[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49907.1

[Show Plain Result]


## Summary of Sequence Search
    1::277
   30::265     4e-47  36%  266 aa  FLIY_ECOLI RecName: Full=Cystine-binding periplasmic protein;      
   30::265     4e-47  36%  266 aa  FLIY_ECOL6 RecName: Full=Cystine-binding periplasmic protein;      
   20::267     7e-34  33%  268 aa  TCYA_BACSU RecName: Full=L-cystine-binding protein tcyA;Flags:
   30::261     2e-33  33%  264 aa  YXEM_BACSU RecName: Full=Probable amino-acid-binding protein
   31::257     6e-33  35%  260 aa  ARGT_SALTY RecName: Full=Lysine-arginine-ornithine-binding
   31::257     3e-31  33%  260 aa  ARGT_ECOLI RecName: Full=Lysine-arginine-ornithine-binding
   28::256     4e-30  29%  257 aa  Y1080_HAEIN RecName: Full=Probable amino-acid ABC
   31::257     5e-30  35%  260 aa  HISJ_SALTY RecName: Full=Histidine-binding periplasmic protein;    
   27::246     8e-30  29%  248 aa  GLNH_ECOLI RecName: Full=Glutamine-binding periplasmic protein;    
   27::246     8e-30  29%  248 aa  GLNH_ECOL6 RecName: Full=Glutamine-binding periplasmic protein;    
   27::246     8e-30  29%  248 aa  GLNH_ECO57 RecName: Full=Glutamine-binding periplasmic protein;    
   31::257     1e-29  35%  260 aa  HISJ_ECOLI RecName: Full=Histidine-binding periplasmic protein;    
   31::257     1e-29  35%  260 aa  HISJ_ECOL6 RecName: Full=Histidine-binding periplasmic protein;    
   31::257     1e-29  35%  260 aa  HISJ_ECO57 RecName: Full=Histidine-binding periplasmic protein;    
   34::251     3e-28  35%  255 aa  ARTP_BACSU RecName: Full=Arginine-binding extracellular protein
   30::243     3e-27  31%  243 aa  ARTI_ECOLI RecName: Full=Putative ABC transporter arginine-binding
   25::247     4e-27  32%  248 aa  PATH_VIBHA RecName: Full=Putative amino-acid ABC
   26::241     3e-26  30%  243 aa  ARTJ_ECOLI RecName: Full=ABC transporter arginine-binding protein
   42::253     5e-25  30%  256 aa  HISJ_CAMJE RecName: Full=Histidine-binding protein;       
   24::282     2e-24  29%  283 aa  NOCT_AGRT5 RecName: Full=Nopaline-binding periplasmic
   47::262     4e-24  30%  268 aa  HISJ_NEIGO RecName: Full=Histidine-binding protein;       
   26::261     7e-24  34%  262 aa  GLNH_BACST RecName: Full=Glutamine-binding protein;       
   24::233     2e-23  29%  237 aa  LAPT_PASHA RecName: Full=Arginine-binding periplasmic
   21::274     2e-23  32%  276 aa  OCCT_RHIRD RecName: Full=Octopine-binding periplasmic
   21::274     2e-23  32%  276 aa  OCCT_AGRT4 RecName: Full=Octopine-binding periplasmic
   24::270     3e-23  31%  273 aa  GLNH_BACSU RecName: Full=ABC transporter glutamine-binding protein
   22::292     1e-22  33%  294 aa  OCCT_RHIME RecName: Full=Octopine-binding periplasmic
   39::277     6e-22  31%  287 aa  YCKB_BACSU RecName: Full=Probable ABC transporter
   20::277     3e-21  30%  302 aa  GLTI_SALTY RecName: Full=Glutamate/aspartate periplasmic-binding
   34::277     3e-19  29%  302 aa  GLTI_ECOLI RecName: Full=Glutamate/aspartate periplasmic-binding
   31::257     2e-17  25%  268 aa  PHEC_PSEAE RecName: Full=Cyclohexadienyl dehydratase;Includes:
   41::280     4e-17  27%  295 aa  GLUB_CORGL RecName: Full=Glutamate-binding protein;Flags:
   39::249     6e-17  28%  253 aa  AABA_DICNO RecName: Full=Amino-acid-binding protein aabA;Flags:
   37::253     1e-16  25%  257 aa  ARTJ_CHLTR RecName: Full=Probable ABC transporter arginine-binding
   30::261     2e-16  22%  269 aa  TCYJ_BACSU RecName: Full=L-cystine-binding protein tcyJ;Flags:
   41::280     2e-16  25%  294 aa  GLUB_COREF RecName: Full=Glutamate-binding protein;Flags:
   33::264     3e-15  26%  270 aa  TCYK_BACSU RecName: Full=L-cystine-binding protein tcyK;Flags:
   62::261     3e-15  25%  454 aa  MLTF_DESOH RecName: Full=Membrane-bound lytic murein
   37::268     1e-14  28%  514 aa  MLTF_PHOPR RecName: Full=Membrane-bound lytic murein
   26::239     1e-13  23%  239 aa  ARTI_HAEIN RecName: Full=ABC transporter arginine-binding
   22::257     1e-13  26%  501 aa  MLTF_COLP3 RecName: Full=Membrane-bound lytic murein
   31::257     2e-12  25%  259 aa  PEB1A_CAMJJ RecName: Full=Major cell-binding factor;AltName:
   31::257     3e-12  25%  259 aa  PEB1A_CAMJE RecName: Full=Major cell-binding factor;AltName:
   42::164     1e-11  32%  300 aa  Y4TE_RHISN RecName: Full=Probable amino-acid ABC transporter
   35::268     2e-11  27%  496 aa  MLTF_AERHH RecName: Full=Membrane-bound lytic murein
   30::236     4e-11  27%  341 aa  AAPJ_RHIL3 RecName: Full=General L-amino acid-binding periplasmic
   32::264     3e-10  23%  486 aa  MLTF_PSEF5 RecName: Full=Membrane-bound lytic murein
   27::264     3e-10  25%  466 aa  MLTF_SODGM RecName: Full=Membrane-bound lytic murein
   41::174     3e-10  29%  501 aa  MLTF_SACD2 RecName: Full=Membrane-bound lytic murein
   35::268     7e-10  26%  496 aa  MLTF_AERS4 RecName: Full=Membrane-bound lytic murein
   27::237     2e-09  27%  341 aa  YHDW_ECO57 RecName: Full=Putative amino-acid ABC
   33::267     2e-09  28%  495 aa  MLTF_VIBF1 RecName: Full=Membrane-bound lytic murein
   32::264     2e-09  23%  486 aa  MLTF_PSEPF RecName: Full=Membrane-bound lytic murein
   38::265     4e-09  27%  511 aa  MLTF_KLEP7 RecName: Full=Membrane-bound lytic murein
   27::264     6e-09  24%  486 aa  MLTF_YERE8 RecName: Full=Membrane-bound lytic murein
  505::594     6e-09  37%  991 aa  GLK1_DROME RecName: Full=Glutamate receptor 1;AltName:
   30::265     8e-09  24%  483 aa  MLTF_ACTP2 RecName: Full=Membrane-bound lytic murein
   30::265     1e-08  23%  483 aa  MLTF_ACTPJ RecName: Full=Membrane-bound lytic murein
   30::265     1e-08  23%  483 aa  MLTF_ACTP7 RecName: Full=Membrane-bound lytic murein
   32::264     1e-08  23%  485 aa  MLTF_PSEPG RecName: Full=Membrane-bound lytic murein
   29::237     2e-08  26%  341 aa  YHDW_ECOLI RecName: Full=Putative amino-acid ABC
   32::136     2e-08  31%  530 aa  MLTF_VIBCH RecName: Full=Membrane-bound lytic murein
   32::136     2e-08  31%  530 aa  MLTF_VIBC3 RecName: Full=Membrane-bound lytic murein
   54::263     2e-08  23%  467 aa  MLTF_ALCBS RecName: Full=Membrane-bound lytic murein
   29::169     3e-08  24%  488 aa  MLTF_PSEMY RecName: Full=Membrane-bound lytic murein
   32::264     4e-08  23%  485 aa  MLTF_PSEP1 RecName: Full=Membrane-bound lytic murein
  465::547     4e-08  41% 1009 aa  GRID1_RAT RecName: Full=Glutamate receptor delta-1 subunit;        
  465::547     4e-08  41% 1009 aa  GRID1_MOUSE RecName: Full=Glutamate receptor delta-1 subunit;      
  465::547     4e-08  41% 1009 aa  GRID1_HUMAN RecName: Full=Glutamate receptor delta-1 subunit;      
   27::264     5e-08  25%  486 aa  MLTF_YERPY RecName: Full=Membrane-bound lytic murein
   27::264     5e-08  25%  486 aa  MLTF_YERPS RecName: Full=Membrane-bound lytic murein
   27::264     5e-08  25%  486 aa  MLTF_YERPP RecName: Full=Membrane-bound lytic murein
   27::264     5e-08  25%  486 aa  MLTF_YERPN RecName: Full=Membrane-bound lytic murein
   27::264     5e-08  25%  486 aa  MLTF_YERPG RecName: Full=Membrane-bound lytic murein
   27::264     5e-08  25%  486 aa  MLTF_YERPE RecName: Full=Membrane-bound lytic murein
   27::264     5e-08  25%  486 aa  MLTF_YERPB RecName: Full=Membrane-bound lytic murein
   27::264     5e-08  25%  486 aa  MLTF_YERPA RecName: Full=Membrane-bound lytic murein
   27::264     5e-08  25%  486 aa  MLTF_YERP3 RecName: Full=Membrane-bound lytic murein
   41::141     5e-08  31%  478 aa  MLTF_SHEON RecName: Full=Membrane-bound lytic murein
   32::264     5e-08  24%  485 aa  MLTF_PSEPK RecName: Full=Membrane-bound lytic murein
   41::141     7e-08  30%  476 aa  MLTF_SHEB9 RecName: Full=Membrane-bound lytic murein
   41::141     7e-08  30%  476 aa  MLTF_SHEB8 RecName: Full=Membrane-bound lytic murein
   41::141     7e-08  30%  476 aa  MLTF_SHEB5 RecName: Full=Membrane-bound lytic murein
   36::264     7e-08  26%  486 aa  MLTF_SERP5 RecName: Full=Membrane-bound lytic murein
   41::141     9e-08  31%  478 aa  MLTF_SHESM RecName: Full=Membrane-bound lytic murein
   41::141     1e-07  31%  478 aa  MLTF_SHESR RecName: Full=Membrane-bound lytic murein
   41::141     1e-07  31%  478 aa  MLTF_SHESA RecName: Full=Membrane-bound lytic murein
   25::261     1e-07  26%  455 aa  MLTF_IDILO RecName: Full=Membrane-bound lytic murein
   41::141     2e-07  29%  477 aa  MLTF_SHESW RecName: Full=Membrane-bound lytic murein
   41::141     2e-07  29%  477 aa  MLTF_SHEPC RecName: Full=Membrane-bound lytic murein
   24::192     2e-07  24%  479 aa  MLTF_SHEPA RecName: Full=Membrane-bound lytic murein
   43::164     3e-07  29%  476 aa  MLTF_SHEFN RecName: Full=Membrane-bound lytic murein
   53::265     4e-07  26%  518 aa  MLTF_SHIDS RecName: Full=Membrane-bound lytic murein
   33::265     4e-07  23%  514 aa  MLTF_SALPB RecName: Full=Membrane-bound lytic murein
   54::255     6e-07  25%  476 aa  MLTF_SHELP RecName: Full=Membrane-bound lytic murein
   32::264     6e-07  23%  485 aa  MLTF_PSEE4 RecName: Full=Membrane-bound lytic murein
   57::256     1e-06  25%  480 aa  MLTF_SHEWM RecName: Full=Membrane-bound lytic murein
  418::546     1e-06  29%  919 aa  GRIK3_RAT RecName: Full=Glutamate receptor, ionotropic kainate
  418::546     1e-06  29%  919 aa  GRIK3_MACFA RecName: Full=Glutamate receptor, ionotropic kainate
  418::546     1e-06  29%  919 aa  GRIK3_HUMAN RecName: Full=Glutamate receptor, ionotropic kainate
   50::146     1e-06  29%  487 aa  GLRK_RANBE RecName: Full=Probable glutamate receptor;AltName:
   42::266     1e-06  25%  478 aa  MLTF_NITMU RecName: Full=Membrane-bound lytic murein
