRLDIVSSDEIGKISEVFNDMVEALEQHARQEKEKNLAIQEQHWLKSK
LUXQ_VIBPA      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
LUXQ_VIBVY      ----------------------------------------------------------------------
LUXQ_VIBVU      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
ARCB_SHIFL      ----------------------------------------------------------------------
ARCB_ECOLI      ----------------------------------------------------------------------
ARCB_ECO57      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
GACS_PSESY      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
BVGS_BORPE      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
TCSA_EMENI      ----------------------------------------------------------------------
DOKA_DICDI      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
MAK2_SCHPO      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
ETR1_PASED      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
DHKL_DICDI      ----------------------------------------------------------------------
ETR1_PELHO      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
DHKF_DICDI      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
MAK1_SCHPO      ----------------------------------------------------------------------
PLEC_CAUCR      ----------------------------------------------------------------------
ERS1_ARATH      ----------------------------------------------------------------------
TORS_ECOLI      ----------------------------------------------------------------------
EVGS_ECOLI      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
ETR1_ARATH      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------
ETR1_BRAOL      ----------------------------------------------------------------------
DSPA_SYNY3      ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
PHOR_BACSU      ----------------------------------------------------------------------
SAES_STAAE      ----------------------------------------------------------------------
SAES_STAAC      ----------------------------------------------------------------------
SAES_STAA8      ----------------------------------------------------------------------
SAES_STAA3      ----------------------------------------------------------------------
ARCB_HAEIN      ----------------------------------------------------------------------
SASA_SYNJA      ----------------------------------------------------------------------
SAES_STAAR      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
DIVL_CAUCR      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SASA_CYAA5      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SAES_STAAW      ----------------------------------------------------------------------
SAES_STAAS      ----------------------------------------------------------------------
SAES_STAAN      ----------------------------------------------------------------------
SAES_STAAM      ----------------------------------------------------------------------
SAES_STAAB      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_THEEB      ----------------------------------------------------------------------
PHOR_ECOLI      ----------------------------------------------------------------------
WALK_STAHJ      ----------------------------------------------------------------------
WALK_STAAR      ----------------------------------------------------------------------
WALK_STAAW      ----------------------------------------------------------------------
WALK_STAAU      ----------------------------------------------------------------------
WALK_STAAT      ----------------------------------------------------------------------
WALK_STAAS      ----------------------------------------------------------------------
WALK_STAAN      ----------------------------------------------------------------------
WALK_STAAM      ----------------------------------------------------------------------
WALK_STAAE      ----------------------------------------------------------------------
WALK_STAAC      ----------------------------------------------------------------------
WALK_STAAB      ----------------------------------------------------------------------
WALK_STAA9      ----------------------------------------------------------------------
WALK_STAA8      ----------------------------------------------------------------------
WALK_STAA3      ----------------------------------------------------------------------
WALK_STAA2      ----------------------------------------------------------------------
WALK_STAA1      ----------------------------------------------------------------------
YCF26_PORYE     ----------------------------------------------------------------------
YYCG_BACSU      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
WALK_STASR      ----------------------------------------------------------------------
PHOR_SHIDY      ----------------------------------------------------------------------
WALK_STAS1      GFFIARTIT-KPITDMRNQTYTQRVKIYGNDEIGELALAFNNLSKRVEAQANTESEK-------------
PHOR_KLEPN      ----------------------------------------------------------------------
SASA_SYNJB      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
YCF29_PORYE     ----------------------------------------------------------------------
BAES_ECOLI      ----------------------------------------------------------------------
Y851_SYNP2      ----------------------------------------------------------------------
SASA_PROMA      ----------------------------------------------------------------------
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
LUXN_VIBHB      ----------------------------------------------------------------------
LUXN_VIBHA      ----------------------------------------------------------------------
YSO1_PLEBO      ----------------------------------------------------------------------
WALK_STAES      RTITKPITDMRNQTVEMSKNYTQRVKIYGNDEIGELALAFNNLSKRVEAQANTESEK-------------
WALK_STAEQ      RTITKPITDMRNQTVEMSKNYTQRVKIYGNDEIGELALAFNNLSKRVEAQANTESEK-------------
SEX3_MYCLE      ----------------------------------------------------------------------
MTRB_MYCPA      ----------------------------------------------------------------------
EVGS_ECO57      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
PILH_PSEAE      ----------------------------------------------------------------------
MTRB_MYCLE      ----------------------------------------------------------------------
SASA_SYNE7      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------
PHOR_HAEIN      ----------------------------------------------------------------------
DIVK_OCHA4      ----------------------------------------------------------------------
DHKM_DICDI      ----------------------------------------------------------------------
YFHK_ECOLI      ----------------------------------------------------------------------
YCF26_PORPU     REL------LTGVKNIASGDFYQRIDLPFGGELGALIFNFNEMAERLEKYEQQNVEK---------LTSE
SASA_SYNS3      ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
ARLS_STAS1      ----------------------------------------------------------------------
SRRA_STAAW      ----------------------------------------------------------------------
SRRA_STAAU      ----------------------------------------------------------------------
SRRA_STAAS      ----------------------------------------------------------------------
SRRA_STAAR      ----------------------------------------------------------------------
SRRA_STAAN      ----------------------------------------------------------------------
SRRA_STAAM      ----------------------------------------------------------------------
SRRA_STAAC      ----------------------------------------------------------------------
SRRA_STAA8      ----------------------------------------------------------------------
MTRB_MYCTU      ----------------------------------------------------------------------
MTRB_MYCBO      ----------------------------------------------------------------------
KDPD_ECOLI      ----------------------------------------------------------------------
EIN4_ARATH      ----------------------------------------------------------------------
DHKH_DICDI      ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
DIVK_BRUSU      ----------------------------------------------------------------------
DIVK_BRUSI      ----------------------------------------------------------------------
DIVK_BRUO2      ----------------------------------------------------------------------
DIVK_BRUME      ----------------------------------------------------------------------
DIVK_BRUC2      ----------------------------------------------------------------------
DIVK_BRUAB      ----------------------------------------------------------------------
DIVK_BRUA2      ----------------------------------------------------------------------
DIVK_BRUA1      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
RSSA_SERMA      ----------------------------------------------------------------------
OMPR_SHIFL      ----------------------------------------------------------------------
OMPR_SALTY      ----------------------------------------------------------------------
OMPR_SALTI      ----------------------------------------------------------------------
OMPR_ECOLI      ----------------------------------------------------------------------
OMPR_ECOL6      ----------------------------------------------------------------------
OMPR_ECO57      ----------------------------------------------------------------------
YYCF_BACSU      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
HSSR_STAES      ----------------------------------------------------------------------
HSSR_STAEQ      ----------------------------------------------------------------------
CQSS_VIBHB      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
MAK3_SCHPO      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
YCF27_CYAPA     ----------------------------------------------------------------------
ARLS_STAHJ      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_MICAN      ----------------------------------------------------------------------
HSSR_STAHJ      ----------------------------------------------------------------------
HSSR_STAAR      ----------------------------------------------------------------------
HSSR_STAAB      ----------------------------------------------------------------------
SASA_CYAP8      ----------------------------------------------------------------------
HSSR_STAAW      ----------------------------------------------------------------------
HSSR_STAAT      ----------------------------------------------------------------------
HSSR_STAAS      ----------------------------------------------------------------------
HSSR_STAAN      ----------------------------------------------------------------------
HSSR_STAAM      ----------------------------------------------------------------------
HSSR_STAA9      ----------------------------------------------------------------------
HSSR_STAA8      ----------------------------------------------------------------------
HSSR_STAA3      ----------------------------------------------------------------------
HSSR_STAA2      ----------------------------------------------------------------------
HSSR_STAA1      ----------------------------------------------------------------------
ZRAS_ECOLI      ----------------------------------------------------------------------
WALR_STAS1      ----------------------------------------------------------------------
VANS_ENTFC      ----------------------------------------------------------------------
PHOB_RHIME      ----------------------------------------------------------------------
PHOB_HAEIN      ----------------------------------------------------------------------
ARLS_STAES      ----------------------------------------------------------------------
PHOR_PSEAE      ----------------------------------------------------------------------
HSSR_STAAE      ----------------------------------------------------------------------
HSSR_STAAC      ----------------------------------------------------------------------
CQSS_VIBCH      ----------------------------------------------------------------------
WALR_STAES      ----------------------------------------------------------------------
WALR_STAEQ      ----------------------------------------------------------------------
WALR_STAAW      ----------------------------------------------------------------------
WALR_STAAU      ----------------------------------------------------------------------
WALR_STAAT      ----------------------------------------------------------------------
WALR_STAAS      ----------------------------------------------------------------------
WALR_STAAR      ----------------------------------------------------------------------
WALR_STAAN      ----------------------------------------------------------------------
WALR_STAAM      ----------------------------------------------------------------------
WALR_STAAE      ----------------------------------------------------------------------
WALR_STAAC      ----------------------------------------------------------------------
WALR_STAAB      ----------------------------------------------------------------------
WALR_STAA9      ----------------------------------------------------------------------
WALR_STAA8      ----------------------------------------------------------------------
WALR_STAA3      ----------------------------------------------------------------------
WALR_STAA2      ----------------------------------------------------------------------
WALR_STAA1      ----------------------------------------------------------------------
YKOH_BACSU      ----------------------------------------------------------------------
YEDW_ECOLI      ----------------------------------------------------------------------
SASA_SYNY3      ----------------------------------------------------------------------
SASA_CYAP7      ----------------------------------------------------------------------
DLTR_STRA5      ----------------------------------------------------------------------
DLTR_STRA3      ----------------------------------------------------------------------
ARLR_STAS1      ----------------------------------------------------------------------
YCLK_BACSU      ----------------------------------------------------------------------
YCF27_PORPU     ----------------------------------------------------------------------
WALR_STAHJ      ----------------------------------------------------------------------
GTCR_ANEMI      ----------------------------------------------------------------------
ARLS_STAEQ      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
CZCR_RALME      ----------------------------------------------------------------------
ZRAS_ECO57      ----------------------------------------------------------------------
YKOG_BACSU      ----------------------------------------------------------------------
YCF27_GUITH     ----------------------------------------------------------------------
ZRAR_KLEOX      ----------------------------------------------------------------------
YCF27_PORYE     ----------------------------------------------------------------------
DHKG_DICDI      ----------------------------------------------------------------------
YCF27_CYACA     ----------------------------------------------------------------------
VIRA_AGRT5      ----------------------------------------------------------------------
SASA_NOSP7      ----------------------------------------------------------------------
SAER_STAAW      ----------------------------------------------------------------------
SAER_STAAS      ----------------------------------------------------------------------
SAER_STAAR      ----------------------------------------------------------------------
SAER_STAAN      ----------------------------------------------------------------------
SAER_STAAM      ----------------------------------------------------------------------
SAER_STAAE      ----------------------------------------------------------------------
SAER_STAAC      ----------------------------------------------------------------------
SAER_STAAB      ----------------------------------------------------------------------
SAER_STAA8      ----------------------------------------------------------------------
SAER_STAA3      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
PHOB_PSEAE      ----------------------------------------------------------------------
YEDV_ECOLI      ----------------------------------------------------------------------
YCF27_PORAE     ----------------------------------------------------------------------
RESD_BACSU      ----------------------------------------------------------------------
SASA_SYNS9      ----------------------------------------------------------------------
PHOP_BACSU      ----------------------------------------------------------------------
YCF27_GALSU     ----------------------------------------------------------------------
YCBM_BACSU      ----------------------------------------------------------------------
SILR_SALTY      ----------------------------------------------------------------------
YVRH_BACSU      ----------------------------------------------------------------------
HSSR_STAS1      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
PHY1_SELMA      ----------------------------------------------------------------------
MPRA_MYCVP      ----------------------------------------------------------------------
CUSR_ECOLI      ----------------------------------------------------------------------
CUSR_ECOL6      ----------------------------------------------------------------------
CUSR_ECO57      ----------------------------------------------------------------------
CPXR_HAEIN      ----------------------------------------------------------------------
COPR_PSESM      ----------------------------------------------------------------------
HSSS_STAAR      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
ATOS_ECOLI      ----------------------------------------------------------------------
PRR73_ORYSJ     ----------------------------------------------------------------------
PRR37_ORYSJ     ----------------------------------------------------------------------
PRR37_ORYSI     ----------------------------------------------------------------------
HSSS_STAAW      ----------------------------------------------------------------------
HSSS_STAAS      ----------------------------------------------------------------------
YCF29_PORPU     ----------------------------------------------------------------------
YBDJ_BACSU      ----------------------------------------------------------------------
SASA_ANASP      ----------------------------------------------------------------------
PRR73_ORYSI     ----------------------------------------------------------------------
HSSS_STAAT      ----------------------------------------------------------------------
HSSS_STAAE      ----------------------------------------------------------------------
HSSS_STAAC      ----------------------------------------------------------------------
HSSS_STAA8      ----------------------------------------------------------------------
HSSS_STAA3      ----------------------------------------------------------------------
CHEB_ARCFU      ----------------------------------------------------------------------
APRR7_ARATH     ----------------------------------------------------------------------
SASA_ANAVT      ----------------------------------------------------------------------
RPRX_BACFR      ----------------------------------------------------------------------
HSSS_STAAN      ----------------------------------------------------------------------
HSSS_STAAM      ----------------------------------------------------------------------
HSSS_STAA9      ----------------------------------------------------------------------
HSSS_STAA2      ----------------------------------------------------------------------
HSSS_STAA1      ----------------------------------------------------------------------
CZCS_RALME      ----------------------------------------------------------------------
ATOC_ECOLI      ----------------------------------------------------------------------