   34::265     1e-06  25%  518 aa  MLTF_ECOSM RecName: Full=Membrane-bound lytic murein
   53::265     2e-06  26%  518 aa  MLTF_SHIF8 RecName: Full=Membrane-bound lytic murein
   33::273     2e-06  24%  495 aa  MLTF_CELJU RecName: Full=Membrane-bound lytic murein
   53::265     2e-06  25%  518 aa  MLTF_SHIFL RecName: Full=Membrane-bound lytic murein
   53::265     2e-06  25%  518 aa  MLTF_SHIBS RecName: Full=Membrane-bound lytic murein
   53::265     2e-06  25%  518 aa  MLTF_SHIB3 RecName: Full=Membrane-bound lytic murein
   53::265     2e-06  25%  518 aa  MLTF_ECOLI RecName: Full=Membrane-bound lytic murein
   53::265     2e-06  25%  518 aa  MLTF_ECOLC RecName: Full=Membrane-bound lytic murein
   53::265     2e-06  25%  518 aa  MLTF_ECOHS RecName: Full=Membrane-bound lytic murein
   53::265     2e-06  25%  518 aa  MLTF_ECODH RecName: Full=Membrane-bound lytic murein
   53::265     2e-06  25%  518 aa  MLTF_ECO57 RecName: Full=Membrane-bound lytic murein
   53::265     2e-06  25%  518 aa  MLTF_ECO11 RecName: Full=Membrane-bound lytic murein
  530::603     4e-06  27%  977 aa  GLR2_CAEEL RecName: Full=Glutamate receptor 2;Flags: Precursor;
  489::575     4e-06  34%  962 aa  GLR1_CAEEL RecName: Full=Glutamate receptor 1;Flags: Precursor;
   32::264     5e-06  22%  485 aa  MLTF_PSEPW RecName: Full=Membrane-bound lytic murein
   22::256     5e-06  27%  470 aa  MLTF_PSEHT RecName: Full=Membrane-bound lytic murein
   53::265     5e-06  25%  518 aa  MLTF_ECOUT RecName: Full=Membrane-bound lytic murein
   53::265     5e-06  25%  518 aa  MLTF_ECOL5 RecName: Full=Membrane-bound lytic murein
   53::265     5e-06  25%  518 aa  MLTF_ECOK1 RecName: Full=Membrane-bound lytic murein
   53::265     5e-06  25%  518 aa  MLTF_ECO24 RecName: Full=Membrane-bound lytic murein
   53::265     6e-06  25%  518 aa  MLTF_ECOL6 RecName: Full=Membrane-bound lytic murein
  491::549     8e-06  34% 1237 aa  NMDE3_RAT RecName: Full=Glutamate [NMDA] receptor subunit
  491::541     8e-06  40% 1239 aa  NMDE3_MOUSE RecName: Full=Glutamate [NMDA] receptor subunit
  491::541     1e-05  38% 1236 aa  NMDE3_HUMAN RecName: Full=Glutamate [NMDA] receptor subunit
   33::264     1e-05  22%  497 aa  MLTF_PSESM RecName: Full=Membrane-bound lytic murein
  496::568     1e-05  33% 1323 aa  NMDE4_RAT RecName: Full=Glutamate [NMDA] receptor subunit
  496::568     1e-05  33% 1323 aa  NMDE4_MOUSE RecName: Full=Glutamate [NMDA] receptor subunit
  499::571     1e-05  33% 1336 aa  NMDE4_HUMAN RecName: Full=Glutamate [NMDA] receptor subunit
   33::264     1e-05  22%  496 aa  MLTF_PSE14 RecName: Full=Membrane-bound lytic murein
  466::541     1e-05  39% 1009 aa  GRID2_DANRE RecName: Full=Glutamate receptor delta-2 subunit;      
   24::232     1e-05  27%  338 aa  BZTA_RHOCA RecName:
   29::136     2e-05  36%  467 aa  MLTF_SULDN RecName: Full=Membrane-bound lytic murein
   53::265     2e-05  24%  518 aa  MLTF_SHISS RecName: Full=Membrane-bound lytic murein
   33::264     2e-05  22%  498 aa  MLTF_PSEU2 RecName: Full=Membrane-bound lytic murein
  441::518     2e-05  35%  956 aa  GRIK4_RAT RecName: Full=Glutamate receptor, ionotropic kainate
  441::518     2e-05  35%  956 aa  GRIK4_PANTR RecName: Full=Glutamate receptor, ionotropic kainate
  441::518     2e-05  35%  956 aa  GRIK4_MOUSE RecName: Full=Glutamate receptor, ionotropic kainate
  441::518     2e-05  35%  956 aa  GRIK4_HUMAN RecName: Full=Glutamate receptor, ionotropic kainate
  440::528     2e-05  29%  902 aa  GRIA4_RAT RecName: Full=Glutamate receptor 4;         Short=GluR-4;
  440::528     2e-05  29%  902 aa  GRIA4_MOUSE RecName: Full=Glutamate receptor 4;       
  440::528     2e-05  29%  902 aa  GRIA4_MACFA RecName: Full=Glutamate receptor 4;       
  440::528     2e-05  29%  902 aa  GRIA4_HUMAN RecName: Full=Glutamate receptor 4;       
   32::281     3e-05  24%  534 aa  MLTF_VIBHB RecName: Full=Membrane-bound lytic murein
   30::264     3e-05  20%  479 aa  MLTF_HAES2 RecName: Full=Membrane-bound lytic murein
   30::264     3e-05  20%  482 aa  MLTF_HAES1 RecName: Full=Membrane-bound lytic murein
   42::192     4e-05  26%  475 aa  MLTF_SHEHH RecName: Full=Membrane-bound lytic murein
   50::145     4e-05  24%  481 aa  MLTF_SHEAM RecName: Full=Membrane-bound lytic murein
   30::266     4e-05  22%  492 aa  MLTF_PASMU RecName: Full=Membrane-bound lytic murein
  376::529     5e-05  22% 1238 aa  BVGS_BORPE RecName: Full=Virulence sensor protein bvgS;       
   34::264     7e-05  24%  486 aa  MLTF_PSEU5 RecName: Full=Membrane-bound lytic murein
  434::559     7e-05  28%  918 aa  GRIK1_MACFA RecName: Full=Glutamate receptor, ionotropic kainate
  434::559     7e-05  28%  918 aa  GRIK1_HUMAN RecName: Full=Glutamate receptor, ionotropic kainate
  440::517     9e-05  30%  979 aa  GRIK5_RAT RecName: Full=Glutamate receptor, ionotropic kainate
  440::517     9e-05  30%  979 aa  GRIK5_MOUSE RecName: Full=Glutamate receptor, ionotropic kainate
  440::517     9e-05  30%  980 aa  GRIK5_HUMAN RecName: Full=Glutamate receptor, ionotropic kainate
   26::152     9e-05  21%  479 aa  GLRK_XENLA RecName: Full=Glutamate receptor U1;AltName:
   33::265     1e-04  23%  517 aa  MLTF_ENT38 RecName: Full=Membrane-bound lytic murein
  447::530     1e-04  31%  888 aa  GRIA3_RAT RecName: Full=Glutamate receptor 3;         Short=GluR-3;
  447::530     1e-04  31%  888 aa  GRIA3_MOUSE RecName: Full=Glutamate receptor 3;       
  453::536     1e-04  31%  894 aa  GRIA3_MACFA RecName: Full=Glutamate receptor 3;       
  453::536     1e-04  31%  894 aa  GRIA3_HUMAN RecName: Full=Glutamate receptor 3;       
  406::527     1e-04  28%  883 aa  GRIA2_RAT RecName: Full=Glutamate receptor 2;       
  406::527     1e-04  28%  883 aa  GRIA2_PONAB RecName: Full=Glutamate receptor 2;       
  406::527     1e-04  28%  883 aa  GRIA2_MOUSE RecName: Full=Glutamate receptor 2;       
  406::527     1e-04  28%  883 aa  GRIA2_MACFA RecName: Full=Glutamate receptor 2;       
  406::527     1e-04  28%  883 aa  GRIA2_HUMAN RecName: Full=Glutamate receptor 2;       
  494::552     2e-04  29% 1482 aa  NMDE2_RAT RecName: Full=Glutamate [NMDA] receptor subunit
  494::552     2e-04  29% 1482 aa  NMDE2_MOUSE RecName: Full=Glutamate [NMDA] receptor subunit
  494::552     2e-04  29% 1484 aa  NMDE2_HUMAN RecName: Full=Glutamate [NMDA] receptor subunit
  494::552     2e-04  29% 1485 aa  NMDE2_CANFA RecName: Full=Glutamate [NMDA] receptor subunit
  419::544     2e-04  27%  836 aa  GRIK1_MOUSE RecName: Full=Glutamate receptor, ionotropic kainate
  458::540     2e-04  30%  917 aa  GLRK_LYMST RecName: Full=Glutamate receptor;Flags: Precursor;
  497::544     2e-04  35%  938 aa  NMDZ1_RAT RecName: Full=Glutamate [NMDA] receptor subunit
  497::544     2e-04  35%  938 aa  NMDZ1_MOUSE RecName: Full=Glutamate [NMDA] receptor subunit
  497::544     2e-04  35%  938 aa  NMDZ1_HUMAN RecName: Full=Glutamate [NMDA] receptor subunit
  518::565     2e-04  35%  943 aa  NMDZ1_CANFA RecName: Full=Glutamate [NMDA] receptor subunit
  434::559     2e-04  30%  949 aa  GRIK1_RAT RecName: Full=Glutamate receptor, ionotropic kainate
  432::520     2e-04  26%  907 aa  GRIA1_RAT RecName: Full=Glutamate receptor 1;       
  432::520     2e-04  26%  907 aa  GRIA1_MOUSE RecName: Full=Glutamate receptor 1;       
  432::520     2e-04  26%  906 aa  GRIA1_MACFA RecName: Full=Glutamate receptor 1;       
  432::520     2e-04  26%  906 aa  GRIA1_HUMAN RecName: Full=Glutamate receptor 1;       
  511::558     3e-04  35%  997 aa  NMDA1_DROYA RecName: Full=Glutamate [NMDA] receptor subunit
  499::546     3e-04  35%  982 aa  NMDA1_DROWI RecName: Full=Glutamate [NMDA] receptor subunit
  508::555     3e-04  35%  984 aa  NMDA1_DROVI RecName: Full=Glutamate [NMDA] receptor subunit
  511::558     3e-04  35%  997 aa  NMDA1_DROSI RecName: Full=Glutamate [NMDA] receptor subunit
  511::558     3e-04  35%  997 aa  NMDA1_DROSE RecName: Full=Glutamate [NMDA] receptor subunit
  508::555     3e-04  35%  980 aa  NMDA1_DROMO RecName: Full=Glutamate [NMDA] receptor subunit
  511::558     3e-04  35%  997 aa  NMDA1_DROME RecName: Full=Glutamate [NMDA] receptor subunit 1;     
  506::553     3e-04  35%  982 aa  NMDA1_DROGR RecName: Full=Glutamate [NMDA] receptor subunit
  511::558     3e-04  35%  997 aa  NMDA1_DROER RecName: Full=Glutamate [NMDA] receptor subunit
  508::555     3e-04  35%  994 aa  NMDA1_DROAN RecName: Full=Glutamate [NMDA] receptor subunit
   30::258     3e-04  20%  507 aa  MLTF_MAGSM RecName: Full=Membrane-bound lytic murein
  365::518     3e-04  24% 1197 aa  EVGS_ECO57 RecName: Full=Sensor protein evgS;       
  376::529     3e-04  21% 1238 aa  BVGS_BORPA RecName: Full=Virulence sensor protein bvgS;       
  376::529     3e-04  21% 1238 aa  BVGS_BORBR RecName: Full=Virulence sensor protein bvgS;       
   32::280     4e-04  24%  525 aa  MLTF_VIBPA RecName: Full=Membrane-bound lytic murein
  493::551     5e-04  29% 1464 aa  NMDE1_RAT RecName: Full=Glutamate [NMDA] receptor subunit
  493::551     5e-04  29% 1464 aa  NMDE1_PANTR RecName: Full=Glutamate [NMDA] receptor subunit
  493::551     5e-04  29% 1464 aa  NMDE1_MOUSE RecName: Full=Glutamate [NMDA] receptor subunit
  493::551     5e-04  29% 1464 aa  NMDE1_HUMAN RecName: Full=Glutamate [NMDA] receptor subunit
  466::541     5e-04  31% 1007 aa  GRID2_RAT RecName: Full=Glutamate receptor delta-2 subunit;        
  466::541     5e-04  31% 1007 aa  GRID2_MOUSE RecName: Full=Glutamate receptor delta-2 subunit;      
  466::541     5e-04  31% 1007 aa  GRID2_HUMAN RecName: Full=Glutamate receptor delta-2 subunit;      
  523::570     6e-04  33% 1004 aa  NMDA1_DROPS RecName: Full=Glutamate [NMDA] receptor subunit
  523::570     6e-04  33% 1004 aa  NMDA1_DROPE RecName: Full=Glutamate [NMDA] receptor subunit
  415::544     6e-04  25%  908 aa  GRIK2_RAT RecName: Full=Glutamate receptor, ionotropic kainate
  415::544     6e-04  25%  908 aa  GRIK2_MOUSE RecName: Full=Glutamate receptor, ionotropic kainate
  415::544     6e-04  25%  908 aa  GRIK2_MACFA RecName: Full=Glutamate receptor, ionotropic kainate
  415::544     6e-04  25%  908 aa  GRIK2_HUMAN RecName: Full=Glutamate receptor, ionotropic kainate
    1::277

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxCGGGEKEKQAANQEPAKQTEKNTLDQIKEKGVIVAGLDDTFAPMGYRDE
FLIY_ECOLI      ----------------------------------------DEGLLNKVKERGTLLVGLEGTYPPFSFQGD
FLIY_ECOL6      ----------------------------------------DEGLLNKVKERGTLLVGLEGTYPPFSFQGD
TCYA_BACSU      ---------------------CGAGND-----NQSKDNAKDGDLWASIKKKGVLTVGTEGTYEPFTYHDD
YXEM_BACSU      ------------------------------------------------EDDNVLHVGATGQSYPFAYK-E
ARGT_SALTY      --------------------------------------------------------GTDTTYAPFSSKDA
ARGT_ECOLI      --------------------------------------------------------GTDTTYAPFSSKDA
Y1080_HAEIN     ---------------------------------------------DRVEKTKTLLVGTEGTYAPFTFHDK
HISJ_SALTY      --------------------------------------------------------GTDPTYAPFESKNA
GLNH_ECOLI      -----------------------------------------------------LVVATDTAFVPFEFK-Q
GLNH_ECOL6      -----------------------------------------------------LVVATDTAFVPFEFK-Q
GLNH_ECO57      -----------------------------------------------------LVVATDTAFVPFEFK-Q
HISJ_ECOLI      --------------------------------------------------------GTDPTYAPFESKNS
HISJ_ECOL6      --------------------------------------------------------GTDPTYAPFESKNS
HISJ_ECO57      --------------------------------------------------------GTDPTYAPFESKNS
ARTP_BACSU      -----------------------------------------------------LIMGTSADYKPFEYKEG
ARTI_ECOLI      ------------------------------------------------------------SYPPFESIDA
PATH_VIBHA      -----------------------------------------------------VKVGMSGRYFPFTFVKQ
ARTJ_ECOLI      --------------------------------------------------------GVSATYPPFESIGA
HISJ_CAMJE      --------------------------------------------------------GTAPNYKPFNFKQD
NOCT_AGRT5      ----------------------------------------------QAKDYKSITIATEGSYAPYNFKDA
HISJ_NEIGO      -------------------------------------------------------------FAPFESLDS
GLNH_BACST      -----------------------GCSSESSTTNKEDAKSTETNTLEKIKKRGKLIVGVKYDLNLFGLKNE
LAPT_PASHA      ---------------------------------------------------------MEPSYPPFEMTEE
OCCT_RHIRD      ------------------------------------------------QEKSITIA-TEGGYAPWNFSGP
OCCT_AGRT4      ------------------------------------------------QEKSITIA-TEGGYAPWNFSGP
GLNH_BACSU      -----------------------------KGSNGEASKESKKDTLAAIKDNDKIVFGVKTDTRLFGLKNP
OCCT_RHIME      -------------------------------------------------EKSITIA-TEGAYAPWNFSGP
YCKB_BACSU      ---------------------------------------------EQIKDKGKIVVATSGTLYPTSYHDT
GLTI_SALTY      -------------------------------AHAEDGAPAAGSTLDKIAKNGVIVVGHRESSVPFSYYDN
GLTI_ECOLI      ---------------------------------------------DKIAKNGVIVVGHRESSVPFSYYDN
PHEC_PSEAE      ---------------------------------------------DRILESGVLRVATTGDYKPFSYRTE
GLUB_CORGL      -------------------------------------------------ENGSVNVGTKYDQPGLGLRNP
AABA_DICNO      ---------------------------------------------------------------PVSYMDE
ARTJ_CHLTR      ------------------------------------------------------IVGTNATYPPFEFVDK
TCYJ_BACSU      ------------------------------------------------RQAQTVIVGTGTDFPNIAFLNE
GLUB_COREF      -------------------------------------------------ENGNVTIGTKYDQPGLGLRNP
TCYK_BACSU      ------------------------------------------------KKVQTITVGTGTQFPNICFIDE
MLTF_DESOH      ----------------------------------------------------------------------
MLTF_PHOPR      --------------------------------------------LEKIRESGVIRVGTLNN--QLSYYIG
ARTI_HAEIN      ---------------------------------------------------------MQPSYPPFETTNA
MLTF_COLP3      -------------------------------------KENDSSSLSRILARGYINVGT--IFGPTNYYTT
PEB1A_CAMJJ     --------------------------------------------LESIKSKGQLIVGVKNDVPHYALLDQ
PEB1A_CAMJE     --------------------------------------------LESIKSKGQLIVGVKNDVPHYALLDQ
Y4TE_RHISN      -------------------------------------------TLEEVKARGYITIAIANEM-PGSYTDP
MLTF_AERHH      ---------------------------------------TPSSQLEQIRQRGEIRVGT--IYGPTSYYQR
AAPJ_RHIL3      -----------------------------------------------VKAKGFVQCGVNTGLTGFAAPDA
MLTF_PSEF5      ------------------------------------------STLERVKEDGVLRVVTRNS--PATYFQD
MLTF_SODGM      -----------------------------------PWRNAHQDNLAAIKARGELISTLD---APLSYYSV
MLTF_SACD2      -------------------------------------------TLEEVKSSGKLI--VISRNGPTTYYEG
MLTF_AERS4      ---------------------------------------TPSSQLEQIRQRGEIRVGT--IYGSTSYYQR
YHDW_ECO57      -------------------------------------------TLDAVQKKGFVQCGISDGLPGFSYADA
MLTF_VIBF1      -----------------------------------------KTKLEQIRERGILVSTLNNQ---LSYYIG
MLTF_PSEPF      ------------------------------------------NTLERVKEDGVLRVVTRN--SPATYFQD
MLTF_KLEP7      ---------------------------------------------------GIIARGISTINSPMTFATM
MLTF_YERE8      -----------------------------------PWRNGQEGQLDRIKARGEL--RVSTISSPLIYSTG
GLK1_DROME      ----------------------------------------------------------------------
MLTF_ACTP2      --------------------------------------QAEENRYNQIQQRKILRVGMVNH--PLSYFIG
MLTF_ACTPJ      --------------------------------------QAEENRYNQIQQRKILRVGMVNH--PLSYFIG
MLTF_ACTP7      --------------------------------------QAEENRYNQIQQRKILRVGMVNH--PLSYFIG
MLTF_PSEPG      ------------------------------------------STLERVKEDGVLRVITRNS--PATYFQD
YHDW_ECOLI      ---------------------------------------------DAVQKKGFVQCGISDGLPGFSYADA
MLTF_VIBCH      -----------------------------------------KSELEKIRERGVLRVGTLNN--PLSYYIG
MLTF_VIBC3      -----------------------------------------KSELEKIRERGVLRVGTLNN--PLSYYIG
MLTF_ALCBS      ------------------------------------------------------------------YYED
MLTF_PSEMY      -------------------------------------EEPKPSVLEQVKAEGELRVVTRNS--PATYFQD
MLTF_PSEP1      ------------------------------------------STLERVKEDGVLRVITRNS--PATYFQD
GRID1_RAT       ----------------------------------------------------------------------
GRID1_MOUSE     ----------------------------------------------------------------------
GRID1_HUMAN     ----------------------------------------------------------------------
MLTF_YERPY      -----------------------------------PWRNGQEGQLDQIKARGEL--RVSTISSPLIYSTE
MLTF_YERPS      -----------------------------------PWRNGQEGQLDQIKARGEL--RVSTISSPLIYSTE
MLTF_YERPP      -----------------------------------PWRNGQEGQLDQIKARGEL--RVSTISSPLIYSTE
MLTF_YERPN      -----------------------------------PWRNGQEGQLDQIKARGEL--RVSTISSPLIYSTE
MLTF_YERPG      -----------------------------------PWRNGQEGQLDQIKARGEL--RVSTISSPLIYSTE
MLTF_YERPE      -----------------------------------PWRNGQEGQLDQIKARGEL--RVSTISSPLIYSTE
MLTF_YERPB      -----------------------------------PWRNGQEGQLDQIKARGEL--RVSTISSPLIYSTE
MLTF_YERPA      -----------------------------------PWRNGQEGQLDQIKARGEL--RVSTISSPLIYSTE
MLTF_YERP3      -----------------------------------PWRNGQEGQLDQIKARGEL--RVSTISSPLIYSTE
MLTF_SHEON      -------------------------------------------------------------YGPQIYMTS
MLTF_PSEPK      ------------------------------------------STLERVKEDGVLRVITRNS--PATYFQD
MLTF_SHEB9      -------------------------------------------------------------YGPQIYMTS
MLTF_SHEB8      -------------------------------------------------------------YGPQIYMTS
MLTF_SHEB5      -------------------------------------------------------------YGPQIYMTS
MLTF_SERP5      --------------------------------------------LEEIKSRGEL--RISTLNSPLTYFTT
MLTF_SHESM      -------------------------------------------------------------YGPQIYMTS
MLTF_SHESR      -------------------------------------------------------------YGPQIYMTS
MLTF_SHESA      -------------------------------------------------------------YGPQIYMTS
MLTF_IDILO      --------------------------------------QTRPDAMSVVQERQVLRVGT--LINPTSYYFD
MLTF_SHESW      -------------------------------------------------------------YGPQIYMTS
MLTF_SHEPC      -------------------------------------------------------------YGPQIYMTS
MLTF_SHEPA      ----------------------------------------QEKTTPPLKPTQLIVGTL---YGPQIYFTS
MLTF_SHEFN      -------------------------------------------------------------YGPQIYLNS
MLTF_SHIDS      ---------------------------------------------------------------PLTYNEI
MLTF_SALPB      -----------------------------------------ENHIAAIQARGVLRVSTIDS--PLTYSVI
MLTF_SHELP      ----------------------------------------------------------------------
MLTF_PSEE4      ------------------------------------------STLERVKEDGVLRVITRNS--PATYFQD
MLTF_SHEWM      ----------------------------------------------------------------------
GRIK3_RAT       ----------------------------------EVAKGRGPNVTDSLTNRSLIVTTLEEPFVMFRKSDR
GRIK3_MACFA     ----------------------------------EVAKGRGPNVTDSLTNRSLIVTTLEEPFVMFRKSDR
GRIK3_HUMAN     ----------------------------------EVAKGRGPNVTDSLTNRSLIVTTLEEPFVMFRKSDR
GLRK_RANBE      ---------------------------------------------------------------PFAMKTE
MLTF_NITMU      ---------------------------------------------DKTDELVVITVNSPDTY----YENA