CHEY_CAMJJ      ----------------------------------------------------------------------
CHEY_CAMJE      ----------------------------------------------------------------------
CHEY_CAMJ8      ----------------------------------------------------------------------
CHEB_NOCSJ      ----------------------------------------------------------------------
ARLS_STAAW      ----------------------------------------------------------------------
ARLS_STAAS      ----------------------------------------------------------------------
ARLS_STAAR      ----------------------------------------------------------------------
ARLS_STAAN      ----------------------------------------------------------------------
ARLS_STAAM      ----------------------------------------------------------------------
ARLS_STAAC      ----------------------------------------------------------------------
ARLS_STAAB      ----------------------------------------------------------------------
ARLS_STAA8      ----------------------------------------------------------------------
ARLS_STAA3      ----------------------------------------------------------------------
PCOR_ECOLX      ----------------------------------------------------------------------
HSSS_STAAB      ----------------------------------------------------------------------
APRR1_ARATH     ----------------------------------------------------------------------
QSEB_ECOLI      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
MPRA_MYCSS      ----------------------------------------------------------------------
MPRA_MYCSK      ----------------------------------------------------------------------
MPRA_MYCSJ      ----------------------------------------------------------------------
IRLR_BURPS      ----------------------------------------------------------------------
SKN7_YEAST      ----------------------------------------------------------------------
RSTB_ECOLI      ----------------------------------------------------------------------
CHEY_RHIEC      ----------------------------------------------------------------------
ZRAR_SALTY      ----------------------------------------------------------------------
ZRAR_SALTI      ----------------------------------------------------------------------
YVRG_BACSU      ----------------------------------------------------------------------
SPAR_BACSU      ----------------------------------------------------------------------
RPFG_XANC8      ----------------------------------------------------------------------
REGX3_MYCS2     ----------------------------------------------------------------------
QSEB_ECO57      ----------------------------------------------------------------------
PCOS_ECOLX      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
MCS4_SCHPO      ----------------------------------------------------------------------
KINC_BACSU      ----------------------------------------------------------------------
KDPD_CLOAB      ----------------------------------------------------------------------
CHEY_TREPA      ----------------------------------------------------------------------
SPHR_SYNE7      ----------------------------------------------------------------------
QSEB_HAEIN      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
MPRA_MYCUA      ----------------------------------------------------------------------
ARR3_ARATH      ----------------------------------------------------------------------
YRKP_BACSU      ----------------------------------------------------------------------
SSK1_YEAST      ----------------------------------------------------------------------
MPRB_MYCVP      ----------------------------------------------------------------------
MPRA_MYCLE      ----------------------------------------------------------------------
CHVG_RHIME      ----------------------------------------------------------------------
PILR_PSEAE      ----------------------------------------------------------------------
PATA_ANASP      ----------------------------------------------------------------------
MPRA_MYCS2      ----------------------------------------------------------------------
MPRA_MYCPA      ----------------------------------------------------------------------
MPRA_MYCBP      ----------------------------------------------------------------------
MPRA_MYCBO      ----------------------------------------------------------------------
MPRA_MYCA1      ----------------------------------------------------------------------
APRR5_ARATH     ----------------------------------------------------------------------
AFSQ1_STRCO     ----------------------------------------------------------------------
CHEB2_CARHZ     ----------------------------------------------------------------------
TORR_ECOLI      ----------------------------------------------------------------------
MPRA_MYCTU      ----------------------------------------------------------------------
MPRA_MYCTA      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
ARR4_ARATH      ----------------------------------------------------------------------
TORR_ECO57      ----------------------------------------------------------------------
QSEB_SALTY      ----------------------------------------------------------------------
QSEB_SALTI      ----------------------------------------------------------------------
PHOB_SHIFL      ----------------------------------------------------------------------
PHOB_SHIDY      ----------------------------------------------------------------------
PHOB_ECOLI      ----------------------------------------------------------------------
PHOB_ECO57      ----------------------------------------------------------------------
CHVI_RHISN      ----------------------------------------------------------------------
CHVI_RHIME      ----------------------------------------------------------------------
APRR9_ARATH     ----------------------------------------------------------------------
VANR_ENTFC      ----------------------------------------------------------------------
PHOB_KLEPN      ----------------------------------------------------------------------
CHVI_RHIRD      ----------------------------------------------------------------------
CHEB2_RHOCS     ----------------------------------------------------------------------
PHY_MOUSC       ----------------------------------------------------------------------
KDPD_RATRA      ----------------------------------------------------------------------
CHEY_HELPY      ----------------------------------------------------------------------
CHEB3_GEOSL     ----------------------------------------------------------------------
VANR_ENTFA      ----------------------------------------------------------------------
SP0A_MOOTA      ----------------------------------------------------------------------
SP0A_BACME      ----------------------------------------------------------------------
SP0A_BACCI      ----------------------------------------------------------------------
NTRC_ECOLI      ----------------------------------------------------------------------
NTRC_ECO57      ----------------------------------------------------------------------
CHEB1_SYNWW     ----------------------------------------------------------------------
YCBL_BACSU      ----------------------------------------------------------------------
PRR95_ORYSJ     ----------------------------------------------------------------------
PDTAR_MYCTU     ----------------------------------------------------------------------
IRLS_BURPS      ----------------------------------------------------------------------
CHEY_HELPJ      ----------------------------------------------------------------------
REGX3_MYCTU     ----------------------------------------------------------------------
REGX3_MYCBO     ----------------------------------------------------------------------
CHEB_BACSU      ----------------------------------------------------------------------
CHEB2_GEOMG     ----------------------------------------------------------------------
CHEB2_AZOBR     ----------------------------------------------------------------------
BASS_SALTY      ----------------------------------------------------------------------
ARR10_ARATH     ----------------------------------------------------------------------
ARLR_STAHJ      ----------------------------------------------------------------------
VIRAL_RHIRD     ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
CHVG_AGRT5      ----------------------------------------------------------------------
ARR8_ARATH      ----------------------------------------------------------------------
ARR17_ARATH     ----------------------------------------------------------------------
ARR12_ARATH     ----------------------------------------------------------------------
ZRAS_KLEOX      ----------------------------------------------------------------------
YCLJ_BACSU      ----------------------------------------------------------------------
TCTD_SALTY      ----------------------------------------------------------------------
PILG_PSEAE      ----------------------------------------------------------------------
PHY2_CERPU      ----------------------------------------------------------------------
SPAK_BACSU      ----------------------------------------------------------------------
SP0A_BACTU      ----------------------------------------------------------------------
SP0A_BACSU      ----------------------------------------------------------------------
SP0A_BACCR      ----------------------------------------------------------------------
RPRY_BACFR      ----------------------------------------------------------------------
PRR1_ORYSJ      ----------------------------------------------------------------------
NTRC_SALTY      ----------------------------------------------------------------------
NTRC_BRASR      ----------------------------------------------------------------------
NODV_BRAJA      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
CPXR_SHIFL      ----------------------------------------------------------------------
CPXR_ECOLI      ----------------------------------------------------------------------
CPXR_ECO57      ----------------------------------------------------------------------
CITS_BACSU      ----------------------------------------------------------------------
SP0A_BACAN      ----------------------------------------------------------------------
PHYB_ANASP      ----------------------------------------------------------------------
PDE2_DICDI      ----------------------------------------------------------------------
NTRC_PROVU      ----------------------------------------------------------------------
CUSS_ECO57      ----------------------------------------------------------------------
CHEY_BACSU      ----------------------------------------------------------------------
PFER_PSEAE      ----------------------------------------------------------------------
HSSS_STAHJ      ----------------------------------------------------------------------
BASS_ECOLI      ----------------------------------------------------------------------
ARR5_ARATH      ----------------------------------------------------------------------
ARCA_SHIFL      ----------------------------------------------------------------------
ARCA_ECOLI      ----------------------------------------------------------------------
ARCA_ECOL6      ----------------------------------------------------------------------
ARCA_ECO57      ----------------------------------------------------------------------
VIRA_AGRT9      ----------------------------------------------------------------------
NTRC_AZOC5      ----------------------------------------------------------------------
KDPD_MYCTU      ----------------------------------------------------------------------
GRAR_STAS1      ----------------------------------------------------------------------
DCTR_BACSU      ----------------------------------------------------------------------
CUSS_ECOLI      ----------------------------------------------------------------------
CHEY_THEMA      ----------------------------------------------------------------------
CHEB_TREDE      ----------------------------------------------------------------------
ARR9_ARATH      ----------------------------------------------------------------------
ARR6_ARATH      ----------------------------------------------------------------------
ARR1_ARATH      ----------------------------------------------------------------------
NTRC_KLEPN      ----------------------------------------------------------------------
DPIB_ECOLI      ----------------------------------------------------------------------
CUSS_ECOL6      ----------------------------------------------------------------------
BCER_BACHD      ----------------------------------------------------------------------
SPHS_SYNE7      ----------------------------------------------------------------------
PHY1_PHYPA      ----------------------------------------------------------------------
NTRB_AZOBR      ----------------------------------------------------------------------
GRAR_STAHJ      ----------------------------------------------------------------------
GRAR_STAES      ----------------------------------------------------------------------
GRAR_STAEQ      ----------------------------------------------------------------------
DCTS_RHOCA      ----------------------------------------------------------------------
REGX3_MYCLE     ----------------------------------------------------------------------
PHYB_TOBAC      ----------------------------------------------------------------------
CHEB_TRIEI      ----------------------------------------------------------------------
BPHY_DEIRA      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
ARR2_ARATH      ----------------------------------------------------------------------
ZRAR_ECOLI      ----------------------------------------------------------------------
ZRAR_ECO57      ----------------------------------------------------------------------
VIRAW_RHIRD     ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
ARR14_ARATH     ----------------------------------------------------------------------
ARLR_STAEQ      ----------------------------------------------------------------------
APRR3_ARATH     ----------------------------------------------------------------------
AFSQ2_STRCO     ----------------------------------------------------------------------
SP0F_BACSU      ----------------------------------------------------------------------
SP0A_BREPA      ----------------------------------------------------------------------
PHY_PICAB       ----------------------------------------------------------------------
CIAR_STRR6      ----------------------------------------------------------------------
CIAR_STRPN      ----------------------------------------------------------------------
CHEY_LISMO      ----------------------------------------------------------------------
CHEY_LISIN      ----------------------------------------------------------------------
CHEB_METBU      ----------------------------------------------------------------------
CHEB_BACLD      ----------------------------------------------------------------------
CHEB1_AGRT5     ----------------------------------------------------------------------
ARLR_STAES      ----------------------------------------------------------------------
YVCP_BACSU      ----------------------------------------------------------------------
SP0A_CLOB8      ----------------------------------------------------------------------
NTRXL_RICPR     ----------------------------------------------------------------------
HNR_SHIFL       ----------------------------------------------------------------------
HNR_ECOLI       ----------------------------------------------------------------------
HNR_ECO57       ----------------------------------------------------------------------
FIXL_AZOC5      ----------------------------------------------------------------------
CYAB_STIAU      ----------------------------------------------------------------------
CSEB_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
CHEB_ALHEH      ----------------------------------------------------------------------
ARR11_ARATH     ----------------------------------------------------------------------
ARLR_STAAW      ----------------------------------------------------------------------
ARLR_STAAS      ----------------------------------------------------------------------
ARLR_STAAR      ----------------------------------------------------------------------
ARLR_STAAN      ----------------------------------------------------------------------
ARLR_STAAM      ----------------------------------------------------------------------
ARLR_STAAC      ----------------------------------------------------------------------
ARLR_STAAB      ----------------------------------------------------------------------
ARLR_STAA8      ----------------------------------------------------------------------
ARLR_STAA3      ----------------------------------------------------------------------
SP0A_BACST      ----------------------------------------------------------------------
PHOP_SALCH      ----------------------------------------------------------------------
NTRXL_RICTY     ----------------------------------------------------------------------
NTRXL_RICFE     ----------------------------------------------------------------------
MPRB_MYCLE      ----------------------------------------------------------------------
CSSR_BACSU      ----------------------------------------------------------------------
CSEB_STRAW      ----------------------------------------------------------------------
VIRG_AGRT5      ----------------------------------------------------------------------
RCAC_FREDI      ----------------------------------------------------------------------
NTRC_RHIME      ----------------------------------------------------------------------
NTRC_AZOBR      ----------------------------------------------------------------------
GRAS_STAES      ----------------------------------------------------------------------
GRAS_STAEQ      ----------------------------------------------------------------------
CHEB_PELCD      ----------------------------------------------------------------------
CHEB2_ACIBL     ----------------------------------------------------------------------
LOVHK_PSE14     ----------------------------------------------------------------------
GRAR_STAAW      ----------------------------------------------------------------------
GRAR_STAAT      ----------------------------------------------------------------------
GRAR_STAAS      ----------------------------------------------------------------------
GRAR_STAAR      ----------------------------------------------------------------------
GRAR_STAAN      ----------------------------------------------------------------------
GRAR_STAAM      ----------------------------------------------------------------------
GRAR_STAAE      ----------------------------------------------------------------------
GRAR_STAAC      ----------------------------------------------------------------------
GRAR_STAAB      ----------------------------------------------------------------------
GRAR_STAA9      ----------------------------------------------------------------------
GRAR_STAA8      ----------------------------------------------------------------------
GRAR_STAA3      ----------------------------------------------------------------------
GRAR_STAA2      ----------------------------------------------------------------------
GRAR_STAA1      ----------------------------------------------------------------------
ALGB_PSESM      ----------------------------------------------------------------------
NTRXL_RICCN     ----------------------------------------------------------------------
ARR21_ARATH     ----------------------------------------------------------------------
ALGB_PSEPK      ----------------------------------------------------------------------
TRPO_PSEAE      ----------------------------------------------------------------------
SP0A_BACSH      ----------------------------------------------------------------------
FIMZ_SALTY      ----------------------------------------------------------------------