MLTF_ECOSM      ------------------------------------------NRIAAIQARGELRVSTINT--PLTYNEI
MLTF_SHIF8      ---------------------------------------------------------------PLTYNKI
MLTF_CELJU      -------------------------------------RSTPPNVLEQVLASGEL--RVISTNGATTFYEG
MLTF_SHIFL      ---------------------------------------------------------------PLTYNEI
MLTF_SHIBS      ---------------------------------------------------------------PLTYNEI
MLTF_SHIB3      ---------------------------------------------------------------PLTYNEI
MLTF_ECOLI      ---------------------------------------------------------------PLTYNEI
MLTF_ECOLC      ---------------------------------------------------------------PLTYNEI
MLTF_ECOHS      ---------------------------------------------------------------PLTYNEI
MLTF_ECODH      ---------------------------------------------------------------PLTYNEI
MLTF_ECO57      ---------------------------------------------------------------PLTYNEI
MLTF_ECO11      ---------------------------------------------------------------PLTYNEI
GLR2_CAEEL      ----------------------------------------------------------------------
GLR1_CAEEL      ----------------------------------------------------------------------
MLTF_PSEPW      ------------------------------------------STLERVKEDGVLRVITRNS--PATYFQD
MLTF_PSEHT      --------------------------------------QEQSTQLAQIKAQNKIRVGT--LASASNYYQA
MLTF_ECOUT      ---------------------------------------------------------------PLTYNEI
MLTF_ECOL5      ---------------------------------------------------------------PLTYNEI
MLTF_ECOK1      ---------------------------------------------------------------PLTYNEI
MLTF_ECO24      ---------------------------------------------------------------PLTYNEI
MLTF_ECOL6      ---------------------------------------------------------------PLTYNEI
NMDE3_RAT       ----------------------------------------------------------------------
NMDE3_MOUSE     ----------------------------------------------------------------------
NMDE3_HUMAN     ----------------------------------------------------------------------
MLTF_PSESM      -------------------------------------------TLERVKEDGVLRVITRNS--PATYFQD
NMDE4_RAT       ----------------------------------------------------------------------
NMDE4_MOUSE     ----------------------------------------------------------------------
NMDE4_HUMAN     ----------------------------------------------------------------------
MLTF_PSE14      -------------------------------------------TLERVKEDGVL--RMITRNSPATYFQD
GRID2_DANRE     ----------------------------------------------------------------------
BZTA_RHOCA      -------------------------------------------TLDDVKARGQLICGSNPGLTGFAAPDA
MLTF_SULDN      -------------------------------------KMIKESTLKKIKKSGALNVVLLN--APSTYYIG
MLTF_SHISS      ---------------------------------------------------------------PLTYNEI
MLTF_PSEU2      -------------------------------------------TLERVKEDGVLRVITRNS--PATYFQD
GRIK4_RAT       ----------------------------------------------------------------------
GRIK4_PANTR     ----------------------------------------------------------------------
GRIK4_MOUSE     ----------------------------------------------------------------------
GRIK4_HUMAN     ----------------------------------------------------------------------
GRIA4_RAT       ----------------------------------------------------------------------
GRIA4_MOUSE     ----------------------------------------------------------------------
GRIA4_MACFA     ----------------------------------------------------------------------
GRIA4_HUMAN     ----------------------------------------------------------------------
MLTF_VIBHB      -----------------------------------------KSEFEQIQERGVLRVGTLNN--QLSYYIG
MLTF_HAES2      --------------------------------------RSKQNYHTTIQERQKLIVGTINN--PVSYFIG
MLTF_HAES1      --------------------------------------RSKQNYHTTIQERQKLIVGTINN--PVSYFIG
MLTF_SHEHH      -------------------------------------------------------------YGPQIYFTS
MLTF_SHEAM      ------------------------------------------------------------------YMSS
MLTF_PASMU      --------------------------------------RSEENRYTAIQSRGKLVVGTINN--PISYFDH
BVGS_BORPE      ----------------------------------------------------------------------
MLTF_PSEU5      --------------------------------------------LERIKEEGVLRVITRNS--PSTYFQD
GRIK1_MACFA     -------------------------------------KDKSSNITDSLANRTLIVTTLEEPYVMYRKSDK
GRIK1_HUMAN     -------------------------------------KDKSSNITDSLANRTLIVTTLEEPYVMYRKSDK
GRIK5_RAT       ----------------------------------------------------------------------
GRIK5_MOUSE     ----------------------------------------------------------------------
GRIK5_HUMAN     ----------------------------------------------------------------------
GLRK_XENLA      ----------------------GSIHKEKERSKRQALKHLTVTTIMEQPFSMKSESGMEGFCIDL--LSE
MLTF_ENT38      -----------------------------------------ENRIAAIQSRGELVSTLD---SPLTYNNV
GRIA3_RAT       ----------------------------------------------------------------------
GRIA3_MOUSE     ----------------------------------------------------------------------
GRIA3_MACFA     ----------------------------------------------------------------------
GRIA3_HUMAN     ----------------------------------------------------------------------
GRIA2_RAT       ------------------------------------------NDTSGLENKTVVVTTLESPYVMMKKNHE
GRIA2_PONAB     ------------------------------------------NDTSGLENKTVVVTTLESPYVMMKKNHE
GRIA2_MOUSE     ------------------------------------------NDTSGLENKTVVVTTLESPYVMMKKNHE
GRIA2_MACFA     ------------------------------------------NDTSGLENKTVVVTTLESPYVMMKKNHE
GRIA2_HUMAN     ------------------------------------------NDTSGLENKTVVVTTLESPYVMMKKNHE
NMDE2_RAT       ----------------------------------------------------------------------
NMDE2_MOUSE     ----------------------------------------------------------------------
NMDE2_HUMAN     ----------------------------------------------------------------------
NMDE2_CANFA     ----------------------------------------------------------------------
GRIK1_MOUSE     -------------------------------------RDRSNNITDSLANRTLIVTTLEEPYVMYRKSDK
GLRK_LYMST      ----------------------------------------------------------------------
NMDZ1_RAT       ----------------------------------------------------------------------
NMDZ1_MOUSE     ----------------------------------------------------------------------
NMDZ1_HUMAN     ----------------------------------------------------------------------
NMDZ1_CANFA     ----------------------------------------------------------------------
GRIK1_RAT       -------------------------------------RDRSNNITDSLANRTLIVTTILEEPYVM-YRKS
GRIA1_RAT       ----------------------------------------------------------------------
GRIA1_MOUSE     ----------------------------------------------------------------------
GRIA1_MACFA     ----------------------------------------------------------------------
GRIA1_HUMAN     ----------------------------------------------------------------------
NMDA1_DROYA     ----------------------------------------------------------------------
NMDA1_DROWI     ----------------------------------------------------------------------
NMDA1_DROVI     ----------------------------------------------------------------------
NMDA1_DROSI     ----------------------------------------------------------------------
NMDA1_DROSE     ----------------------------------------------------------------------
NMDA1_DROMO     ----------------------------------------------------------------------
NMDA1_DROME     ----------------------------------------------------------------------
NMDA1_DROGR     ----------------------------------------------------------------------
NMDA1_DROER     ----------------------------------------------------------------------
NMDA1_DROAN     ----------------------------------------------------------------------
MLTF_MAGSM      --------------------------------------------MDEIRKTGVLVVVTRN--APTTYYQG
EVGS_ECO57      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
MLTF_VIBPA      -----------------------------------------KSEFEKIQERGVLRVGTLNN--QLSYYIG
NMDE1_RAT       ----------------------------------------------------------------------
NMDE1_PANTR     ----------------------------------------------------------------------
NMDE1_MOUSE     ----------------------------------------------------------------------
NMDE1_HUMAN     ----------------------------------------------------------------------
GRID2_RAT       ----------------------------------------------------------------------
GRID2_MOUSE     ----------------------------------------------------------------------
GRID2_HUMAN     ----------------------------------------------------------------------
NMDA1_DROPS     ----------------------------------------------------------------------
NMDA1_DROPE     ----------------------------------------------------------------------
GRIK2_RAT       ----------------------------------ESQKGKPANITDSLSNRSLIVTTLEEPYVLFKKSDK
GRIK2_MOUSE     ----------------------------------ESQKGKPANITDSLSNRSLIVTTLEEPYVLFKKSDK
GRIK2_MACFA     ----------------------------------ESQKGKPANITDSLSNRSLIVTTLEEPYVLFKKSDK
GRIK2_HUMAN     ----------------------------------ESQKGKPANITDSLSNRSLIVTTLEEPYVLFKKSDK


                         .         .         *         .         .         .         .:140
query           SNKLVGFDIDMGEEMAKRLGVKIQWQPTQWDGIIMALDSKRFDIILSGMTVTEERKKSINFSVPYVGDGQ
FLIY_ECOLI      DGKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDFSTPYTISGI
FLIY_ECOL6      DGKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDFSTPYTISGI
TCYA_BACSU      TDKLTGYDVEVITEVAKRLGLKVDFKETQWDSMFAGLNSKRFDVVANQVGKT-DREDKYDFSDKYTTSRA
YXEM_BACSU      NGKLTGFDVEVMEAVAKKIDMKLDWKLLEFSGLMGELQTGKLDTISNQVAVTDERKETYNFTKPYAYAGT
ARGT_SALTY      KGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADS
ARGT_ECOLI      KGDFVGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADS
Y1080_HAEIN     SGKLTGFDVEVIRKVAEKLGLKVEFKETQWDAMYAGLNAKRFDVIANQTNPSPERLKKYSFTTPYNYSGG
HISJ_SALTY      QGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADS
GLNH_ECOLI      GDKYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGL
GLNH_ECOL6      GDKYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGL
GLNH_ECO57      GDKYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGL
HISJ_ECOLI      QGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADS
HISJ_ECOL6      QGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADS
HISJ_ECO57      QGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADS
ARTP_BACSU      DN-IVGFDVELAKALAKKAGYEIEVQDMDFNSLITALKSKQVDLVLSGMTPTPERKKQVDFSDVYY-TAN
ARTI_ECOLI      NNQIVGFDVDLAQALCKEIDATCTFSNQAFDSLIPSLKFRRVEAVMAGMDITPEREKQVLFTTPYYDNSA
PATH_VIBHA      -DKLQGFEVDMWDEIGKRNDYKIEYVTANFSGLFGLLETGRIDTISNQITMTDARKAKYLFADPYVVDGA
ARTJ_ECOLI      NNEIVGFDIDLAKALCKQMQAECTFTNHAFDSLIPSLKFRKYDAVISGMDITPERSKQVSFTTPYYENSA
HISJ_CAMJE      S-KLTGFDTDLIEEIAKKNGIEIVWVETNFDGLIPALKSGKIDMIASAMSATDERRQSVDFTKPYYMSKN
NOCT_AGRT5      GGKLIGFDIDLGNDLCKRMNIECKFVEQAWDGIIPSLTAGRYDAIMAAMGIQPAREKVIAFSRPYLLTPM
HISJ_NEIGO      KGNVEGFDVDLMNAMAKAGNFKIEFKHQPWDSLFPALNNGDADIVMSGVTITDDRKQSMDFSDPYFEITQ
GLNH_BACST      TGKVEGFDIDIAKGLAKKIENKIELKEVTSKTRIPMLNNGEIDAIIGTMTITEERKKEVDFSDVYFMAGQ
LAPT_PASHA      KGEIIGFDVDIANAICKEMNANCTFHSQPFDSLIQSLKQKQFDAAISGMGITEPRKKQVLFSEPYFPSSA
OCCT_RHIRD      GGKLDGFEIDLANALCEKMKAKCQIVAQNWDGIMPSLTGKKYDAIMAAMSVTPKRQEVIGFSIPYAAGGD
OCCT_AGRT4      GGKLDGFEIDLANALCEKMKAKCQIVAQNWDGIMPSLTGKKYDAIMAAMSVTPKRQEVIGFSIPYAAGGD
GLNH_BACSU      SSEIEGFXXXLGDEK------KAQFKEVTSKTRIPMLQNGDIDAIVATMTITEERKKEVDFSDVYFEAGQ
OCCT_RHIME      NGKLDGFEIDLAKVLCERMKVKCQIVAQNWDGIIPSLVAKKYDVIMAAMSVTPKRQEVISFSTPYGAHMN
YCKB_BACSU      SDKLTGYEVEVVREAAKRLGLKVEFKEMGIDGMLTAVNSGQVDAAANDIDVTKDREEKFAFSTPYYSYGT
GLTI_SALTY      QQKVVGYSQDYSEAVKKKLNLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNLERQKQAAFSDTIFVVGT
GLTI_ECOLI      QQKVVGYSQDYSEAVKKKLNLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAAFSDTIFVVGT
PHEC_PSEAE      EGGYAGFDVDMAQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGK
GLUB_CORGL      DNSMSGLDVDVAEYVVNSIADDKGWDPTEWRESPSAIQNGEVDMIAATYSINAGRSESVNFGGPYLLTHQ
AABA_DICNO      KGSPTGFETELIRKIAEQAQLDLKEEVANFGDTLTALENGKADLAMATISVTPARQQIFDFTTPYFRVNP
ARTJ_CHLTR      RGEVVGFDIDLAREISNKLGKTLDVREFSFDALILNLKQHRIDAVITGMSITPSRLKEI-LMIPYYGEKH
TCYJ_BACSU      KGELTGYDIEVMKAIDKELPYTFEFKTMDFSNLLTSLGNKKIDVIAHNMAKNKEREKRFLYKVPYNYSPM
GLUB_COREF      DNSMSGLDVDVAQYVVNSIAPTVEWRETPSAQRETLIQNGEVDMIAATYSINPGRSESVNFGGPYLLTHQ
TCYK_BACSU      KGDLTGYDVELIKELDKRLPYKFTFKTMEFSNLLVSLGQHKVDIVAHQMEKSKEREKKFLFNVAYNHFPL
MLTF_DESOH      ----MGFEYDLAKAFAGHLGVDLEVKTPGWDALFASLQRGDGDFIAASMTHTRKREQYADFSEPYLSVRQ
MLTF_PHOPR      NDGPTGLDYELAQRFAQKLGVKLEMQPMTLSGLFPTLERGGIDVVAAGLTISKDRIENYHAAPAYYYASQ
ARTI_HAEIN      KGEIIGFDVDVTNAICQEIQATCKFKSETFDALIPNLKAKRFXXXXXXXXXXXXXXKQVLFXXXXXXXXX
MLTF_COLP3      ANGFAGFEYELAKQYADSLNVELRIVPTSLDELFIKLNTGEVDLLASGLSITDKRLQRFRFAPSYETISQ
PEB1A_CAMJJ     ATEIKGFEVDVAKLLAKSIKIKLVAVNAKTRGPL--LDNGSVDAVIATFTITPERKRIYNFSEPYYQDAI
PEB1A_CAMJE     ATEIKGFEVDVAKLLAKSIKIKLVAVNAKTRGPL--LDNGSVDAVIATFTITPERKRIYNFSEPYYQDAI
Y4TE_RHISN      NGEVKGSEADVARRVLEKLGIKIQWVVTTFGSLIPGLQANRFDMTAAGMAIRPERCEKVIYSEPNSSYGE
MLTF_AERHH      DDTAQGFDYELAQSYADWLGVKLTIVPVYSTAELVELLRKKLDLAAAAIVVTPERRQLFRFGPGFYQVSP
AAPJ_RHIL3      SGNWAGFDVDFCKAVASAVPTKVKYTPTNAKERFTALQSGEIDVLSRNTTWTINRDTALGFNVTYY-DGQ
MLTF_PSEF5      RNGETGFEYELVKRFADDLGVELKIETADLDDLFDQLGQPKGPVLAAGLVSSEQRKQQVRFSHPYLEVTP
MLTF_SODGM      NNQPSGFDYDLAQRFADYLGVTLKVRRSNLNQLFDDLENDNADILAASLIYNAERLNRFTVGPSYYSVSQ
MLTF_SACD2      PAGHTGFEYVMAKAFAKHLGVDLEVREIEDLGEMLKVGTKAGHLAASGLTVTEKRARKVLFAEPYLQVTQ
MLTF_AERS4      DDLAQGFDYELAKSYADWLGVKLTIVPVYSIALVELLEKGKLDLAAAAIVVTPERRALFRFGPGFYQVSP
YHDW_ECO57      DGKFSGIDVDVCRGVAAAVDTKVKYTPLTAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTDG-
MLTF_VIBF1      SNGPTGLDYDLAKAFAEKLEVKLEITPAYYSGLFPALERNEVDIIAANMTITPERLQKFRPGPXXXXXXX
MLTF_PSEPF      RSGETGFEYELVKRFADDLGVELKIETANLDDLFNQVGKPNGPVLAAGLVSSEQRKKQVRFSRSYLEVTP
MLTF_KLEP7      NNKAFGLDYELAKQFADYLGVTLKITVRQISQLFDDLDDGQADMLAAGLVYNQERVKNYQAGPTYYSVSQ
MLTF_YERE8      KDGPSGFDYELAKRFADYLGVKLVMTPHHINXXXXXXXXXXXXMIAAGLIYNSERLKRARTGPAYYSVSQ
GLK1_DROME      NDRFEGYCKDLADMLAAQLGIKYQYAPGGWDGMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGI
MLTF_ACTP2      AEGTAGIEYELAKSFANYLDVRLDIKTDNSEQLFSALKDNKVDIAAAGLLYQPELSKQFQIGSAYYSASW
MLTF_ACTPJ      AEGTAGIEYELAKSFANYLDVRLDIKTDNSEQLFSALKDNKVDIAAAGLLYQPELSKQFQIGSAYYSASW
MLTF_ACTP7      AEGTAGIEYELAKSFANYLDVRLDIKTDNSEQLFSALKDNKVDIAAAGLLYQPELSKQFQIGSAYYSASW
MLTF_PSEPG      RNGETGFEYELVQHFAEDLGVKLQIETADLDELYDALGKPSGPVLAAGLVSSERRKAQVKYSHPYLEVTP
YHDW_ECOLI      DGKFSGIDVDICRGVAAAVDTKVKYTPLTAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTDG-
MLTF_VIBCH      PDGPTGLDYELAREFAKELGVKLEMKPARLSSLFPALKNGEVDIIAAGLSQSEERLKDFRAGPAXXXXXX
MLTF_VIBC3      PDGPTGLDYELAREFAKELGVKLEMKPARLSSLFPALKNGEVDIIAAGLSQSEERLKDFRAGPAXXXXXX
MLTF_ALCBS      QHGFTGMEYELAKGFADSQGVELRLESDDLSYIRYAIRKGTADIVAAGLIATPERSKSLRFSTAYQNVDV
MLTF_PSEMY      RNGATGFEYELAKRFATDLGLELKIETADLDSLFASLGHVDGPVLAAGLVETPQRQRQARFSVPYLEVTP
MLTF_PSEP1      RNGETGFEYELVQHFADDLGVKLQIETADLDELYDALGKPSGPVLAAGLVSSERRKTQVKYSHPYLEVTP
GRID1_RAT       -----GFSIDVLDALAKALGFKYQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSV
GRID1_MOUSE     -----GFSIDVLDALAKALGFKYQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSV
GRID1_HUMAN     -----GFSIDVLDALAKALGFKYQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSV
MLTF_YERPY      KDTPSGFDYELAKRFADYLGVKLVIIPHHNIXXXXXXXXXXXXXXXXXXXINRERLNRARTGPAYYSVSQ
MLTF_YERPS      KDTPSGFDYELAKRFADYLGVKLVIIPHHNIXXXXXXXXXXXXXXXXXXXINRERLNRARTGPAYYSVSQ
MLTF_YERPP      KDTPSGFDYELAKRFADYLGVKLVIIPHHNIXXXXXXXXXXXXXXXXXXXINRERLNRARTGPAYYSVSQ
MLTF_YERPN      KDTPSGFDYELAKRFADYLGVKLVIIPHHNIXXXXXXXXXXXXXXXXXXXINRERLNRARTGPAYYSVSQ
MLTF_YERPG      KDTPSGFDYELAKRFADYLGVKLVIIPHHNIXXXXXXXXXXXXXXXXXXXINRERLNRARTGPAYYSVSQ
MLTF_YERPE      KDTPSGFDYELAKRFADYLGVKLVIIPHHNIXXXXXXXXXXXXXXXXXXXINRERLNRARTGPAYYSVSQ
MLTF_YERPB      KDTPSGFDYELAKRFADYLGVKLVIIPHHNIXXXXXXXXXXXXXXXXXXXINRERLNRARTGPAYYSVSQ
MLTF_YERPA      KDTPSGFDYELAKRFADYLGVKLVIIPHHNIXXXXXXXXXXXXXXXXXXXINRERLNRARTGPAYYSVSQ
MLTF_YERP3      KDTPSGFDYELAKRFADYLGVKLVIIPHHNIXXXXXXXXXXXXXXXXXXXINRERLNRARTGPAYYSVSQ
MLTF_SHEON      GQGNSGFDYDMAVLFAEYLDVPLKMVPTNLAELYDALKKNEIDIIAAGMTETPARREHFRLGPPLYRVNQ
MLTF_PSEPK      RNGETGFEYELVQHFADDLGVKLQIETADLDELYDALGKPSGPVLAAGLVSSERRKTQVRYSHPYLEVTP
MLTF_SHEB9      GQGDSGFDYDMAVLFAEYLDVPLKMVPTNRTELYEALKKNEIDLIAAGMTETPARREQFRLGPPLYRVNQ
MLTF_SHEB8      GQGDSGFDYDMAVLFAEYLDVPLKMVPTNRTELYEALKKNEIDLIAAGMTETPARREQFRLGPPLYRVNQ
MLTF_SHEB5      GQGDSGFDYDMAVLFAEYLDVPLKMVPTNRTELYEALKKNEIDLIAAGMTETPARREQFRLGPPLYRVNQ
MLTF_SERP5      KQGPSGLDYELAKRFANYLGVKLVVIPHKINXXXXXXXXXXXXXXXXGLIYNQDRLSRARTGPAYYSVSQ
MLTF_SHESM      GQGNSGFDYDMAVLFAEYLDVPLKMVPTNRAELYEALKKNEIDIIAAGMTETPARREQFRLGPPLYRVNQ
MLTF_SHESR      GQGNSGFDYDMAVLFAEYLDVPLKMVPTNRAELYDALKKNEIDIIAAGMTETPARREQFRLGPPLYRVNQ
MLTF_SHESA      GQGNSGFDYDMAVLFAEYLDVPLKMVPTNRAELYDALKKNEIDIIAAGMTETPARREQFRLGPPLYRVNQ
MLTF_IDILO      HDREQGFEYDLAKRFADRLGVELEMVPRDVNDLFTMLRRGEVDIVAAGLDRTSTRAQLFRFSPPYDIISQ
MLTF_SHESW      GQGNSGFDYDMALRFAEYLNVPLKMVPTNRSELYDALKKNDIDIIAAGMTETPARREQFRLGPPLYRVNQ
MLTF_SHEPC      GQGNSGFDYDMALRFAEYLNVPLKMVPTNRSELYDALKKNDIDIIAAGMTETPARREQFRLGPPLYRVNQ
MLTF_SHEPA      GQGDSGYDYEMAERFANYLDLELKMKPANISELYSAMHSGEIDIIAAGLADTPARREQFRLGPPLYRVNQ
MLTF_SHEFN      EQGESGFDFEMAQRFADYLAVPLEMIPTNRKQLFAALKENKIDIIAAGIAKTPNRSQQFKLGPTLYKVNQ
MLTF_SHIDS      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_SALPB      NGKKYGLDYELAQQFANYLGVKLKVTVRQISQLFDDLDSGNADLLAAGLVYDSARVKNYQPGPMYYSVSQ
MLTF_SHELP      ---LAGFDYEMAERFAKHQGLTLNMQPPTISDLYQAMRNGEIDLIAAGLADTQSRREQFRLGPPLYYVNQ
MLTF_PSEE4      RNGETGFEYELVKRFADDLGVKLQIETADLDELFDQLGKPSGPVLAAGLVSSERRGAQARFSHPYLEVTP
MLTF_SHEWM      -----GFDYEMASRFADHLELELAMKPSNIKELYQALNSGEVDLIAAGLADTPTRRENFRLGPPLYRVNQ
GRIK3_RAT       TDRFEGYCIDLLKELAHILGFSYQDDKGQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGV
GRIK3_MACFA     TDRFEGYCIDLLKELAHILGFSYQDDKGQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGV
GRIK3_HUMAN     TDRFEGYCIDLLKELAHILGFSYQDDKGQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGV
GLRK_RANBE      SDALEGYAIDLLSELTQSLGFNYTLQEGNWSGMVGEIIRKEADLAIAPLTITSVRENAISFTKPFMQTGI
MLTF_NITMU      EGSYAGLDYDLATEFAKELGMKVRFKTVPRLDKAWSLLEKHKGHFAAGMNISAKHSRHVAF-------GP
MLTF_ECOSM      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_SHIF8      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPSPTYYSVSQ
MLTF_CELJU      SDGLTGFEYSLLKGFADSLGVNLAIE-NQADTLLHAVEQRQYHMGSAELTALESQDYHLSFAKPYMQITQ
MLTF_SHIFL      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_SHIBS      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_SHIB3      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_ECOLI      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_ECOLC      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_ECOHS      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_ECODH      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_ECO57      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_ECO11      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