DCTR_BACME      ----------------------------------------------------------------------
DCTB_RHIME      ----------------------------------------------------------------------
CITT_BACHD      ----------------------------------------------------------------------
CHEB3_RHOPA     ----------------------------------------------------------------------
CHEB1_GEOSL     ----------------------------------------------------------------------
ARR18_ARATH     ----------------------------------------------------------------------
PHYB_SOLTU      ----------------------------------------------------------------------
MPRB_MYCUA      ----------------------------------------------------------------------
MPRB_MYCTU      ----------------------------------------------------------------------
MPRB_MYCTA      ----------------------------------------------------------------------
FIXL_BRAJA      ----------------------------------------------------------------------
CHEB_METMP      ----------------------------------------------------------------------
CHEB_DESHY      ----------------------------------------------------------------------
CHEB3_BURTA     ----------------------------------------------------------------------
CHEB2_RHOSH     ----------------------------------------------------------------------
CHEB2_RHOS4     ----------------------------------------------------------------------
ALGB_PSEAE      ----------------------------------------------------------------------
Y2151_LEPIN     ----------------------------------------------------------------------
Y1769_LEPIC     ----------------------------------------------------------------------
SILS_SALTY      ----------------------------------------------------------------------
RCP1_SYNY3      ----------------------------------------------------------------------
PHY_PINSY       ----------------------------------------------------------------------
MPRB_MYCBP      ----------------------------------------------------------------------
MPRB_MYCBO      ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------------
CHEB_TREPA      ----------------------------------------------------------------------
CHEB_PSEA6      ----------------------------------------------------------------------
CHEB5_GEOMG     ----------------------------------------------------------------------
CHEB1_RHORT     ----------------------------------------------------------------------
ARR7_ARATH      ----------------------------------------------------------------------
HOXA_RALEH      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
CHEB1_METMA     ----------------------------------------------------------------------
Y3689_SHEFN     ----------------------------------------------------------------------
PHYB_ORYSJ      ----------------------------------------------------------------------
PHYB1_SOLLC     ----------------------------------------------------------------------
NTRB_VIBAL      ----------------------------------------------------------------------
KDPE_ECOLI      ----------------------------------------------------------------------
DCTR_BACHD      ----------------------------------------------------------------------
CHEB_SYMTH      ----------------------------------------------------------------------
CHEB_CLOAB      ----------------------------------------------------------------------
CHEB_BACHD      ----------------------------------------------------------------------
CHEB1_MAGSA     ----------------------------------------------------------------------
YHCZ_BACSU      ----------------------------------------------------------------------
PRRA_MYCLE      ----------------------------------------------------------------------
PHYB_ORYSI      ----------------------------------------------------------------------
NTRB_KLEOX      ----------------------------------------------------------------------
MPRB_MYCSS      ----------------------------------------------------------------------
MPRB_MYCSK      ----------------------------------------------------------------------
MPRB_MYCSJ      ----------------------------------------------------------------------
ETR2_ARATH      ----------------------------------------------------------------------
DEGU_BREBE      ----------------------------------------------------------------------
CHEB_DESPS      ----------------------------------------------------------------------
VANS_ENTFA      ----------------------------------------------------------------------
RSTA_ECOLI      ----------------------------------------------------------------------
PHOP_SHIFL      ----------------------------------------------------------------------
PHOP_ECOLI      ----------------------------------------------------------------------
PHOP_ECOL6      ----------------------------------------------------------------------
NTRXL_RICBR     ----------------------------------------------------------------------
NISR_LACLA      ----------------------------------------------------------------------
EHD1_ORYSJ      ----------------------------------------------------------------------
EHD1_ORYSI      ----------------------------------------------------------------------
DCTS_BACSU      ----------------------------------------------------------------------
CHEB_PYRAB      ----------------------------------------------------------------------
CHEB_OCEIH      ----------------------------------------------------------------------
CHEB1_SACD2     ----------------------------------------------------------------------
ARR16_ARATH     ----------------------------------------------------------------------
VIRG_AGRRH      ----------------------------------------------------------------------
PRRA_MYCTU      ----------------------------------------------------------------------
PRRA_MYCBO      ----------------------------------------------------------------------
PHOQ_SALTY      ----------------------------------------------------------------------
PHOQ_SALTI      ----------------------------------------------------------------------
PHOQ_SALPA      ----------------------------------------------------------------------
PHOQ_SALCH      ----------------------------------------------------------------------
NTRC_RHOCA      ----------------------------------------------------------------------
CREB_ECOLI      ----------------------------------------------------------------------
CHEB5_ANADE     ----------------------------------------------------------------------
CHEB3_BRAJA     ----------------------------------------------------------------------
ARR20_ARATH     ----------------------------------------------------------------------
YXDJ_BACSU      ----------------------------------------------------------------------
SP0F_BACTK      ----------------------------------------------------------------------
PHYB_ARATH      ----------------------------------------------------------------------
NTRB_SALTY      ----------------------------------------------------------------------
NTRB_SALTI      ----------------------------------------------------------------------
LOVHK_PSESM     ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CSEC_STRCO      ----------------------------------------------------------------------
SP0A_CLODI      ----------------------------------------------------------------------
PHYB_SORBI      ----------------------------------------------------------------------
PHOP_ECO57      ----------------------------------------------------------------------
CSEC_STRAW      ----------------------------------------------------------------------
CHEV_BACSU      ----------------------------------------------------------------------
CHEB_THEMA      ----------------------------------------------------------------------
CHEB1_DECAR     ----------------------------------------------------------------------
CHEB1_CAUCR     ----------------------------------------------------------------------
CHEB1_CARHZ     ----------------------------------------------------------------------
NTRB_SHIFL      ----------------------------------------------------------------------
NTRB_ECOLI      ----------------------------------------------------------------------
NTRB_ECO57      ----------------------------------------------------------------------
LYTT_BACSU      ----------------------------------------------------------------------
GRAS_STAHJ      ----------------------------------------------------------------------
ENVZ_SHIFL      ----------------------------------------------------------------------
ENVZ_ECOLI      ----------------------------------------------------------------------
COPS_PSESM      ----------------------------------------------------------------------
CHEB_THETN      ----------------------------------------------------------------------
CHEB_SULDN      ----------------------------------------------------------------------
CHEB_NITWN      ----------------------------------------------------------------------
PHOP_SALTY      ----------------------------------------------------------------------
PHOP_SALTI      ----------------------------------------------------------------------
PHOP_SALPA      ----------------------------------------------------------------------
CHEB_PYRKO      ----------------------------------------------------------------------
CHEB_PYRHO      ----------------------------------------------------------------------
CHEB1_RHIEC     ----------------------------------------------------------------------
CHEB1_LEPIN     ----------------------------------------------------------------------
CHEB1_LEPIC     ----------------------------------------------------------------------
BCER_BACSU      ----------------------------------------------------------------------
UVRY_SHIFL      ----------------------------------------------------------------------
UVRY_ECOLI      ----------------------------------------------------------------------
SP0A_CLOAB      ----------------------------------------------------------------------
LOVHK_PSEU2     ----------------------------------------------------------------------
FIXL_RHIME      ----------------------------------------------------------------------
CHEY_YEREN      ----------------------------------------------------------------------
ARR15_ARATH     ----------------------------------------------------------------------
YFHA_ECOLI      ----------------------------------------------------------------------
YFHA_ECO57      ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
PILS_PSEAE      ----------------------------------------------------------------------
NTRY_AZOBR      ----------------------------------------------------------------------
CITS_BACHD      ----------------------------------------------------------------------
CHEB_NITEU      ----------------------------------------------------------------------
CHEB_LAWIP      ----------------------------------------------------------------------
CHEB_HALSA      ----------------------------------------------------------------------
CHEB1_RHIL3     ----------------------------------------------------------------------
YCF29_CYAPA     ----------------------------------------------------------------------
PHOQ_SHIFL      ----------------------------------------------------------------------
PHOQ_ECOLI      ----------------------------------------------------------------------
PHOQ_ECOL6      ----------------------------------------------------------------------
DCTS_BACHD      ----------------------------------------------------------------------
CHEB_RHOP2      ----------------------------------------------------------------------
CHEB_IDILO      ----------------------------------------------------------------------
CHEB3_RHOSH     ----------------------------------------------------------------------
ARCA_HAEIN      ----------------------------------------------------------------------
PHOQ_ECO57      ----------------------------------------------------------------------
LYTT_BACCR      ----------------------------------------------------------------------
HOXA_BRAJA      ----------------------------------------------------------------------
CHEB_SALRD      ----------------------------------------------------------------------
CHEB3_HAHCH     ----------------------------------------------------------------------
CHEB1_METAC     ----------------------------------------------------------------------
YDFI_BACSU      ----------------------------------------------------------------------
Y4XI_RHISN      ----------------------------------------------------------------------
SP0A_CLOPA      ----------------------------------------------------------------------
PETR_RHOCA      ----------------------------------------------------------------------
NTRB_RHOCA      ----------------------------------------------------------------------
NTRB_RHILP      ----------------------------------------------------------------------
GRAS_STAAW      ----------------------------------------------------------------------
GRAS_STAAT      ----------------------------------------------------------------------
GRAS_STAAS      ----------------------------------------------------------------------
GRAS_STAAN      ----------------------------------------------------------------------
GRAS_STAAM      ----------------------------------------------------------------------
GRAS_STAAE      ----------------------------------------------------------------------
GRAS_STAAC      ----------------------------------------------------------------------
GRAS_STAAB      ----------------------------------------------------------------------
GRAS_STAA9      ----------------------------------------------------------------------
GRAS_STAA8      ----------------------------------------------------------------------
GRAS_STAA3      ----------------------------------------------------------------------
GRAS_STAA2      ----------------------------------------------------------------------
GRAS_STAA1      ----------------------------------------------------------------------
CHEY_ECOL6      ----------------------------------------------------------------------
CHEB_THIDA      ----------------------------------------------------------------------
CHEB_NATPD      ----------------------------------------------------------------------
CHEB6_ANADE     ----------------------------------------------------------------------
CHEB3_CHRVO     ----------------------------------------------------------------------
CHEB2_RHIL3     ----------------------------------------------------------------------
CHEB1_RHOS4     ----------------------------------------------------------------------
CHEB1_DESDG     ----------------------------------------------------------------------
BASR_SALTY      ----------------------------------------------------------------------
BASR_ECOLI      ----------------------------------------------------------------------
UVRY_ECOL6      ----------------------------------------------------------------------
UVRY_ECO57      ----------------------------------------------------------------------
NTRB_PROVU      ----------------------------------------------------------------------
LYTT_BACAN      ----------------------------------------------------------------------
KIND_BACSU      ----------------------------------------------------------------------
CITA_KLEPN      ----------------------------------------------------------------------
CHEB_ROSDO      ----------------------------------------------------------------------
CHEB2_DESVH     ----------------------------------------------------------------------
CHEB2_DESDG     ----------------------------------------------------------------------
CHEB1_RHOPB     ----------------------------------------------------------------------
BVGA_BORPE      ----------------------------------------------------------------------
BVGA_BORPA      ----------------------------------------------------------------------
BVGA_BORBR      ----------------------------------------------------------------------
PHYC_SORBI      ----------------------------------------------------------------------
NTRB_BRASR      ----------------------------------------------------------------------
NARP_ECOLI      ----------------------------------------------------------------------
LIAR_BACSU      ----------------------------------------------------------------------
DEGM_BACB2      ----------------------------------------------------------------------
CHEY_YERPE      ----------------------------------------------------------------------
CHEY_SALTY      ----------------------------------------------------------------------
CHEY_SALTI      ----------------------------------------------------------------------
CHEB3_SYNWW     ----------------------------------------------------------------------
CHEB2_METHJ     ----------------------------------------------------------------------
CHEB1_HAHCH     ----------------------------------------------------------------------
CCDB_BACSU      ----------------------------------------------------------------------
BPHY_PSEAE      ----------------------------------------------------------------------
ARR22_ARATH     ----------------------------------------------------------------------
SAER_STAES      ----------------------------------------------------------------------
SAER_STAEQ      ----------------------------------------------------------------------
GACA_PSEU2      ----------------------------------------------------------------------
FIMZ_ECOLI      ----------------------------------------------------------------------
FIMZ_ECO57      ----------------------------------------------------------------------
ENVZ_SALTY      ----------------------------------------------------------------------
ENVZ_SALTI      ----------------------------------------------------------------------
CHEY_SHIFL      ----------------------------------------------------------------------
CHEY_PSEAE      ----------------------------------------------------------------------
CHEY_ENTCL      ----------------------------------------------------------------------
CHEY_ECOLI      ----------------------------------------------------------------------
CHEY_ECO57      ----------------------------------------------------------------------
CHEB_RHOPS      ----------------------------------------------------------------------
CHEB2_GEOSL     ----------------------------------------------------------------------
CHEB1_SYNAS     ----------------------------------------------------------------------
CHEB1_RHOFD     ----------------------------------------------------------------------
CHEB1_RHIME     ----------------------------------------------------------------------
YXDK_BACSU      ----------------------------------------------------------------------
NODW_BRAJA      ----------------------------------------------------------------------
DCTB_RHILE      ----------------------------------------------------------------------
CHEB_SHEFN      ----------------------------------------------------------------------
CHEB_NITHX      ----------------------------------------------------------------------
CHEB2_RHOPA     ----------------------------------------------------------------------
YCCH_BACSU      ----------------------------------------------------------------------
REGA_RHOCA      ----------------------------------------------------------------------
PKHA7_HUMAN     ----------------------------------------------------------------------
MALR_BACSU      ----------------------------------------------------------------------
LYTR_STRA5      ----------------------------------------------------------------------
LYTR_STRA3      ----------------------------------------------------------------------
FIXJ_BRAJA      ----------------------------------------------------------------------
DEGU_BACSU      ----------------------------------------------------------------------
CHEB_METFK      ----------------------------------------------------------------------
CHEB1_METHJ     ----------------------------------------------------------------------
YPH5_THIVI      ----------------------------------------------------------------------