GLR2_CAEEL      AKNITGFEYDVFISDGNKYGSR--QADGSWDGMIGYLLNETADVAVAPLTITQERERAVDFSKPFMTTGI
GLR1_CAEEL      NNKFEGFCIDLLKLLADKLGTKAGSKQADWDGMIGELLSGRAHAVVASLTINQERERVVDFSKPFMTTGI
MLTF_PSEPW      RNGETGFEYELVKRFADDLGVKLEIETADLDELFDDLGKPSGPVLAAGLVNSERRKTQARFSHPYLEVTP
MLTF_PSEHT      VQGEQGFEYELSQAFADYLGVELEIVPFNLSDMFARLQSGDLDLIASGLTYNKTRAQQYRFGPTYRTISQ
MLTF_ECOUT      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_ECOL5      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_ECOK1      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_ECO24      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_ECOL6      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
NMDE3_RAT       -----------------------------WNGMIGEVYYKRADMAIGSLTINEERSEIIDFSVPFVETGI
NMDE3_MOUSE     -----------------------------WNGMIGEVYYKRADMAIGSLTINEERSEIIDFSVPFVETGS
NMDE3_HUMAN     -----------------------------WNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGS
MLTF_PSESM      RNGETGFEYELVKRFADDLGVELKIETANLDDLFDQMNKPGGPVLAAGLIETSKRKQQARFSHSYLEVTP
NMDE4_RAT       ----IGFSYDLYLVTNGKHGKKIDGV---WNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETGS
NMDE4_MOUSE     ----IGFSYDLYLVTNGKHGKKIDGV---WNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETGS
NMDE4_HUMAN     ----IGFSYDLYLVTNGKHGKKIDGV---WNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETGS
MLTF_PSE14      RNGETGFEYELVKRFADDLGVELKIETANLDDLFDQMNKPGGPVLAAGLIETPKRKQQARFSHSYLEVTP
GRID2_DANRE     --KYQGFSIDVLDALANYLGFKYQQADGTWNGLIGELVFKRADVGLSALTITPERESVVDFTTRYM----
BZTA_RHOCA      NGVYQGFDXXXXXXXXXXLGMKVKYVPLTGETRFTALASGEVDVLVSTWTFSRDTELALDFVAVNYYDGQ
MLTF_SULDN      SDGPKGFEYDLLESYANHLGVKL--NITTANTIKEALESKNPDIHIASLTKTPEREKEFNFGPSYFEAQE
MLTF_SHISS      NGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFXXXXXXXXXXXXXXXVNSERVKNYQPGPTYYSVSQ
MLTF_PSEU2      RNGETGFEYELVKRFADDLGVELKIETANLDDLFDQMNKPGGPVLAAGLIETPLRKQQARFSHSYLEVTP
GRIK4_RAT       NDRYEGFCVDMLKELAERFNYKIRLVGDTWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFM----
GRIK4_PANTR     NDRYEGFCVDMLKELAERFNYKIRLVGDTWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFM----
GRIK4_MOUSE     NDRYEGFCVDMLKELAERFNYKIRLVGDTWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFM----
GRIK4_HUMAN     NDRYEGFCVDMLKELAERFNYKIRLVGDTWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFM----
GRIA4_RAT       NDKYEGYCVDLASEIAKHIGIKYKIAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGI
GRIA4_MOUSE     NDKYEGYCVDLASEIAKHIGIKYKIAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGI
GRIA4_MACFA     NDKYEGYCVDLASEIAKHIGIKYKIAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGI
GRIA4_HUMAN     NDKYEGYCVDLASEIAKHIGIKYKIAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGI
MLTF_VIBHB      PDGPAGLDYELARKFAEQLGVKLEIRPARQAELFPALKKGDIDIIATGLNQTSQAVQRFRPGPAXXXXXX
MLTF_HAES2      TNGETGLEYELSKAFANYLNVDLEMFPNSADALFQALAQGKIDIAAASLFYQQDRSEKFKLGPAYHAASW
MLTF_HAES1      TNGETGLEYELSKAFANYLNVDLEMFPNSADALFQALAQGKIDIAAASLFYQQDRSEKFKLGPAYHAASW
MLTF_SHEHH      GQGDSGYDYEMAERFAKYLNLKLKMRAANISELYAAMRSGEIDIIAAGLGDTPARREQFRVGPPLYRVDQ
MLTF_SHEAM      GQGLSGFDYELAQKFADYLGKPLEMQPSNRSELYDALAKGEIDLIAAGITESPNRRNRFRMGPPLYRVDQ
MLTF_PASMU      AGQAAGLEYELSKAFADYLNVDLELAMSNGDELFSALKNNKIDIAAANLLYQPNKLDMFQVGPTYNSASW
BVGS_BORPE      --------------------------------------------------VNSARESFLSFSRPYVRNGM
MLTF_PSEU5      RNGEAGFEYELVKRFASTLGVELQIETANIDDIFSRLNRXXXXXXXXXXXVASERQELARFTRSYLDVTT
GRIK1_MACFA     NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
GRIK1_HUMAN     NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
GRIK5_RAT       NERFEGFCVDMLRELAELLRFRYRLRLVEWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM----
GRIK5_MOUSE     NERFEGFCVDMLRELAELLRFRYRLRLVEWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM----
GRIK5_HUMAN     NERFEGFCVDMLRELAELLRFRYRLRLVEWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM----
GLRK_XENLA      LSQSLGFNYTIKEVKDGRYGAKDQ--DGNWNGMVGEVLRKEVDLAVAPLTITANRERELAFTKPFMQTGI
MLTF_ENT38      NGKIIGLDYELAQQFADYLGVKLKITVRQISQLFXXXXXXXXXXXXXGLVYNSERSKNYQPGPTYXXXXX
GRIA3_RAT       -----GYCVDLAYEIAKHVRIKYKLETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGI
GRIA3_MOUSE     -----GYCVDLAYEIAKHVRIKYKLETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGI
GRIA3_MACFA     -----GYCVDLAYEIAKHVRIKYKLETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGI
GRIA3_HUMAN     -----GYCVDLAYEIAKHVRIKYKLETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGI
GRIA2_RAT       NERYEGYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
GRIA2_PONAB     NERYEGYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
GRIA2_MOUSE     NERYEGYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
GRIA2_MACFA     NERYEGYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
GRIA2_HUMAN     NERYEGYCVDLAAEIAKHCGFKYKLDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
NMDE2_RAT       -----------------------------WNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGI
NMDE2_MOUSE     -----------------------------WNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGI
NMDE2_HUMAN     -----------------------------WNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGI
NMDE2_CANFA     -----------------------------WNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGI
GRIK1_MOUSE     NDRFEGYCLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
GLRK_LYMST      -----GFCIDLTKAVAEKVGFDFVIQFVKWDGIVGELIRHEADMAIAPFTITADRSRVIDFTKPFMSLGI
NMDZ1_RAT       ----------------------------EWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
NMDZ1_MOUSE     ----------------------------EWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
NMDZ1_HUMAN     ----------------------------EWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
NMDZ1_CANFA     ----------------------------EWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
GRIK1_RAT       DKPLYGNDLDLLKELSNILGVKLQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
GRIA1_RAT       NDRYEGYCVELAAEIAKHVGYSYRLEIVSWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGI
GRIA1_MOUSE     NDRYEGYCVELAAEIAKHVGYSYRLEIVSWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGI
GRIA1_MACFA     NDRYEGYCVELAAEIAKHVGYSYRLEIVSWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGI
GRIA1_HUMAN     NDRYEGYCVELAAEIAKHVGYSYRLEIVSWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGI
NMDA1_DROYA     ----------------------------EWTGLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGI
NMDA1_DROWI     ----------------------------EWTGLIGQLVNERADMIVAPLTINPERAEYIEFSKPFKYQGI
NMDA1_DROVI     ----------------------------EWTGLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGI
NMDA1_DROSI     ----------------------------EWTGLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGI
NMDA1_DROSE     ----------------------------EWTGLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGI
NMDA1_DROMO     ----------------------------EWTGLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGI
NMDA1_DROME     ----------------------------EWTGLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGI
NMDA1_DROGR     ----------------------------EWTGLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGI
NMDA1_DROER     ----------------------------EWTGLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGI
NMDA1_DROAN     ----------------------------EWTGLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGI
MLTF_MAGSM      RDRVEGFEHDLATLFAAHLGVKVAFIKKQSRGVLQTLHEGKAHLAAAGLVRQEEDGDRYLYGPDYQSVFQ
EVGS_ECO57      --------------------------------------------ILPGAIYSEDRENNVLFAEAFITTPY
BVGS_BORPA      --------------------------------------------------VNAARESVLSFSRPYVRNGM
BVGS_BORBR      --------------------------------------------------VNAARESVLSFSRPYVRNGM
MLTF_VIBPA      PDGPAGLDYELARKFAEELGVKLEIKPARQADLFPALKKGDIDIIATGLNQTSQAVKRFRPGPAXXXXXX
NMDE1_RAT       -----------------------------WNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGI
NMDE1_PANTR     -----------------------------WNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGI
NMDE1_MOUSE     -----------------------------WNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGI
NMDE1_HUMAN     -----------------------------WNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGI
GRID2_RAT       --KYQGFSIDVLDALSNYLGFNYEQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYM----
GRID2_MOUSE     --KYQGFSIDVLDALSNYLGFNYEQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYM----
GRID2_HUMAN     --KYQGFSIDVLDALSNYLGFNYEQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYM----
NMDA1_DROPS     ----------------------------EWTGLMGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGI
NMDA1_DROPE     ----------------------------EWTGLMGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGI
GRIK2_RAT       NDRFEGYCIDLLRELSTILGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
GRIK2_MOUSE     NDRFEGYCIDLLRELSTILGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
GRIK2_MACFA     NDRFEGYCIDLLRELSTILGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI
GRIK2_HUMAN     NDRFEGYCIDLLRELSTILGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGI


                         +         .         .         .         .         *         .:210
query           IMVVKKGTTGFNTAADLKGKVVGTQAGSSGEEAVKKVEGIKEVKLYKTYPEAFTDLQIGRIPVVVCDRIT
FLIY_ECOLI      QALVKKGNEGIKTADDXXXXXXXXXXXTNYEEWLRQVQGV-DVRTYDDDPTKYQDLRVGRIDAILVDRLA
FLIY_ECOL6      QALVKKGNEGIKTADDXXXXXXXXXXXTNYEEWLRQVQGV-DVRTYDDDPTKYQDLRVGRIDAILVDRLA