VIRG_RHIRD      ----------------------------------------------------------------------
PFES_PSEAE      ----------------------------------------------------------------------
GACA_PSEFL      ----------------------------------------------------------------------
CHEB_MOOTA      ----------------------------------------------------------------------
VIRG_AGRT9      ----------------------------------------------------------------------
PRR1_SCHPO      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
GACA_PSEAE      ----------------------------------------------------------------------
DLTS_STRA5      ----------------------------------------------------------------------
CYAD_DICDI      ----------------------------------------------------------------------
CHEB_CHRSD      ----------------------------------------------------------------------
CHEB3_MAGSA     ----------------------------------------------------------------------
CHEB3_GEOMG     ----------------------------------------------------------------------
PHYD_ARATH      ----------------------------------------------------------------------
KINA_BACSU      ----------------------------------------------------------------------
CHEB3_RHOPB     ----------------------------------------------------------------------
CHEB1_BURTA     ----------------------------------------------------------------------
CHEB1_BURPS     ----------------------------------------------------------------------
CHEB1_BURP1     ----------------------------------------------------------------------
CHEB1_BURMA     ----------------------------------------------------------------------
YCF29_GUITH     ----------------------------------------------------------------------
CHEB3_RHORT     ----------------------------------------------------------------------
CHEB3_PSESM     ----------------------------------------------------------------------
Y0G0_VIBCH      ----------------------------------------------------------------------
MCPB_BACSU      KPLKRLVQSSKTIS-RGDLT--ETIEIHSKDELGELGESFNEMGQSLRSSAIQDSVNNVAASSE------
MALK_BACSU      ----------------------------------------------------------------------
CHEB_RALSO      ----------------------------------------------------------------------
CHEB_PSEHT      ----------------------------------------------------------------------
CHEB_NITMU      ----------------------------------------------------------------------
CHEB3_PSE14     ----------------------------------------------------------------------
CHEB2_PSEU2     ----------------------------------------------------------------------
CHEB2_BURTA     ----------------------------------------------------------------------
CHEB2_BORA1     ----------------------------------------------------------------------
YFIK_BACSU      ----------------------------------------------------------------------
NUF2_CANAL      ----------------------------------------------------------------------
NARP_HAEIN      ----------------------------------------------------------------------
LYTR_STRMU      ----------------------------------------------------------------------
GACA_PSEVI      ----------------------------------------------------------------------
DLTS_STRA3      ----------------------------------------------------------------------
CHEB_NOSP7      ----------------------------------------------------------------------
CHEB_GEOKA      ----------------------------------------------------------------------
CHEB_BORPE      ----------------------------------------------------------------------
CHEB_BORPA      ----------------------------------------------------------------------
CHEB_BORBR      ----------------------------------------------------------------------
CHEB3_PSEAE     ----------------------------------------------------------------------
CHEB2_XANC8     ----------------------------------------------------------------------
CHEB2_SYNWW     ----------------------------------------------------------------------
CHEB1_XANCP     ----------------------------------------------------------------------
CHEB1_CHRVO     ----------------------------------------------------------------------
CHEA_LISMO      ----------------------------------------------------------------------
ARR19_ARATH     ----------------------------------------------------------------------
ARR13_ARATH     ----------------------------------------------------------------------
PMRA_PECCC      ----------------------------------------------------------------------
PKHA7_MOUSE     ----------------------------------------------------------------------
DCTR_RHOCA      ----------------------------------------------------------------------
DCTD_RHILE      ----------------------------------------------------------------------
CHEB_THICR      ----------------------------------------------------------------------
CHEB3_VIBCH     ----------------------------------------------------------------------
CHEB2_XANOR     ----------------------------------------------------------------------
CHEB2_XANOM     ----------------------------------------------------------------------
CHEB2_RALEJ     ----------------------------------------------------------------------
CHEB2_BRAJA     ----------------------------------------------------------------------
CHEB1_XANC5     ----------------------------------------------------------------------
CHEB1_XANAC     ----------------------------------------------------------------------
CHEB1_MYXXD     ----------------------------------------------------------------------
CHEB1_DESVH     ----------------------------------------------------------------------
CPS_CLOTH       KPIGQMVEAA-------DRLALGDVEVETRDEIGKLAESFKRMIENIREQA-------------------
CHEB_SHISS      ----------------------------------------------------------------------
CHEB_SHIFL      ----------------------------------------------------------------------
CHEB_SHIBS      ----------------------------------------------------------------------
CHEB_SALTY      ----------------------------------------------------------------------
CHEB_SALTI      ----------------------------------------------------------------------
CHEB_SALPA      ----------------------------------------------------------------------
CHEB_SALCH      ----------------------------------------------------------------------
CHEB_MARMM      ----------------------------------------------------------------------
CHEB_HALMA      ----------------------------------------------------------------------
CHEB_ENTCL      ----------------------------------------------------------------------
CHEB_ECOUT      ----------------------------------------------------------------------
CHEB_ECOLI      ----------------------------------------------------------------------
CHEB_ECOL6      ----------------------------------------------------------------------
CHEB_ECOL5      ----------------------------------------------------------------------
CHEB_ECO57      ----------------------------------------------------------------------
CHEB2_PHOPR     ----------------------------------------------------------------------
CHEB1_PSEPF     ----------------------------------------------------------------------
CHEB1_BURCA     ----------------------------------------------------------------------
CHEB1_ACIBL     ----------------------------------------------------------------------
CHEA_THEMA      ----------------------------------------------------------------------
REGA_RHOS4      ----------------------------------------------------------------------
PHYA_ARATH      ----------------------------------------------------------------------
KIF15_HUMAN     ----------------------------------------------------------------------
GLNL_BACSU      ----------------------------------------------------------------------
CHEB_YERPS      ----------------------------------------------------------------------
CHEB_YERPN      ----------------------------------------------------------------------
CHEB_YERPE      ----------------------------------------------------------------------
CHEB_YERPA      ----------------------------------------------------------------------
CHEB_PHOLL      ----------------------------------------------------------------------
CHEB_BURXL      ----------------------------------------------------------------------
CHEB2_CAUCR     ----------------------------------------------------------------------
CHEB2_ANADE     ----------------------------------------------------------------------
CHEB1_ANADE     ----------------------------------------------------------------------
NTRX_AZOC5      ----------------------------------------------------------------------
LIAS_BACSU      ----------------------------------------------------------------------
CTRA_OCHA4      ----------------------------------------------------------------------
CTRA_BRUSU      ----------------------------------------------------------------------
CTRA_BRUSI      ----------------------------------------------------------------------
CTRA_BRUO2      ----------------------------------------------------------------------
CTRA_BRUME      ----------------------------------------------------------------------
CTRA_BRUC2      ----------------------------------------------------------------------
CTRA_BRUAB      ----------------------------------------------------------------------
CTRA_BRUA2      ----------------------------------------------------------------------
CTRA_BRUA1      ----------------------------------------------------------------------
CHEB4_BURTA     ----------------------------------------------------------------------
CHEB2_PSEAE     ----------------------------------------------------------------------
CHEB2_BURPS     ----------------------------------------------------------------------
CHEB2_BURP1     ----------------------------------------------------------------------
CHEB2_BURMA     ----------------------------------------------------------------------
CHEB1_RALME     ----------------------------------------------------------------------
NREB_STAAW      ----------------------------------------------------------------------
NREB_STAAT      ----------------------------------------------------------------------
NREB_STAAS      ----------------------------------------------------------------------
NREB_STAAR      ----------------------------------------------------------------------
NREB_STAAN      ----------------------------------------------------------------------
NREB_STAAM      ----------------------------------------------------------------------
NREB_STAAE      ----------------------------------------------------------------------
NREB_STAAC      ----------------------------------------------------------------------
NREB_STAAB      ----------------------------------------------------------------------
NREB_STAA9      ----------------------------------------------------------------------
NREB_STAA8      ----------------------------------------------------------------------
NREB_STAA3      ----------------------------------------------------------------------
NREB_STAA2      ----------------------------------------------------------------------
NREB_STAA1      ----------------------------------------------------------------------
NARL_SHIFL      ----------------------------------------------------------------------
NARL_ECOLI      ----------------------------------------------------------------------
NARL_ECOL6      ----------------------------------------------------------------------
NARL_ECO57      ----------------------------------------------------------------------
LYTT_ENTFA      ----------------------------------------------------------------------
HUPR_RHOCA      ----------------------------------------------------------------------
CHEB_ERWCT      ----------------------------------------------------------------------
CHEB3_BURS3     ----------------------------------------------------------------------
CHEB2_RALME     ----------------------------------------------------------------------
CHEB2_METAC     ----------------------------------------------------------------------
CHEB1_GEOMG     ----------------------------------------------------------------------
Y899_CHLAA      ----------------------------------------------------------------------
NREB_STACT      ----------------------------------------------------------------------
MTRA_MYCTU      ----------------------------------------------------------------------
MTRA_MYCPA      ----------------------------------------------------------------------
MTRA_MYCLE      ----------------------------------------------------------------------
MTRA_MYCBO      ----------------------------------------------------------------------
LYTS_STAS1      ----------------------------------------------------------------------
LMNB1_HUMAN     ----------------------------------------------------------------------
DCUR_SHIFL      ----------------------------------------------------------------------
CHEB_RHILO      ----------------------------------------------------------------------
CHEB2_VIBVY     ----------------------------------------------------------------------
CHEB2_VIBVU     ----------------------------------------------------------------------
CHEB2_CHRVO     ----------------------------------------------------------------------
CHEB1_BURS3     ----------------------------------------------------------------------
CHEA_LISIN      ----------------------------------------------------------------------
BAER_ECOLI      ----------------------------------------------------------------------
BAER_ECOL6      ----------------------------------------------------------------------
YESN_BACSU      ----------------------------------------------------------------------
PYRB_CLOPS      ----------------------------------------------------------------------
PYRB_CLOPE      ----------------------------------------------------------------------
PYRB_CLOP1      ----------------------------------------------------------------------
GRAS_STAS1      ----------------------------------------------------------------------
DCUS_SHIFL      ----------------------------------------------------------------------
DCUS_ECOLI      ----------------------------------------------------------------------
DCUS_ECOL6      ----------------------------------------------------------------------
DCUS_ECO57      ----------------------------------------------------------------------
DCUR_ECOLI      ----------------------------------------------------------------------
DCUR_ECO57      ----------------------------------------------------------------------
CHEB3_LEPIN     ----------------------------------------------------------------------
CHEB3_LEPIC     ----------------------------------------------------------------------
CHEB2_SHESR     ----------------------------------------------------------------------
CHEB2_SHESM     ----------------------------------------------------------------------
CHEB2_RHORT     ----------------------------------------------------------------------
CHEB2_PSESM     ----------------------------------------------------------------------
CHEB2_BURCA     ----------------------------------------------------------------------
CHEB1_VIBVY     ----------------------------------------------------------------------
CHEB1_VIBVU     ----------------------------------------------------------------------
CHEB1_PSEF5     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VAEIMTLFQGVLDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LUXQ_VIBPA      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
LUXQ_VIBVY      ----------------------------------------------------------------------
LUXQ_VIBVU      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
ARCB_SHIFL      ----------------------------------------------------------------------
ARCB_ECOLI      ----------------------------------------------------------------------
ARCB_ECO57      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
GACS_PSESY      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
BVGS_BORPE      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
TCSA_EMENI      ----------------------------------------------------------------------
DOKA_DICDI      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
MAK2_SCHPO      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
ETR1_PASED      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
DHKL_DICDI      ----------------------------------------------------------------------
ETR1_PELHO      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
DHKF_DICDI      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
MAK1_SCHPO      ----------------------------------------------------------------------
PLEC_CAUCR      ----------------------------------------------------------------------
ERS1_ARATH      ----------------------------------------------------------------------
TORS_ECOLI      ----------------------------------------------------------------------
EVGS_ECOLI      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
ETR1_ARATH      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------
ETR1_BRAOL      ----------------------------------------------------------------------
DSPA_SYNY3      ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
PHOR_BACSU      ----------------------------------------------------------------------
SAES_STAAE      ----------------------------------------------------------------------
SAES_STAAC      ----------------------------------------------------------------------
SAES_STAA8      ----------------------------------------------------------------------
SAES_STAA3      ----------------------------------------------------------------------
ARCB_HAEIN      ----------------------------------------------------------------------
SASA_SYNJA      ----------------------------------------------------------------------
SAES_STAAR      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
DIVL_CAUCR      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SASA_CYAA5      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SAES_STAAW      ----------------------------------------------------------------------
SAES_STAAS      ----------------------------------------------------------------------
SAES_STAAN      ----------------------------------------------------------------------
SAES_STAAM      ----------------------------------------------------------------------
SAES_STAAB      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_THEEB      ----------------------------------------------------------------------
PHOR_ECOLI      ----------------------------------------------------------------------
WALK_STAHJ      ----------------------------------------------------------------------
WALK_STAAR      ----------------------------------------------------------------------
WALK_STAAW      ----------------------------------------------------------------------
WALK_STAAU      ----------------------------------------------------------------------
WALK_STAAT      ----------------------------------------------------------------------
WALK_STAAS      ----------------------------------------------------------------------
WALK_STAAN      ----------------------------------------------------------------------
WALK_STAAM      ----------------------------------------------------------------------
WALK_STAAE      ----------------------------------------------------------------------
WALK_STAAC      ----------------------------------------------------------------------
WALK_STAAB      ----------------------------------------------------------------------
WALK_STAA9      ----------------------------------------------------------------------
WALK_STAA8      ----------------------------------------------------------------------
WALK_STAA3      ----------------------------------------------------------------------
WALK_STAA2      ----------------------------------------------------------------------
WALK_STAA1      ----------------------------------------------------------------------
YCF26_PORYE     ----------------------------------------------------------------------
YYCG_BACSU      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
WALK_STASR      ----------------------------------------------------------------------
PHOR_SHIDY      ----------------------------------------------------------------------
WALK_STAS1      ----------------------------------------------------------------------
PHOR_KLEPN      ----------------------------------------------------------------------
SASA_SYNJB      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
YCF29_PORYE     ----------------------------------------------------------------------
BAES_ECOLI      ----------------------------------------------------------------------
Y851_SYNP2      ----------------------------------------------------------------------
SASA_PROMA      ----------------------------------------------------------------------
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
LUXN_VIBHB      ----------------------------------------------------------------------
LUXN_VIBHA      ----------------------------------------------------------------------
YSO1_PLEBO      ----------------------------------------------------------------------
WALK_STAES      ----------------------------------------------------------------------
WALK_STAEQ      ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
MTRB_MYCPA      ----------------------------------------------------------------------
EVGS_ECO57      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
PILH_PSEAE      ----------------------------------------------------------------------
MTRB_MYCLE      ----------------------------------------------------------------------
SASA_SYNE7      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------
PHOR_HAEIN      ----------------------------------------------------------------------
DIVK_OCHA4      ----------------------------------------------------------------------
DHKM_DICDI      ----------------------------------------------------------------------
YFHK_ECOLI      ----------------------------------------------------------------------
YCF26_PORPU     KAKLETLVSTIAD---------------------------------------------------------
SASA_SYNS3      ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
ARLS_STAS1      ----------------------------------------------------------------------
SRRA_STAAW      ----------------------------------------------------------------------
SRRA_STAAU      ----------------------------------------------------------------------
SRRA_STAAS      ----------------------------------------------------------------------
SRRA_STAAR      ----------------------------------------------------------------------
SRRA_STAAN      ----------------------------------------------------------------------
SRRA_STAAM      ----------------------------------------------------------------------
SRRA_STAAC      ----------------------------------------------------------------------
SRRA_STAA8      ----------------------------------------------------------------------
MTRB_MYCTU      ----------------------------------------------------------------------
MTRB_MYCBO      ----------------------------------------------------------------------
KDPD_ECOLI      ----------------------------------------------------------------------
EIN4_ARATH      ----------------------------------------------------------------------
DHKH_DICDI      ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
DIVK_BRUSU      ----------------------------------------------------------------------
DIVK_BRUSI      ----------------------------------------------------------------------
DIVK_BRUO2      ----------------------------------------------------------------------
DIVK_BRUME      ----------------------------------------------------------------------
DIVK_BRUC2      ----------------------------------------------------------------------
DIVK_BRUAB      ----------------------------------------------------------------------
DIVK_BRUA2      ----------------------------------------------------------------------
DIVK_BRUA1      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
RSSA_SERMA      ----------------------------------------------------------------------
OMPR_SHIFL      ----------------------------------------------------------------------
OMPR_SALTY      ----------------------------------------------------------------------
OMPR_SALTI      ----------------------------------------------------------------------
OMPR_ECOLI      ----------------------------------------------------------------------
OMPR_ECOL6      ----------------------------------------------------------------------
OMPR_ECO57      ----------------------------------------------------------------------
YYCF_BACSU      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
HSSR_STAES      ----------------------------------------------------------------------
HSSR_STAEQ      ----------------------------------------------------------------------
CQSS_VIBHB      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
MAK3_SCHPO      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
YCF27_CYAPA     ----------------------------------------------------------------------
ARLS_STAHJ      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_MICAN      ----------------------------------------------------------------------
HSSR_STAHJ      ----------------------------------------------------------------------
HSSR_STAAR      ----------------------------------------------------------------------
HSSR_STAAB      ----------------------------------------------------------------------
SASA_CYAP8      ----------------------------------------------------------------------
HSSR_STAAW      ----------------------------------------------------------------------
HSSR_STAAT      ----------------------------------------------------------------------
HSSR_STAAS      ----------------------------------------------------------------------
HSSR_STAAN      ----------------------------------------------------------------------
HSSR_STAAM      ----------------------------------------------------------------------
HSSR_STAA9      ----------------------------------------------------------------------
HSSR_STAA8      ----------------------------------------------------------------------
HSSR_STAA3      ----------------------------------------------------------------------
HSSR_STAA2      ----------------------------------------------------------------------
HSSR_STAA1      ----------------------------------------------------------------------
ZRAS_ECOLI      ----------------------------------------------------------------------
WALR_STAS1      ----------------------------------------------------------------------
VANS_ENTFC      ----------------------------------------------------------------------
PHOB_RHIME      ----------------------------------------------------------------------
PHOB_HAEIN      ----------------------------------------------------------------------
ARLS_STAES      ----------------------------------------------------------------------
PHOR_PSEAE      ----------------------------------------------------------------------
HSSR_STAAE      ----------------------------------------------------------------------
HSSR_STAAC      ----------------------------------------------------------------------
CQSS_VIBCH      ----------------------------------------------------------------------
WALR_STAES      ----------------------------------------------------------------------
WALR_STAEQ      ----------------------------------------------------------------------
WALR_STAAW      ----------------------------------------------------------------------
WALR_STAAU      ----------------------------------------------------------------------
WALR_STAAT      ----------------------------------------------------------------------
WALR_STAAS      ----------------------------------------------------------------------
WALR_STAAR      ----------------------------------------------------------------------
WALR_STAAN      ----------------------------------------------------------------------
WALR_STAAM      ----------------------------------------------------------------------
WALR_STAAE      ----------------------------------------------------------------------
WALR_STAAC      ----------------------------------------------------------------------
WALR_STAAB      ----------------------------------------------------------------------
WALR_STAA9      ----------------------------------------------------------------------
WALR_STAA8      ----------------------------------------------------------------------
WALR_STAA3      ----------------------------------------------------------------------
WALR_STAA2      ----------------------------------------------------------------------
WALR_STAA1      ----------------------------------------------------------------------
YKOH_BACSU      ----------------------------------------------------------------------
YEDW_ECOLI      ----------------------------------------------------------------------
SASA_SYNY3      ----------------------------------------------------------------------
SASA_CYAP7      ----------------------------------------------------------------------
DLTR_STRA5      ----------------------------------------------------------------------
DLTR_STRA3      ----------------------------------------------------------------------
ARLR_STAS1      ----------------------------------------------------------------------
YCLK_BACSU      ----------------------------------------------------------------------
YCF27_PORPU     ----------------------------------------------------------------------
WALR_STAHJ      ----------------------------------------------------------------------
GTCR_ANEMI      ----------------------------------------------------------------------
ARLS_STAEQ      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
CZCR_RALME      ----------------------------------------------------------------------
ZRAS_ECO57      ----------------------------------------------------------------------
YKOG_BACSU      ----------------------------------------------------------------------
YCF27_GUITH     ----------------------------------------------------------------------
ZRAR_KLEOX      ----------------------------------------------------------------------
YCF27_PORYE     ----------------------------------------------------------------------
DHKG_DICDI      ----------------------------------------------------------------------
YCF27_CYACA     ----------------------------------------------------------------------
VIRA_AGRT5      ----------------------------------------------------------------------
SASA_NOSP7      ----------------------------------------------------------------------
SAER_STAAW      ----------------------------------------------------------------------
SAER_STAAS      ----------------------------------------------------------------------
SAER_STAAR      ----------------------------------------------------------------------
SAER_STAAN      ----------------------------------------------------------------------
SAER_STAAM      ----------------------------------------------------------------------
SAER_STAAE      ----------------------------------------------------------------------
SAER_STAAC      ----------------------------------------------------------------------
SAER_STAAB      ----------------------------------------------------------------------
SAER_STAA8      ----------------------------------------------------------------------
SAER_STAA3      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
PHOB_PSEAE      ----------------------------------------------------------------------
YEDV_ECOLI      ----------------------------------------------------------------------
YCF27_PORAE     ----------------------------------------------------------------------
RESD_BACSU      ----------------------------------------------------------------------
SASA_SYNS9      ----------------------------------------------------------------------
PHOP_BACSU      ----------------------------------------------------------------------
YCF27_GALSU     ----------------------------------------------------------------------
YCBM_BACSU      ----------------------------------------------------------------------
SILR_SALTY      ----------------------------------------------------------------------
YVRH_BACSU      ----------------------------------------------------------------------
HSSR_STAS1      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
PHY1_SELMA      ----------------------------------------------------------------------
MPRA_MYCVP      ----------------------------------------------------------------------
CUSR_ECOLI      ----------------------------------------------------------------------
CUSR_ECOL6      ----------------------------------------------------------------------
CUSR_ECO57      ----------------------------------------------------------------------
CPXR_HAEIN      ----------------------------------------------------------------------
COPR_PSESM      ----------------------------------------------------------------------
HSSS_STAAR      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
ATOS_ECOLI      ----------------------------------------------------------------------
PRR73_ORYSJ     ----------------------------------------------------------------------
PRR37_ORYSJ     ----------------------------------------------------------------------
PRR37_ORYSI     ----------------------------------------------------------------------
HSSS_STAAW      ----------------------------------------------------------------------
HSSS_STAAS      ----------------------------------------------------------------------
YCF29_PORPU     ----------------------------------------------------------------------
YBDJ_BACSU      ----------------------------------------------------------------------
SASA_ANASP      ----------------------------------------------------------------------
PRR73_ORYSI     ----------------------------------------------------------------------
HSSS_STAAT      ----------------------------------------------------------------------
HSSS_STAAE      ----------------------------------------------------------------------
HSSS_STAAC      ----------------------------------------------------------------------
HSSS_STAA8      ----------------------------------------------------------------------
HSSS_STAA3      ----------------------------------------------------------------------
CHEB_ARCFU      ----------------------------------------------------------------------
APRR7_ARATH     ----------------------------------------------------------------------
SASA_ANAVT      ----------------------------------------------------------------------
RPRX_BACFR      ----------------------------------------------------------------------
HSSS_STAAN      ----------------------------------------------------------------------
HSSS_STAAM      ----------------------------------------------------------------------
HSSS_STAA9      ----------------------------------------------------------------------
HSSS_STAA2      ----------------------------------------------------------------------
HSSS_STAA1      ----------------------------------------------------------------------
CZCS_RALME      ----------------------------------------------------------------------
ATOC_ECOLI      ----------------------------------------------------------------------
CHEY_CAMJJ      ----------------------------------------------------------------------
CHEY_CAMJE      ----------------------------------------------------------------------
CHEY_CAMJ8      ----------------------------------------------------------------------
CHEB_NOCSJ      ----------------------------------------------------------------------
ARLS_STAAW      ----------------------------------------------------------------------
ARLS_STAAS      ----------------------------------------------------------------------
ARLS_STAAR      ----------------------------------------------------------------------
ARLS_STAAN      ----------------------------------------------------------------------
ARLS_STAAM      ----------------------------------------------------------------------
ARLS_STAAC      ----------------------------------------------------------------------
ARLS_STAAB      ----------------------------------------------------------------------
ARLS_STAA8      ----------------------------------------------------------------------
ARLS_STAA3      ----------------------------------------------------------------------
PCOR_ECOLX      ----------------------------------------------------------------------
HSSS_STAAB      ----------------------------------------------------------------------
APRR1_ARATH     ----------------------------------------------------------------------
QSEB_ECOLI      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
MPRA_MYCSS      ----------------------------------------------------------------------
MPRA_MYCSK      ----------------------------------------------------------------------
MPRA_MYCSJ      ----------------------------------------------------------------------
IRLR_BURPS      ----------------------------------------------------------------------
SKN7_YEAST      ----------------------------------------------------------------------
RSTB_ECOLI      ----------------------------------------------------------------------
CHEY_RHIEC      ----------------------------------------------------------------------
ZRAR_SALTY      ----------------------------------------------------------------------
ZRAR_SALTI      ----------------------------------------------------------------------
YVRG_BACSU      ----------------------------------------------------------------------
SPAR_BACSU      ----------------------------------------------------------------------
RPFG_XANC8      ----------------------------------------------------------------------
REGX3_MYCS2     ----------------------------------------------------------------------
QSEB_ECO57      ----------------------------------------------------------------------
PCOS_ECOLX      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
MCS4_SCHPO      ----------------------------------------------------------------------
KINC_BACSU      ----------------------------------------------------------------------
KDPD_CLOAB      ----------------------------------------------------------------------
CHEY_TREPA      ----------------------------------------------------------------------
SPHR_SYNE7      ----------------------------------------------------------------------
QSEB_HAEIN      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
MPRA_MYCUA      ----------------------------------------------------------------------
ARR3_ARATH      ----------------------------------------------------------------------
YRKP_BACSU      ----------------------------------------------------------------------
SSK1_YEAST      ----------------------------------------------------------------------
MPRB_MYCVP      ----------------------------------------------------------------------
MPRA_MYCLE      ----------------------------------------------------------------------
CHVG_RHIME      ----------------------------------------------------------------------
PILR_PSEAE      ----------------------------------------------------------------------
PATA_ANASP      ----------------------------------------------------------------------
MPRA_MYCS2      ----------------------------------------------------------------------
MPRA_MYCPA      ----------------------------------------------------------------------
MPRA_MYCBP      ----------------------------------------------------------------------
MPRA_MYCBO      ----------------------------------------------------------------------
MPRA_MYCA1      ----------------------------------------------------------------------
APRR5_ARATH     ----------------------------------------------------------------------
AFSQ1_STRCO     ----------------------------------------------------------------------
CHEB2_CARHZ     ----------------------------------------------------------------------
TORR_ECOLI      ----------------------------------------------------------------------
MPRA_MYCTU      ----------------------------------------------------------------------