TCYA_BACSU      VVVTKKDNNDIKSEADVKGKTSAQSLTSNATNAGAKVEGVEGM------AQALQMIQQGRVDMTYNDKLA
YXEM_BACSU      QIVVKKDNTDIKSVDDLKGKTVAAVLGSNHAKNLESKDPDKKIKTYETQEGTLKDVAYGRVDAYVNSRTV
ARGT_SALTY      RLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANRTKGV-DVVAYANQDLIYSDLTAGRLDAALQDEVA
ARGT_ECOLI      RLIAAKGSPIQPTLDSLKGKHVGVLQGSTQEAYANETWRSKDVVAYANQDLVYSDLAAGRLDAALQDEVA
Y1080_HAEIN     VIVTKSSDNSIKSFEDLKGRKSAQSATSNGKDA--KAAG-AQILVVDGLAQSLELIKQGRAEATINDKLA
HISJ_SALTY      RLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEPKGI-EIVSYQGQDNIYSDLTAGRIDAAFQDEVA
GLNH_ECOLI      LVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPN
GLNH_ECOL6      LVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPN
GLNH_ECO57      LVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPN
HISJ_ECOLI      RLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEPKGI-EIVSYQGQDNIYSDLTAGRIDAAFQDEVA
HISJ_ECOL6      RLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEPKGI-EIVSYQGQDNIYSDLTAGRIDAAFQDEVA
HISJ_ECO57      RLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEPKGI-EIVSYQGQDNIYSDLTAGRIDAAFQDEVA
ARTP_BACSU      HMIVSKKDSGIQSLKDLKGKTVGVQLGSIQEEKGKELSGFK-TEDRNRISDLVQEIKSDRFDAAIIEDIV
ARTI_ECOLI      LFVGQQGK--YTSVDQLKGKKVGVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDLQNGRIDGVFGDTAV
PATH_VIBHA      QITVRKGNDSIQGVEDLAGKTVAVNLGSNFEQLLRDYDGKINIKTYDTGIE--HDVALGRADAFIMDRLS
ARTJ_ECOLI      VVIAKKDT--YKTFADLKGKRIGMENGTTHQKYIQDQHPEVKTVSYDSYQNAFIDLKNGRIDGVFGDTAV
HISJ_CAMJE      LYLKLKNNDSLQTKNDLEGKKIGVQLGTLQENTAKAIKN-AQVQSNKDLNIAVLALKNNKIDAIVADQDT
NOCT_AGRT5      TFLTTADSPLLKTQVAIEGVKFGVQAGTSHEAFMKQMMPSVQISTYDTIDNVVMDLKAGRIDASLAS-VS
HISJ_NEIGO      VVLVPKGKKVSSSDDLKKMNKVGVVTGHTGDFSVSKLLGNDNPKIFENVPLIIKELENGGLDSVVSDSAV
GLNH_BACST      SLLVKKDSK-INSVKDLKGMTVLTAKGSTSAQNIRKVAPEVNVLEFENYAEAFTALKAGQGDALTTDN-A
LAPT_PASHA      AFIAKKDTD------FAKVKTIGVQNGTTYQHYLAKEKKEYNVKSYASYQNAILDVQNGRIDAIFGD-VP
OCCT_RHIRD      SKLAEMPGLGETYSLDLNGTTVGVQGSTTASTFLDKFKGSVDIKEYKSVEEHNLDLTSGRLDXXXXXXXX
OCCT_AGRT4      SKLAEMPGLGETYSLDLNGTTVGVQGSTTASTFLDKFKGSVDIKEYKSVEEHNLDLTSGRLDXXXXXXXX
GLNH_BACSU      SLLVKKGSKIKSVENLGKGSKVLAVKGSTSSQNIREKAPEASVLEFENYAEAFTALKSGQGDALTTDNAI
OCCT_RHIME      GFAVMKD----SKLADMPGSGEVYSLNTQADAAKKRIDDVNDIKEYKTVEEFNIDLMSGRVDAVFASALT
YCKB_BACSU      AIVRKDDLSGIXXXXXXXXXXXXXXXXXVYMEVARKY-GAKEV-IYATNEQYLKDVANGRTDVILNDYYL
GLTI_SALTY      RLLTKKGGD-IKDFPDLKGKAVVVTSGTTSEILLHKLNEEQKMGMRKDHGDSFRTLESGRAVAFMMDDLA
GLTI_ECOLI      RLLTKKGGD-IKDFANLKDKAVVVTSGTTSEVLLNKLNEEQKMNMRKDHGDSFRTLESGRAVAFMMDDLA
PHEC_PSEAE      TITLCSEEARFQTQIDQPGVTAIVNPGGTNEKFARANLKKARILVHPDNVTIFQQIVDGKADLMMTDAIE
GLUB_CORGL      ALLVRQDDDRIETLEDLNGLILCSVSGSTPAQKVKDVLPGVQLQEYDTYSSCVEALSQGNVDALTTDATI
AABA_DICNO      FAFITKDDS-IKTIQDLANKKVSVWTGSNHEQKIKEIEGTGSVIPAKSIFLAVKAVIQGEADVAVGD---
ARTJ_CHLTR      LVLVFKGENK-HPLPLTQYRSVAVQTGTYQEAYLQSLSEV-HIRSFDSTLEVLMEVMHGKSPVAVLEPSI
TCYJ_BACSU      YITVKEDNHKIHTLKDLHGKTVIVGATSNAADYITKYNKTHGSPIHLKYADTANQIETGRADATIATPFA
GLUB_COREF      ALLVREDDDRIQTLEDLDGLILCSVTGSTPAQKVKDVLPGVQLQEYDTYSSCVEALSQGNVDAMTTDATI
TCYK_BACSU      KITVLQNNDTIRGIEDLKGKRVITSATSNGALVLKKWNEDNGRPFEIAYEETANQLKSGRADATISTPFA
MLTF_DESOH      HLILHKSDHSIVTPAGLAGRTVHVREDTTYQQRLEQADGIDQLVLHRNTPTEELIEQVAKRQIDITVADS
MLTF_PHOPR      IVVYKNGQWRPRKPADLKG-TLSVVKGSSHEKHLIKLKEIHPDLTWESIEETDSDVAKGELDFTIADSVD
ARTI_HAEIN      XXVALKGKATLESA-----KNIGVQNGTTFQQYTVAETKQYSPKSYASLQNAILDLKSGRIDIIFGDTAV
MLTF_COLP3      KLVFKQGNVRPRKVADLTGTLMVT----SGSSYVENLEKLKQTNSELAWQESLRKVLSGEIDYTIIDSNN
PEB1A_CAMJJ     GLLVLK-EKNYKSLADMKGANIGVXXXXXXXXXXXXXXXXXDVKFFPDYPSIKAALDAKRVDAFSVDKSI
PEB1A_CAMJE     GLLVLK-EKKYKSLADMKGANIGVXXXXXXXXXXXXXXXXXDVKFFPDYPSIKAALDAKRVDAFSVDKSI
Y4TE_RHISN      GMLVIKGNRNFHSYEDVQGKI-------------------------------------------------
MLTF_AERHH      KLVYRNGSPKPKDIGDLKGNIV-VPAGSTGEDLLK--------ELAKQYPSTNRDADVEELLKQVADTVV
AAPJ_RHIL3      GFMVRKG-LNVKSALELSGAAICVQSGTTTELNLADYFKTNNLQVFENLPEVNAAYDAGRCDVYTTDQLY
MLTF_PSEF5      QVIYRNGRSRPTTAQDLVGKHIMVLKGSTHAEQLAELDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQV-
MLTF_SODGM      QLVYRLGQPRPKNLGDLRGRL----AVASGSAQITQLRQLKKKQYPQLAWEVSSDLSSGKLDYTLAD--S
MLTF_SACD2      QLIYRSGESKPETIEDLYGKRVMVISNSSHSERLKELQ--------------------------------
MLTF_AERS4      KLVYRYGSPKPKDIGDLKGSIV-VPAGSTGEELAKEYPGLKSTNRDADVEELLKQVADGKIDTVVQDTV-
YHDW_ECO57      IGFLTHDKAGLKSAKELDGATVCIQAGTDTELNVAKANNMKYTPVFDRSDESAKALESGRCDTLASDQSQ
MLTF_VIBF1      XXXXKKGSWRPRNIKNLTDENLTIVKDSSFEGTL--------IKLKEKYPELLKKVATGEIHYTLADSVE
MLTF_PSEPF      QIIYRNGQSRPTDAGDLVGKKIMVLKGSTHAEQLAELDAVEVVDLLRMVDEGQIDLTLVDSNEVAMNQV-
MLTF_KLEP7      QLVYRVGNTRPRTLAALTAEQLTI---APGHVAINDLQTLKAEK----YPDALMQAVIGKLDYTIADSVA
MLTF_YERE8      QLVYRLGSPRPKSFSDLKGQLI-VASGSAHMTTLKQLKQTKYPDLNRSGKELLEQVADGKLDYTLGDSVT
GLK1_DROME      SIMIKK----------------------------------------------------------------
MLTF_ACTP2      QVVYKKGSNRPYKLSELEGDLI-IPAGSAVLPILQRLKEDNPKLSWQTQEELLLQVAEGKIPVGVSVDIS
MLTF_ACTPJ      QVVYKKGSNRPYKLSELEGDLI-IPAGSAVLPILQRLKEDNPKLSWQTQEELLLQVAEGKIPVGISVDIS
MLTF_ACTP7      QVVYKKGSNRPYKLSELEGDLI-IPAGSAVLPILQRLKEDNPKLSWQTQEELLLQVAEGKIPVGISVDIS
MLTF_PSEPG      QVIYRNGRPRPTNAKGLVGKKIMVLKGSSHADLLAELDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQV-
YHDW_ECOLI      IGFLTHDKAGLKSAKELDGATVCIQAGTDTELNVAKANNMKYTPVFDRSDESAKALESGRCDTLASDQSQ
MLTF_VIBCH      XXXXKKG---------------------------------------------------------------
MLTF_VIBC3      XXXXKKG---------------------------------------------------------------
MLTF_ALCBS      LLVRRLTSHRITDLSQLNQQTIAVSAGSSHAELLLKAQELEFQEVENATPEQLLALEDGQVDYTL---IN
MLTF_PSEMY      QIIYRQGETRPTKAEDLLGKRILVLAGSSHAEQLEALK--------------------------------
MLTF_PSEP1      QVIYRNGRARPTGAKGLVGKKIMVLKGSSHADQLAELDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQV-
GRID1_RAT       GILIKK----------------------------------------------------------------
GRID1_MOUSE     GILIKK----------------------------------------------------------------
GRID1_HUMAN     GILIKK----------------------------------------------------------------
MLTF_YERPY      QLVYRLGSPRPKSFSDLKGQVV-VASGSAHMTTLKRLKQTKYPELNKSGKELLEQVAEGKLDYTLGDSAT
MLTF_YERPS      QLVYRLGSPRPKSFSDLKGQVV-VASGSAHMTTLKRLKQTKYPELNKSGKELLEQVAEGKLDYTLGDSAT
MLTF_YERPP      QLVYRLGSPRPKSFSDLKGQVV-VASGSAHMTTLKRLKQTKYPELNKSGKELLEQVAEGKLDYTLGDSAT
MLTF_YERPN      QLVYRLGSPRPKSFSDLKGQVV-VASGSAHMTTLKRLKQTKYPELNKSGKELLEQVAEGKLDYTLGDSAT
MLTF_YERPG      QLVYRLGSPRPKSFSDLKGQVV-VASGSAHMTTLKRLKQTKYPELNKSGKELLEQVAEGKLDYTLGDSAT
MLTF_YERPE      QLVYRLGSPRPKSFSDLKGQVV-VASGSAHMTTLKRLKQTKYPELNKSGKELLEQVAEGKLDYTLGDSAT
MLTF_YERPB      QLVYRLGSPRPKSFSDLKGQVV-VASGSAHMTTLKRLKQTKYPELNKSGKELLEQVAEGKLDYTLGDSAT
MLTF_YERPA      QLVYRLGSPRPKSFSDLKGQVV-VASGSAHMTTLKRLKQTKYPELNKSGKELLEQVAEGKLDYTLGDSAT
MLTF_YERP3      QLVYRLGSPRPKSFSDLKGQVV-VASGSAHMTTLKRLKQTKYPELNKSGKELLEQVAEGKLDYTLGDSAT
MLTF_SHEON      VLVYREGMPAPKDISDLKGKI-------------------------------------------------
MLTF_PSEPK      QVIYRNGRPRPTGAKGLVGKKIMVLKGSSHADQLAELDAVEVVDLLRMVDEGQIDLTL-----VDSNELA
MLTF_SHEB9      VLVYREGMPAPKDISDLKGKI-------------------------------------------------
MLTF_SHEB8      VLVYREGMPAPKDISDLKGKI-------------------------------------------------
MLTF_SHEB5      VLVYREGMPAPKDISDLKGKI-------------------------------------------------
MLTF_SERP5      QLVYRLGTARPKTFADIKGKL----AVASGSAHVSTLKQLKQSKFPDLSWEASSDLTSGKLDYTLGDSVT
MLTF_SHESM      VLVYREGMPTPKDITDLKGKI-------------------------------------------------
MLTF_SHESR      VLVYREGMPTPKDITDLKGKI-------------------------------------------------
MLTF_SHESA      VLVYREGMPTPKDITDLKGKI-------------------------------------------------
MLTF_IDILO      KVVFKQGSR--QRPRDLQGEIVVVE-GSSHHEFLKSLDSIPTLKWRATRDHDAVELLQMVISGEVDYTIT
MLTF_SHESW      VLVYREGVAAPKDISKLKGRI-------------------------------------------------
MLTF_SHEPC      VLVYREGVAAPKDISKLKGRI-------------------------------------------------
MLTF_SHEPA      VLVYRQGTPIPRSVDTLKGEITVTTDSSFVDTLTELQKSNPDLEKDKDAEELLTMIAAGEIPYTIAD---
MLTF_SHEFN      VLVYKEGTPEPKDISTLSGEIT-VMANSSSVNTL--------TKLQKDYPE-------------------
MLTF_SHIDS      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKETKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_SALPB      QLVYRVGQYRPRSLATVNENQLTI---APGHVVVNDLQRLKETKFKKGSTTLLEEVISGKLDYTIADSVA
MLTF_SHELP      VLVYKQGAKYPTDVSQLDDNITVISDSSF-------IETLAEMQ--KLYPELVWDQQWDKLAMIARDEIS
MLTF_PSEE4      QVIYRNGRSRPTNAKGLVGKKIMVLKGSSHADQLAELDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQV-
MLTF_SHEWM      VLVYKQGTPQPKDISQLKDEIT-VITDSSFVDTLSQLQKIYPELVWKDNEELLAMIARGEISYTIADSTT
GRIK3_RAT       SILYRK----------------------------------------------------------------
GRIK3_MACFA     SILYRK----------------------------------------------------------------
GRIK3_HUMAN     SILYRK----------------------------------------------------------------
GLRK_RANBE      GILLKKDT--------------------------------------------------------------
MLTF_NITMU      IYQLVQPQLAYNTLHQLGGRTIRIAKGVTHAEQLNKVPELKWKEMDLTPDELLARLAEGKVDYVVADNLA
MLTF_ECOSM      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKETKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_SHIF8      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKETKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_CELJU      QLVYNHRLGTPTSIKDLKGKEVLILADSAHSKRV--------ARLQKKFPNTWRPIENGQIDLLEMVHKG