MPRA_MYCTA      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
ARR4_ARATH      ----------------------------------------------------------------------
TORR_ECO57      ----------------------------------------------------------------------
QSEB_SALTY      ----------------------------------------------------------------------
QSEB_SALTI      ----------------------------------------------------------------------
PHOB_SHIFL      ----------------------------------------------------------------------
PHOB_SHIDY      ----------------------------------------------------------------------
PHOB_ECOLI      ----------------------------------------------------------------------
PHOB_ECO57      ----------------------------------------------------------------------
CHVI_RHISN      ----------------------------------------------------------------------
CHVI_RHIME      ----------------------------------------------------------------------
APRR9_ARATH     ----------------------------------------------------------------------
VANR_ENTFC      ----------------------------------------------------------------------
PHOB_KLEPN      ----------------------------------------------------------------------
CHVI_RHIRD      ----------------------------------------------------------------------
CHEB2_RHOCS     ----------------------------------------------------------------------
PHY_MOUSC       ----------------------------------------------------------------------
KDPD_RATRA      ----------------------------------------------------------------------
CHEY_HELPY      ----------------------------------------------------------------------
CHEB3_GEOSL     ----------------------------------------------------------------------
VANR_ENTFA      ----------------------------------------------------------------------
SP0A_MOOTA      ----------------------------------------------------------------------
SP0A_BACME      ----------------------------------------------------------------------
SP0A_BACCI      ----------------------------------------------------------------------
NTRC_ECOLI      ----------------------------------------------------------------------
NTRC_ECO57      ----------------------------------------------------------------------
CHEB1_SYNWW     ----------------------------------------------------------------------
YCBL_BACSU      ----------------------------------------------------------------------
PRR95_ORYSJ     ----------------------------------------------------------------------
PDTAR_MYCTU     ----------------------------------------------------------------------
IRLS_BURPS      ----------------------------------------------------------------------
CHEY_HELPJ      ----------------------------------------------------------------------
REGX3_MYCTU     ----------------------------------------------------------------------
REGX3_MYCBO     ----------------------------------------------------------------------
CHEB_BACSU      ----------------------------------------------------------------------
CHEB2_GEOMG     ----------------------------------------------------------------------
CHEB2_AZOBR     ----------------------------------------------------------------------
BASS_SALTY      ----------------------------------------------------------------------
ARR10_ARATH     ----------------------------------------------------------------------
ARLR_STAHJ      ----------------------------------------------------------------------
VIRAL_RHIRD     ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
CHVG_AGRT5      ----------------------------------------------------------------------
ARR8_ARATH      ----------------------------------------------------------------------
ARR17_ARATH     ----------------------------------------------------------------------
ARR12_ARATH     ----------------------------------------------------------------------
ZRAS_KLEOX      ----------------------------------------------------------------------
YCLJ_BACSU      ----------------------------------------------------------------------
TCTD_SALTY      ----------------------------------------------------------------------
PILG_PSEAE      ----------------------------------------------------------------------
PHY2_CERPU      ----------------------------------------------------------------------
SPAK_BACSU      ----------------------------------------------------------------------
SP0A_BACTU      ----------------------------------------------------------------------
SP0A_BACSU      ----------------------------------------------------------------------
SP0A_BACCR      ----------------------------------------------------------------------
RPRY_BACFR      ----------------------------------------------------------------------
PRR1_ORYSJ      ----------------------------------------------------------------------
NTRC_SALTY      ----------------------------------------------------------------------
NTRC_BRASR      ----------------------------------------------------------------------
NODV_BRAJA      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
CPXR_SHIFL      ----------------------------------------------------------------------
CPXR_ECOLI      ----------------------------------------------------------------------
CPXR_ECO57      ----------------------------------------------------------------------
CITS_BACSU      ----------------------------------------------------------------------
SP0A_BACAN      ----------------------------------------------------------------------
PHYB_ANASP      ----------------------------------------------------------------------
PDE2_DICDI      ----------------------------------------------------------------------
NTRC_PROVU      ----------------------------------------------------------------------
CUSS_ECO57      ----------------------------------------------------------------------
CHEY_BACSU      ----------------------------------------------------------------------
PFER_PSEAE      ----------------------------------------------------------------------
HSSS_STAHJ      ----------------------------------------------------------------------
BASS_ECOLI      ----------------------------------------------------------------------
ARR5_ARATH      ----------------------------------------------------------------------
ARCA_SHIFL      ----------------------------------------------------------------------
ARCA_ECOLI      ----------------------------------------------------------------------
ARCA_ECOL6      ----------------------------------------------------------------------
ARCA_ECO57      ----------------------------------------------------------------------
VIRA_AGRT9      ----------------------------------------------------------------------
NTRC_AZOC5      ----------------------------------------------------------------------
KDPD_MYCTU      ----------------------------------------------------------------------
GRAR_STAS1      ----------------------------------------------------------------------
DCTR_BACSU      ----------------------------------------------------------------------
CUSS_ECOLI      ----------------------------------------------------------------------
CHEY_THEMA      ----------------------------------------------------------------------
CHEB_TREDE      ----------------------------------------------------------------------
ARR9_ARATH      ----------------------------------------------------------------------
ARR6_ARATH      ----------------------------------------------------------------------
ARR1_ARATH      ----------------------------------------------------------------------
NTRC_KLEPN      ----------------------------------------------------------------------
DPIB_ECOLI      ----------------------------------------------------------------------
CUSS_ECOL6      ----------------------------------------------------------------------
BCER_BACHD      ----------------------------------------------------------------------
SPHS_SYNE7      ----------------------------------------------------------------------
PHY1_PHYPA      ----------------------------------------------------------------------
NTRB_AZOBR      ----------------------------------------------------------------------
GRAR_STAHJ      ----------------------------------------------------------------------
GRAR_STAES      ----------------------------------------------------------------------
GRAR_STAEQ      ----------------------------------------------------------------------
DCTS_RHOCA      ----------------------------------------------------------------------
REGX3_MYCLE     ----------------------------------------------------------------------
PHYB_TOBAC      ----------------------------------------------------------------------
CHEB_TRIEI      ----------------------------------------------------------------------
BPHY_DEIRA      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
ARR2_ARATH      ----------------------------------------------------------------------
ZRAR_ECOLI      ----------------------------------------------------------------------
ZRAR_ECO57      ----------------------------------------------------------------------
VIRAW_RHIRD     ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
ARR14_ARATH     ----------------------------------------------------------------------
ARLR_STAEQ      ----------------------------------------------------------------------
APRR3_ARATH     ----------------------------------------------------------------------
AFSQ2_STRCO     ----------------------------------------------------------------------
SP0F_BACSU      ----------------------------------------------------------------------
SP0A_BREPA      ----------------------------------------------------------------------
PHY_PICAB       ----------------------------------------------------------------------
CIAR_STRR6      ----------------------------------------------------------------------
CIAR_STRPN      ----------------------------------------------------------------------
CHEY_LISMO      ----------------------------------------------------------------------
CHEY_LISIN      ----------------------------------------------------------------------
CHEB_METBU      ----------------------------------------------------------------------
CHEB_BACLD      ----------------------------------------------------------------------
CHEB1_AGRT5     ----------------------------------------------------------------------
ARLR_STAES      ----------------------------------------------------------------------
YVCP_BACSU      ----------------------------------------------------------------------
SP0A_CLOB8      ----------------------------------------------------------------------
NTRXL_RICPR     ----------------------------------------------------------------------
HNR_SHIFL       ----------------------------------------------------------------------
HNR_ECOLI       ----------------------------------------------------------------------
HNR_ECO57       ----------------------------------------------------------------------
FIXL_AZOC5      ----------------------------------------------------------------------
CYAB_STIAU      ----------------------------------------------------------------------
CSEB_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
CHEB_ALHEH      ----------------------------------------------------------------------
ARR11_ARATH     ----------------------------------------------------------------------
ARLR_STAAW      ----------------------------------------------------------------------
ARLR_STAAS      ----------------------------------------------------------------------
ARLR_STAAR      ----------------------------------------------------------------------
ARLR_STAAN      ----------------------------------------------------------------------
ARLR_STAAM      ----------------------------------------------------------------------
ARLR_STAAC      ----------------------------------------------------------------------
ARLR_STAAB      ----------------------------------------------------------------------
ARLR_STAA8      ----------------------------------------------------------------------
ARLR_STAA3      ----------------------------------------------------------------------
SP0A_BACST      ----------------------------------------------------------------------
PHOP_SALCH      ----------------------------------------------------------------------
NTRXL_RICTY     ----------------------------------------------------------------------
NTRXL_RICFE     ----------------------------------------------------------------------
MPRB_MYCLE      ----------------------------------------------------------------------
CSSR_BACSU      ----------------------------------------------------------------------
CSEB_STRAW      ----------------------------------------------------------------------
VIRG_AGRT5      ----------------------------------------------------------------------
RCAC_FREDI      ----------------------------------------------------------------------
NTRC_RHIME      ----------------------------------------------------------------------
NTRC_AZOBR      ----------------------------------------------------------------------
GRAS_STAES      ----------------------------------------------------------------------
GRAS_STAEQ      ----------------------------------------------------------------------
CHEB_PELCD      ----------------------------------------------------------------------
CHEB2_ACIBL     ----------------------------------------------------------------------
LOVHK_PSE14     ----------------------------------------------------------------------
GRAR_STAAW      ----------------------------------------------------------------------
GRAR_STAAT      ----------------------------------------------------------------------
GRAR_STAAS      ----------------------------------------------------------------------
GRAR_STAAR      ----------------------------------------------------------------------
GRAR_STAAN      ----------------------------------------------------------------------
GRAR_STAAM      ----------------------------------------------------------------------
GRAR_STAAE      ----------------------------------------------------------------------
GRAR_STAAC      ----------------------------------------------------------------------
GRAR_STAAB      ----------------------------------------------------------------------
GRAR_STAA9      ----------------------------------------------------------------------
GRAR_STAA8      ----------------------------------------------------------------------
GRAR_STAA3      ----------------------------------------------------------------------
GRAR_STAA2      ----------------------------------------------------------------------
GRAR_STAA1      ----------------------------------------------------------------------
ALGB_PSESM      ----------------------------------------------------------------------
NTRXL_RICCN     ----------------------------------------------------------------------
ARR21_ARATH     ----------------------------------------------------------------------
ALGB_PSEPK      ----------------------------------------------------------------------
TRPO_PSEAE      ----------------------------------------------------------------------
SP0A_BACSH      ----------------------------------------------------------------------
FIMZ_SALTY      ----------------------------------------------------------------------
DCTR_BACME      ----------------------------------------------------------------------
DCTB_RHIME      ----------------------------------------------------------------------
CITT_BACHD      ----------------------------------------------------------------------
CHEB3_RHOPA     ----------------------------------------------------------------------
CHEB1_GEOSL     ----------------------------------------------------------------------
ARR18_ARATH     ----------------------------------------------------------------------
PHYB_SOLTU      ----------------------------------------------------------------------
MPRB_MYCUA      ----------------------------------------------------------------------
MPRB_MYCTU      ----------------------------------------------------------------------
MPRB_MYCTA      ----------------------------------------------------------------------
FIXL_BRAJA      ----------------------------------------------------------------------
CHEB_METMP      ----------------------------------------------------------------------
CHEB_DESHY      ----------------------------------------------------------------------
CHEB3_BURTA     ----------------------------------------------------------------------
CHEB2_RHOSH     ----------------------------------------------------------------------
CHEB2_RHOS4     ----------------------------------------------------------------------
ALGB_PSEAE      ----------------------------------------------------------------------
Y2151_LEPIN     ----------------------------------------------------------------------
Y1769_LEPIC     ----------------------------------------------------------------------
SILS_SALTY      ----------------------------------------------------------------------
RCP1_SYNY3      ----------------------------------------------------------------------
PHY_PINSY       ----------------------------------------------------------------------
MPRB_MYCBP      ----------------------------------------------------------------------
MPRB_MYCBO      ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------------
CHEB_TREPA      ----------------------------------------------------------------------
CHEB_PSEA6      ----------------------------------------------------------------------
CHEB5_GEOMG     ----------------------------------------------------------------------
CHEB1_RHORT     ----------------------------------------------------------------------
ARR7_ARATH      ----------------------------------------------------------------------
HOXA_RALEH      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
CHEB1_METMA     ----------------------------------------------------------------------
Y3689_SHEFN     ----------------------------------------------------------------------
PHYB_ORYSJ      ----------------------------------------------------------------------
PHYB1_SOLLC     ----------------------------------------------------------------------
NTRB_VIBAL      ----------------------------------------------------------------------
KDPE_ECOLI      ----------------------------------------------------------------------
DCTR_BACHD      ----------------------------------------------------------------------
CHEB_SYMTH      ----------------------------------------------------------------------
CHEB_CLOAB      ----------------------------------------------------------------------
CHEB_BACHD      ----------------------------------------------------------------------
CHEB1_MAGSA     ----------------------------------------------------------------------
YHCZ_BACSU      ----------------------------------------------------------------------
PRRA_MYCLE      ----------------------------------------------------------------------
PHYB_ORYSI      ----------------------------------------------------------------------
NTRB_KLEOX      ----------------------------------------------------------------------
MPRB_MYCSS      ----------------------------------------------------------------------
MPRB_MYCSK      ----------------------------------------------------------------------
MPRB_MYCSJ      ----------------------------------------------------------------------
ETR2_ARATH      ----------------------------------------------------------------------
DEGU_BREBE      ----------------------------------------------------------------------
CHEB_DESPS      ----------------------------------------------------------------------
VANS_ENTFA      ----------------------------------------------------------------------
RSTA_ECOLI      ----------------------------------------------------------------------
PHOP_SHIFL      ----------------------------------------------------------------------
PHOP_ECOLI      ----------------------------------------------------------------------
PHOP_ECOL6      ----------------------------------------------------------------------
NTRXL_RICBR     ----------------------------------------------------------------------
NISR_LACLA      ----------------------------------------------------------------------
EHD1_ORYSJ      ----------------------------------------------------------------------
EHD1_ORYSI      ----------------------------------------------------------------------
DCTS_BACSU      ----------------------------------------------------------------------
CHEB_PYRAB      ----------------------------------------------------------------------
CHEB_OCEIH      ----------------------------------------------------------------------
CHEB1_SACD2     ----------------------------------------------------------------------
ARR16_ARATH     ----------------------------------------------------------------------
VIRG_AGRRH      ----------------------------------------------------------------------
PRRA_MYCTU      ----------------------------------------------------------------------
PRRA_MYCBO      ----------------------------------------------------------------------
PHOQ_SALTY      ----------------------------------------------------------------------
PHOQ_SALTI      ----------------------------------------------------------------------
PHOQ_SALPA      ----------------------------------------------------------------------
PHOQ_SALCH      ----------------------------------------------------------------------
NTRC_RHOCA      ----------------------------------------------------------------------
CREB_ECOLI      ----------------------------------------------------------------------
CHEB5_ANADE     ----------------------------------------------------------------------
CHEB3_BRAJA     ----------------------------------------------------------------------
ARR20_ARATH     ----------------------------------------------------------------------
YXDJ_BACSU      ----------------------------------------------------------------------
SP0F_BACTK      ----------------------------------------------------------------------
PHYB_ARATH      ----------------------------------------------------------------------
NTRB_SALTY      ----------------------------------------------------------------------
NTRB_SALTI      ----------------------------------------------------------------------
LOVHK_PSESM     ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CSEC_STRCO      ----------------------------------------------------------------------
SP0A_CLODI      ----------------------------------------------------------------------
PHYB_SORBI      ----------------------------------------------------------------------
PHOP_ECO57      ----------------------------------------------------------------------
CSEC_STRAW      ----------------------------------------------------------------------
CHEV_BACSU      ----------------------------------------------------------------------
CHEB_THEMA      ----------------------------------------------------------------------
CHEB1_DECAR     ----------------------------------------------------------------------
CHEB1_CAUCR     ----------------------------------------------------------------------
CHEB1_CARHZ     ----------------------------------------------------------------------
NTRB_SHIFL      ----------------------------------------------------------------------
NTRB_ECOLI      ----------------------------------------------------------------------
NTRB_ECO57      ----------------------------------------------------------------------
LYTT_BACSU      ----------------------------------------------------------------------
GRAS_STAHJ      ----------------------------------------------------------------------
ENVZ_SHIFL      ----------------------------------------------------------------------
ENVZ_ECOLI      ----------------------------------------------------------------------
COPS_PSESM      ----------------------------------------------------------------------
CHEB_THETN      ----------------------------------------------------------------------
CHEB_SULDN      ----------------------------------------------------------------------
CHEB_NITWN      ----------------------------------------------------------------------
PHOP_SALTY      ----------------------------------------------------------------------
PHOP_SALTI      ----------------------------------------------------------------------
PHOP_SALPA      ----------------------------------------------------------------------
CHEB_PYRKO      ----------------------------------------------------------------------
CHEB_PYRHO      ----------------------------------------------------------------------
CHEB1_RHIEC     ----------------------------------------------------------------------
CHEB1_LEPIN     ----------------------------------------------------------------------
CHEB1_LEPIC     ----------------------------------------------------------------------
BCER_BACSU      ----------------------------------------------------------------------
UVRY_SHIFL      ----------------------------------------------------------------------
UVRY_ECOLI      ----------------------------------------------------------------------
SP0A_CLOAB      ----------------------------------------------------------------------
LOVHK_PSEU2     ----------------------------------------------------------------------
FIXL_RHIME      ----------------------------------------------------------------------
CHEY_YEREN      ----------------------------------------------------------------------
ARR15_ARATH     ----------------------------------------------------------------------
YFHA_ECOLI      ----------------------------------------------------------------------
YFHA_ECO57      ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
PILS_PSEAE      ----------------------------------------------------------------------
NTRY_AZOBR      ----------------------------------------------------------------------
CITS_BACHD      ----------------------------------------------------------------------
CHEB_NITEU      ----------------------------------------------------------------------
CHEB_LAWIP      ----------------------------------------------------------------------
CHEB_HALSA      ----------------------------------------------------------------------
CHEB1_RHIL3     ----------------------------------------------------------------------
YCF29_CYAPA     ----------------------------------------------------------------------
PHOQ_SHIFL      ----------------------------------------------------------------------
PHOQ_ECOLI      ----------------------------------------------------------------------
PHOQ_ECOL6      ----------------------------------------------------------------------
DCTS_BACHD      ----------------------------------------------------------------------
CHEB_RHOP2      ----------------------------------------------------------------------
CHEB_IDILO      ----------------------------------------------------------------------
CHEB3_RHOSH     ----------------------------------------------------------------------
ARCA_HAEIN      ----------------------------------------------------------------------
PHOQ_ECO57      ----------------------------------------------------------------------
LYTT_BACCR      ----------------------------------------------------------------------
HOXA_BRAJA      ----------------------------------------------------------------------
CHEB_SALRD      ----------------------------------------------------------------------
CHEB3_HAHCH     ----------------------------------------------------------------------
CHEB1_METAC     ----------------------------------------------------------------------
YDFI_BACSU      ----------------------------------------------------------------------
Y4XI_RHISN      ----------------------------------------------------------------------
SP0A_CLOPA      ----------------------------------------------------------------------
PETR_RHOCA      ----------------------------------------------------------------------
NTRB_RHOCA      ----------------------------------------------------------------------
NTRB_RHILP      ----------------------------------------------------------------------
GRAS_STAAW      ----------------------------------------------------------------------
GRAS_STAAT      ----------------------------------------------------------------------
GRAS_STAAS      ----------------------------------------------------------------------
GRAS_STAAN      ----------------------------------------------------------------------
GRAS_STAAM      ----------------------------------------------------------------------
GRAS_STAAE      ----------------------------------------------------------------------
GRAS_STAAC      ----------------------------------------------------------------------
GRAS_STAAB      ----------------------------------------------------------------------
GRAS_STAA9      ----------------------------------------------------------------------
GRAS_STAA8      ----------------------------------------------------------------------
GRAS_STAA3      ----------------------------------------------------------------------
GRAS_STAA2      ----------------------------------------------------------------------
GRAS_STAA1      ----------------------------------------------------------------------
CHEY_ECOL6      ----------------------------------------------------------------------
CHEB_THIDA      ----------------------------------------------------------------------
CHEB_NATPD      ----------------------------------------------------------------------
CHEB6_ANADE     ----------------------------------------------------------------------
CHEB3_CHRVO     ----------------------------------------------------------------------
CHEB2_RHIL3     ----------------------------------------------------------------------
CHEB1_RHOS4     ----------------------------------------------------------------------
CHEB1_DESDG     ----------------------------------------------------------------------
BASR_SALTY      ----------------------------------------------------------------------
BASR_ECOLI      ----------------------------------------------------------------------
UVRY_ECOL6      ----------------------------------------------------------------------
UVRY_ECO57      ----------------------------------------------------------------------
NTRB_PROVU      ----------------------------------------------------------------------
LYTT_BACAN      ----------------------------------------------------------------------
KIND_BACSU      ----------------------------------------------------------------------
CITA_KLEPN      ----------------------------------------------------------------------
CHEB_ROSDO      ----------------------------------------------------------------------
CHEB2_DESVH     ----------------------------------------------------------------------
CHEB2_DESDG     ----------------------------------------------------------------------
CHEB1_RHOPB     ----------------------------------------------------------------------
BVGA_BORPE      ----------------------------------------------------------------------
BVGA_BORPA      ----------------------------------------------------------------------
BVGA_BORBR      ----------------------------------------------------------------------
PHYC_SORBI      ----------------------------------------------------------------------
NTRB_BRASR      ----------------------------------------------------------------------
NARP_ECOLI      ----------------------------------------------------------------------
LIAR_BACSU      ----------------------------------------------------------------------
DEGM_BACB2      ----------------------------------------------------------------------
CHEY_YERPE      ----------------------------------------------------------------------
CHEY_SALTY      ----------------------------------------------------------------------
CHEY_SALTI      ----------------------------------------------------------------------
CHEB3_SYNWW     ----------------------------------------------------------------------
CHEB2_METHJ     ----------------------------------------------------------------------
CHEB1_HAHCH     ----------------------------------------------------------------------
CCDB_BACSU      ----------------------------------------------------------------------
BPHY_PSEAE      ----------------------------------------------------------------------
ARR22_ARATH     ----------------------------------------------------------------------
SAER_STAES      ----------------------------------------------------------------------
SAER_STAEQ      ----------------------------------------------------------------------
GACA_PSEU2      ----------------------------------------------------------------------
FIMZ_ECOLI      ----------------------------------------------------------------------
FIMZ_ECO57      ----------------------------------------------------------------------
ENVZ_SALTY      ----------------------------------------------------------------------
ENVZ_SALTI      ----------------------------------------------------------------------
CHEY_SHIFL      ----------------------------------------------------------------------
CHEY_PSEAE      ----------------------------------------------------------------------
CHEY_ENTCL      ----------------------------------------------------------------------
CHEY_ECOLI      ----------------------------------------------------------------------
CHEY_ECO57      ----------------------------------------------------------------------
CHEB_RHOPS      ----------------------------------------------------------------------
CHEB2_GEOSL     ----------------------------------------------------------------------
CHEB1_SYNAS     ----------------------------------------------------------------------
CHEB1_RHOFD     ----------------------------------------------------------------------
CHEB1_RHIME     ----------------------------------------------------------------------
YXDK_BACSU      ----------------------------------------------------------------------
NODW_BRAJA      ----------------------------------------------------------------------
DCTB_RHILE      ----------------------------------------------------------------------
CHEB_SHEFN      ----------------------------------------------------------------------
CHEB_NITHX      ----------------------------------------------------------------------
CHEB2_RHOPA     ----------------------------------------------------------------------
YCCH_BACSU      ----------------------------------------------------------------------
REGA_RHOCA      ----------------------------------------------------------------------
PKHA7_HUMAN     ----------------------------------------------------------------------
MALR_BACSU      ----------------------------------------------------------------------
LYTR_STRA5      ----------------------------------------------------------------------
LYTR_STRA3      ----------------------------------------------------------------------
FIXJ_BRAJA      ----------------------------------------------------------------------
DEGU_BACSU      ----------------------------------------------------------------------
CHEB_METFK      ----------------------------------------------------------------------
CHEB1_METHJ     ----------------------------------------------------------------------
YPH5_THIVI      ----------------------------------------------------------------------
VIRG_RHIRD      ----------------------------------------------------------------------
PFES_PSEAE      ----------------------------------------------------------------------
GACA_PSEFL      ----------------------------------------------------------------------
CHEB_MOOTA      ----------------------------------------------------------------------
VIRG_AGRT9      ----------------------------------------------------------------------
PRR1_SCHPO      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
GACA_PSEAE      ----------------------------------------------------------------------
DLTS_STRA5      ----------------------------------------------------------------------
CYAD_DICDI      ----------------------------------------------------------------------
CHEB_CHRSD      ----------------------------------------------------------------------
CHEB3_MAGSA     ----------------------------------------------------------------------
CHEB3_GEOMG     ----------------------------------------------------------------------
PHYD_ARATH      ----------------------------------------------------------------------
KINA_BACSU      ----------------------------------------------------------------------
CHEB3_RHOPB     ----------------------------------------------------------------------
CHEB1_BURTA     ----------------------------------------------------------------------
CHEB1_BURPS     ----------------------------------------------------------------------
CHEB1_BURP1     ----------------------------------------------------------------------
CHEB1_BURMA     ----------------------------------------------------------------------
YCF29_GUITH     ----------------------------------------------------------------------
CHEB3_RHORT     ----------------------------------------------------------------------
CHEB3_PSESM     ----------------------------------------------------------------------
Y0G0_VIBCH      ----------------------------------------------------------------------
MCPB_BACSU      ----------------------------------------------------------------------
MALK_BACSU      ----------------------------------------------------------------------
CHEB_RALSO      ----------------------------------------------------------------------
CHEB_PSEHT      ----------------------------------------------------------------------
CHEB_NITMU      ----------------------------------------------------------------------
CHEB3_PSE14     ----------------------------------------------------------------------
CHEB2_PSEU2     ----------------------------------------------------------------------
CHEB2_BURTA     ----------------------------------------------------------------------
CHEB2_BORA1     ----------------------------------------------------------------------
YFIK_BACSU      ----------------------------------------------------------------------
NUF2_CANAL      ----------------------------------------------------------------------
NARP_HAEIN      ----------------------------------------------------------------------
LYTR_STRMU      ----------------------------------------------------------------------
GACA_PSEVI      ----------------------------------------------------------------------
DLTS_STRA3      ----------------------------------------------------------------------
CHEB_NOSP7      ----------------------------------------------------------------------
CHEB_GEOKA      ----------------------------------------------------------------------
CHEB_BORPE      ----------------------------------------------------------------------
CHEB_BORPA      ----------------------------------------------------------------------
CHEB_BORBR      ----------------------------------------------------------------------
CHEB3_PSEAE     ----------------------------------------------------------------------
CHEB2_XANC8     ----------------------------------------------------------------------
CHEB2_SYNWW     ----------------------------------------------------------------------
CHEB1_XANCP     ----------------------------------------------------------------------
CHEB1_CHRVO     ----------------------------------------------------------------------
CHEA_LISMO      ----------------------------------------------------------------------
ARR19_ARATH     ----------------------------------------------------------------------
ARR13_ARATH     ----------------------------------------------------------------------
PMRA_PECCC      ----------------------------------------------------------------------
PKHA7_MOUSE     ----------------------------------------------------------------------
DCTR_RHOCA      ----------------------------------------------------------------------
DCTD_RHILE      ----------------------------------------------------------------------
CHEB_THICR      ----------------------------------------------------------------------
CHEB3_VIBCH     ----------------------------------------------------------------------
CHEB2_XANOR     ----------------------------------------------------------------------
CHEB2_XANOM     ----------------------------------------------------------------------
CHEB2_RALEJ     ----------------------------------------------------------------------
CHEB2_BRAJA     ----------------------------------------------------------------------
CHEB1_XANC5     ----------------------------------------------------------------------
CHEB1_XANAC     ----------------------------------------------------------------------
CHEB1_MYXXD     ----------------------------------------------------------------------
CHEB1_DESVH     ----------------------------------------------------------------------
CPS_CLOTH       ----------------------------------------------------------------------
CHEB_SHISS      ----------------------------------------------------------------------
CHEB_SHIFL      ----------------------------------------------------------------------
CHEB_SHIBS      ----------------------------------------------------------------------
CHEB_SALTY      ----------------------------------------------------------------------
CHEB_SALTI      ----------------------------------------------------------------------
CHEB_SALPA      ----------------------------------------------------------------------
CHEB_SALCH      ----------------------------------------------------------------------
CHEB_MARMM      ----------------------------------------------------------------------
CHEB_HALMA      ----------------------------------------------------------------------
CHEB_ENTCL      ----------------------------------------------------------------------
CHEB_ECOUT      ----------------------------------------------------------------------
CHEB_ECOLI      ----------------------------------------------------------------------
CHEB_ECOL6      ----------------------------------------------------------------------
CHEB_ECOL5      ----------------------------------------------------------------------
CHEB_ECO57      ----------------------------------------------------------------------
CHEB2_PHOPR     ----------------------------------------------------------------------
CHEB1_PSEPF     ----------------------------------------------------------------------
CHEB1_BURCA     ----------------------------------------------------------------------
CHEB1_ACIBL     ----------------------------------------------------------------------
CHEA_THEMA      ----------------------------------------------------------------------
REGA_RHOS4      ----------------------------------------------------------------------
PHYA_ARATH      ----------------------------------------------------------------------
KIF15_HUMAN     ----------------------------------------------------------------------
GLNL_BACSU      ----------------------------------------------------------------------
CHEB_YERPS      ----------------------------------------------------------------------
CHEB_YERPN      ----------------------------------------------------------------------
CHEB_YERPE      ----------------------------------------------------------------------
CHEB_YERPA      ----------------------------------------------------------------------
CHEB_PHOLL      ----------------------------------------------------------------------
CHEB_BURXL      ----------------------------------------------------------------------
CHEB2_CAUCR     ----------------------------------------------------------------------
CHEB2_ANADE     ----------------------------------------------------------------------
CHEB1_ANADE     ----------------------------------------------------------------------
NTRX_AZOC5      ----------------------------------------------------------------------
LIAS_BACSU      ----------------------------------------------------------------------
CTRA_OCHA4      ----------------------------------------------------------------------
CTRA_BRUSU      ----------------------------------------------------------------------
CTRA_BRUSI      ----------------------------------------------------------------------
CTRA_BRUO2      ----------------------------------------------------------------------
CTRA_BRUME      ----------------------------------------------------------------------
CTRA_BRUC2      ----------------------------------------------------------------------
CTRA_BRUAB      ----------------------------------------------------------------------
CTRA_BRUA2      ----------------------------------------------------------------------
CTRA_BRUA1      ----------------------------------------------------------------------
CHEB4_BURTA     ----------------------------------------------------------------------
CHEB2_PSEAE     ----------------------------------------------------------------------
CHEB2_BURPS     ----------------------------------------------------------------------
CHEB2_BURP1     ----------------------------------------------------------------------
CHEB2_BURMA     ----------------------------------------------------------------------
CHEB1_RALME     ----------------------------------------------------------------------
NREB_STAAW      ----------------------------------------------------------------------
NREB_STAAT      ----------------------------------------------------------------------
NREB_STAAS      ----------------------------------------------------------------------
NREB_STAAR      ----------------------------------------------------------------------
NREB_STAAN      ----------------------------------------------------------------------
NREB_STAAM      ----------------------------------------------------------------------
NREB_STAAE      ----------------------------------------------------------------------
NREB_STAAC      ----------------------------------------------------------------------
NREB_STAAB      ----------------------------------------------------------------------
NREB_STAA9      ----------------------------------------------------------------------
NREB_STAA8      ----------------------------------------------------------------------
NREB_STAA3      ----------------------------------------------------------------------
NREB_STAA2      ----------------------------------------------------------------------
NREB_STAA1      ----------------------------------------------------------------------
NARL_SHIFL      ----------------------------------------------------------------------
NARL_ECOLI      ----------------------------------------------------------------------
NARL_ECOL6      ----------------------------------------------------------------------
NARL_ECO57      ----------------------------------------------------------------------
LYTT_ENTFA      ----------------------------------------------------------------------
HUPR_RHOCA      ----------------------------------------------------------------------
CHEB_ERWCT      ----------------------------------------------------------------------
CHEB3_BURS3     ----------------------------------------------------------------------
CHEB2_RALME     ----------------------------------------------------------------------
CHEB2_METAC     ----------------------------------------------------------------------
CHEB1_GEOMG     ----------------------------------------------------------------------
Y899_CHLAA      ----------------------------------------------------------------------
NREB_STACT      ----------------------------------------------------------------------
MTRA_MYCTU      ----------------------------------------------------------------------
MTRA_MYCPA      ----------------------------------------------------------------------
MTRA_MYCLE      ----------------------------------------------------------------------
MTRA_MYCBO      ----------------------------------------------------------------------
LYTS_STAS1      ----------------------------------------------------------------------
LMNB1_HUMAN     ----------------------------------------------------------------------
DCUR_SHIFL      ----------------------------------------------------------------------
CHEB_RHILO      ----------------------------------------------------------------------
CHEB2_VIBVY     ----------------------------------------------------------------------
CHEB2_VIBVU     ----------------------------------------------------------------------
CHEB2_CHRVO     ----------------------------------------------------------------------
CHEB1_BURS3     ----------------------------------------------------------------------
CHEA_LISIN      ----------------------------------------------------------------------
BAER_ECOLI      ----------------------------------------------------------------------
BAER_ECOL6      ----------------------------------------------------------------------
YESN_BACSU      ----------------------------------------------------------------------
PYRB_CLOPS      ----------------------------------------------------------------------
PYRB_CLOPE      ----------------------------------------------------------------------
PYRB_CLOP1      ----------------------------------------------------------------------
GRAS_STAS1      ----------------------------------------------------------------------
DCUS_SHIFL      ----------------------------------------------------------------------
DCUS_ECOLI      ----------------------------------------------------------------------
DCUS_ECOL6      ----------------------------------------------------------------------
DCUS_ECO57      ----------------------------------------------------------------------
DCUR_ECOLI      ----------------------------------------------------------------------
DCUR_ECO57      ----------------------------------------------------------------------
CHEB3_LEPIN     ----------------------------------------------------------------------
CHEB3_LEPIC     ----------------------------------------------------------------------
CHEB2_SHESR     ----------------------------------------------------------------------
CHEB2_SHESM     ----------------------------------------------------------------------
CHEB2_RHORT     ----------------------------------------------------------------------
CHEB2_PSESM     ----------------------------------------------------------------------
CHEB2_BURCA     ----------------------------------------------------------------------
CHEB1_VIBVY     ----------------------------------------------------------------------
CHEB1_VIBVU     ----------------------------------------------------------------------
CHEB1_PSEF5     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LUXQ_VIBPA      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
LUXQ_VIBVY      ----------------------------------------------------------------------
LUXQ_VIBVU      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
ARCB_SHIFL      ----------------------------------------------------------------------
ARCB_ECOLI      ----------------------------------------------------------------------
ARCB_ECO57      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
GACS_PSESY      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
BVGS_BORPE      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
TCSA_EMENI      ----------------------------------------------------------------------
DOKA_DICDI      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
MAK2_SCHPO      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
ETR1_PASED      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
DHKL_DICDI      ----------------------------------------------------------------------
ETR1_PELHO      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
DHKF_DICDI      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
MAK1_SCHPO      ----------------------------------------------------------------------
PLEC_CAUCR      ----------------------------------------------------------------------
ERS1_ARATH      ----------------------------------------------------------------------
TORS_ECOLI      ----------------------------------------------------------------------
EVGS_ECOLI      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
ETR1_ARATH      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------
ETR1_BRAOL      ----------------------------------------------------------------------
DSPA_SYNY3      ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
PHOR_BACSU      ----------------------------------------------------------------------
SAES_STAAE      ----------------------------------------------------------------------
SAES_STAAC      ----------------------------------------------------------------------
SAES_STAA8      ----------------------------------------------------------------------
SAES_STAA3      ----------------------------------------------------------------------
ARCB_HAEIN      ----------------------------------------------------------------------
SASA_SYNJA      ----------------------------------------------------------------------
SAES_STAAR      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
DIVL_CAUCR      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SASA_CYAA5      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SAES_STAAW      ----------------------------------------------------------------------
SAES_STAAS      ----------------------------------------------------------------------
SAES_STAAN      ----------------------------------------------------------------------
SAES_STAAM      ----------------------------------------------------------------------
SAES_STAAB      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_THEEB      ----------------------------------------------------------------------
PHOR_ECOLI      ----------------------------------------------------------------------
WALK_STAHJ      ----------------------------------------------------------------------
WALK_STAAR      ----------------------------------------------------------------------
WALK_STAAW      ----------------------------------------------------------------------
WALK_STAAU      ----------------------------------------------------------------------
WALK_STAAT      ----------------------------------------------------------------------
WALK_STAAS      ----------------------------------------------------------------------
WALK_STAAN      ----------------------------------------------------------------------
WALK_STAAM      ----------------------------------------------------------------------
WALK_STAAE      ----------------------------------------------------------------------
WALK_STAAC      ----------------------------------------------------------------------
WALK_STAAB      ----------------------------------------------------------------------
WALK_STAA9      ----------------------------------------------------------------------
WALK_STAA8      ----------------------------------------------------------------------
WALK_STAA3      ----------------------------------------------------------------------
WALK_STAA2      ----------------------------------------------------------------------
WALK_STAA1      ----------------------------------------------------------------------
YCF26_PORYE     ----------------------------------------------------------------------
YYCG_BACSU      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
WALK_STASR      ----------------------------------------------------------------------
PHOR_SHIDY      ----------------------------------------------------------------------
WALK_STAS1      ----------------------------------------------------------------------
PHOR_KLEPN      ----------------------------------------------------------------------
SASA_SYNJB      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
YCF29_PORYE     ----------------------------------------------------------------------
BAES_ECOLI      ----------------------------------------------------------------------
Y851_SYNP2      ----------------------------------------------------------------------
SASA_PROMA      ----------------------------------------------------------------------
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
LUXN_VIBHB      ----------------------------------------------------------------------
LUXN_VIBHA      ----------------------------------------------------------------------
YSO1_PLEBO      ----------------------------------------------------------------------
WALK_STAES      ----------------------------------------------------------------------
WALK_STAEQ      ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
MTRB_MYCPA      ----------------------------------------------------------------------
EVGS_ECO57      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
PILH_PSEAE      ----------------------------------------------------------------------
MTRB_MYCLE      ----------------------------------------------------------------------
SASA_SYNE7      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------
PHOR_HAEIN      ----------------------------------------------------------------------
DIVK_OCHA4      ----------------------------------------------------------------------
DHKM_DICDI      ----------------------------------------------------------------------
YFHK_ECOLI      ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SASA_SYNS3      ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
ARLS_STAS1      ----------------------------------------------------------------------
SRRA_STAAW      ----------------------------------------------------------------------
SRRA_STAAU      ----------------------------------------------------------------------
SRRA_STAAS      ----------------------------------------------------------------------
SRRA_STAAR      ----------------------------------------------------------------------
SRRA_STAAN      ----------------------------------------------------------------------
SRRA_STAAM      ----------------------------------------------------------------------
SRRA_STAAC      ----------------------------------------------------------------------
SRRA_STAA8      ----------------------------------------------------------------------
MTRB_MYCTU      ----------------------------------------------------------------------
MTRB_MYCBO      ----------------------------------------------------------------------
KDPD_ECOLI      ----------------------------------------------------------------------
EIN4_ARATH      ----------------------------------------------------------------------
DHKH_DICDI      ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
DIVK_BRUSU      ----------------------------------------------------------------------
DIVK_BRUSI      ----------------------------------------------------------------------
DIVK_BRUO2      ----------------------------------------------------------------------
DIVK_BRUME      ----------------------------------------------------------------------
DIVK_BRUC2      ----------------------------------------------------------------------
DIVK_BRUAB      ----------------------------------------------------------------------
DIVK_BRUA2      ----------------------------------------------------------------------
DIVK_BRUA1      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
RSSA_SERMA      ----------------------------------------------------------------------
OMPR_SHIFL      ----------------------------------------------------------------------
OMPR_SALTY      ----------------------------------------------------------------------
OMPR_SALTI      ----------------------------------------------------------------------
OMPR_ECOLI      ----------------------------------------------------------------------
OMPR_ECOL6      ----------------------------------------------------------------------
OMPR_ECO57      ----------------------------------------------------------------------
YYCF_BACSU      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
HSSR_STAES      ----------------------------------------------------------------------
HSSR_STAEQ      ----------------------------------------------------------------------
CQSS_VIBHB      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
MAK3_SCHPO      ----------------------------------------------------------------------
ZRAS_SALTY      -----------------------------------------