MLTF_SHIFL      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKETKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_SHIBS      QLVYKVGQYRPRTLCNLTAEQLTV---APGHVVVNDLQTLKETKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_SHIB3      QLVYKVGQYRPRTLCNLTAEQLTV---APGHVVVNDLQTLKETKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_ECOLI      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKETKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_ECOLC      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKETKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_ECOHS      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKETKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_ECODH      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKETKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_ECO57      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKETKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_ECO11      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKETKFKKGSAELMEDVIEGKLDYTIADSVA
GLR2_CAEEL      SIMIKK----------------------------------------------------------------
GLR1_CAEEL      SIMIKK----------------------------------------------------------------
MLTF_PSEPW      QVIYRNGRSRPTDPKGLVGKKIMVLKGSSHADQLAELDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQV-
MLTF_PSEHT      KLVYKQGIERPRDYDDLTGNLM-VIAKSSHSLTLQKVK--------KSNPELNWSXXXXXXXXXLLQAVI
MLTF_ECOUT      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKDTKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_ECOL5      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKDTKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_ECOK1      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKDTKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_ECO24      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKDTKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_ECOL6      QLVYKVGQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKDTKFKKGSVELMEDVIEGKLDYTIADSVA
NMDE3_RAT       SVMVSRSNGTVSPSAFLE----------------------------------------------------
NMDE3_MOUSE     VMVARSNGT-------------------------------------------------------------
NMDE3_HUMAN     VMVARSNGT-------------------------------------------------------------
MLTF_PSESM      QVVYRNGQSRPTDPGDLVGKRIVVLKGSAHAEQLEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQV-
NMDE4_RAT       VMVARSNGT-------------------------------------------------------------
NMDE4_MOUSE     VMVARSNGT-------------------------------------------------------------
NMDE4_HUMAN     VMVARSNGT-------------------------------------------------------------
MLTF_PSE14      QVVYRNGQSRPTDPGDLVGKRIVVLKGSAHAEQLEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQV-
GRID2_DANRE     ----------------------------------------------------------------------
BZTA_RHOCA      GFMVNK-SLGVSSAKELDGATICVQTGTTTE--------MNLADFFKANNMTYTPVNIAKFAAGACDSYT
MLTF_SULDN      QVVCNK----------------------------------------------------------------
MLTF_SHISS      QLVYKVSQYRPRTLGNLTAEQLTV---APGHVVVNDLQTLKDTKFKKGSAELMEDVIEGKLDYTIADSVA
MLTF_PSEU2      QVVYRNGQSRPTDPGDLVGKRIVVLKGSAHAEQLEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQV-
GRIK4_RAT       ----------------------------------------------------------------------
GRIK4_PANTR     ----------------------------------------------------------------------
GRIK4_MOUSE     ----------------------------------------------------------------------
GRIK4_HUMAN     ----------------------------------------------------------------------
GRIA4_RAT       SIMIKK----------------------------------------------------------------
GRIA4_MOUSE     SIMIKK----------------------------------------------------------------
GRIA4_MACFA     SIMIKK----------------------------------------------------------------
GRIA4_HUMAN     SIMIKK----------------------------------------------------------------
MLTF_VIBHB      XXXXKKGQLRPRDVDQLKDEKAGNEDSNAGAETLQIVEQSQFVALQKEHPELLKHVSTGELRFTVTDSVE
MLTF_HAES2      QLTYRKGERRPITLENLSGKLVIPANSALNNILLAKKEKYPSLTWETSQEELLFQVAEGKIDYTIATSTE
MLTF_HAES1      QLTYRKGERRPITLENLSGKLVIPANSALNNILLAKKEKYPSLTWETSQEELLFQVAEGKIDYTIATSTE
MLTF_SHEHH      VLVYRQGTPVPKNINSLNGEITVTDLQKSNPDLVWNQEKDKDAE------ELLTMIAAGDIPYTIAD---
MLTF_SHEAM      VVVYRQGNRAPESIEQLSGNL-------------------------------------------------
MLTF_PASMU      QLVYRKGTERPRSLGELKGS-LSIASGSXXXXXXXXXDLIWRVNEKLTPEELLIQMADGKIDYVIANSID
BVGS_BORPE      VIVTRQDPDAPVDADHLDGRTVALVRNSAAIPLLQRRYPQAKVVTADNPSEAMLMVANGQADAVVQTQIS
MLTF_PSEU5      QVVYHSGQRRPTSPKDLIGKRILVLKGSSQAEKLASLDAVEVVDLLRMVDEGQIDLTLVESNEMSMNQV-
GRIK1_MACFA     SILYRK----------------------------------------------------------------
GRIK1_HUMAN     SILYRK----------------------------------------------------------------
GRIK5_RAT       ----------------------------------------------------------------------
GRIK5_MOUSE     ----------------------------------------------------------------------
GRIK5_HUMAN     ----------------------------------------------------------------------
GLRK_XENLA      SILLRKEDASENS---------------------------------------------------------
MLTF_ENT38      XXXXXXXXXXPRTMATLNDQQLTV---APGHVVIDDLRALKE----KKYPDLSVDEKLGKLAYTIADSVA
GRIA3_RAT       SIMIKK----------------------------------------------------------------
GRIA3_MOUSE     SIMIKK----------------------------------------------------------------
GRIA3_MACFA     SIMIKK----------------------------------------------------------------
GRIA3_HUMAN     SIMIKK----------------------------------------------------------------
GRIA2_RAT       SIMIKK----------------------------------------------------------------
GRIA2_PONAB     SIMIKK----------------------------------------------------------------
GRIA2_MOUSE     SIMIKK----------------------------------------------------------------
GRIA2_MACFA     SIMIKK----------------------------------------------------------------
GRIA2_HUMAN     SIMIKK----------------------------------------------------------------
NMDE2_RAT       SVMVSRSNGTVSPSAFLE----------------------------------------------------
NMDE2_MOUSE     SVMVSRSNGTVSPSAFLE----------------------------------------------------
NMDE2_HUMAN     SVMVSRSNGTVSPSAFLE----------------------------------------------------
NMDE2_CANFA     SVMVSRSNGTVSPSAFLE----------------------------------------------------
GRIK1_MOUSE     SILYRK----------------------------------------------------------------
GLRK_LYMST      SIMIKR----------------------------------------------------------------
NMDZ1_RAT       TILVKK----------------------------------------------------------------
NMDZ1_MOUSE     TILVKK----------------------------------------------------------------
NMDZ1_HUMAN     TILVKK----------------------------------------------------------------
NMDZ1_CANFA     TILVKK----------------------------------------------------------------
GRIK1_RAT       SILYRK----------------------------------------------------------------
GRIA1_RAT       SIMIKK----------------------------------------------------------------
GRIA1_MOUSE     SIMIKK----------------------------------------------------------------
GRIA1_MACFA     SIMIKK----------------------------------------------------------------
GRIA1_HUMAN     SIMIKK----------------------------------------------------------------
NMDA1_DROYA     TILEKK----------------------------------------------------------------
NMDA1_DROWI     TILEKK----------------------------------------------------------------
NMDA1_DROVI     TILEKK----------------------------------------------------------------
NMDA1_DROSI     TILEKK----------------------------------------------------------------
NMDA1_DROSE     TILEKK----------------------------------------------------------------
NMDA1_DROMO     TILEKK----------------------------------------------------------------
NMDA1_DROME     TILEKK----------------------------------------------------------------
NMDA1_DROGR     TILEKK----------------------------------------------------------------
NMDA1_DROER     TILEKK----------------------------------------------------------------
NMDA1_DROAN     TILEKK----------------------------------------------------------------
MLTF_MAGSM      QVVCRRGGVRPTNLLKLTQAKLTVVKESAYEDRLRELQQLVPQLTWHSVEQVLEQVWLGKVDCTLAD---
EVGS_ECO57      VFVMQKAPDSEQTLK--KGMKVAIELHSQLKEMYPEVEWIK----VDNASAAFHKVKEGELDALVATQLN
BVGS_BORPA      VIVTRQXXXXXXXXXHLDGRTIAMVRNSAAIPLLQQRYPQAKVVTADNPTEAMLLVADGQADAVVQTQIS
BVGS_BORBR      VIVTRQXXXXXXXXXHLDGRTIAMVRNSAAIPLLQQRYPQAKVVTADNPTEAMLLVADGQADAVVQTQIS
MLTF_VIBPA      XXXXKKGQLRPRDIEQLIEYQASKDSQSAGAQTLKIVEQSQYVALKKQYPELLKHVSTGELRFTVTDSVE
NMDE1_RAT       SVMVSRSNGTVSPSAFLE----------------------------------------------------
NMDE1_PANTR     SVMVSRSNGTVSPSAFLE----------------------------------------------------
NMDE1_MOUSE     SVMVSRSNGTVSPSAFLE----------------------------------------------------
NMDE1_HUMAN     SVMVSRSNGTVSPSAFLE----------------------------------------------------
GRID2_RAT       ----------------------------------------------------------------------
GRID2_MOUSE     ----------------------------------------------------------------------
GRID2_HUMAN     ----------------------------------------------------------------------
NMDA1_DROPS     TILEKK----------------------------------------------------------------
NMDA1_DROPE     TILEKK----------------------------------------------------------------
GRIK2_RAT       SILYRK----------------------------------------------------------------
GRIK2_MOUSE     SILYRK----------------------------------------------------------------
GRIK2_MACFA     SILYRK----------------------------------------------------------------
GRIK2_HUMAN     SILYRK----------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ASHYISKRADTYEIVGEKITDEPLAIGLRKSDPELKEAIDNVLNEMKKDGTLTKISMKWFNRDITVK
FLIY_ECOLI      ALDLVKKTNDTLAVTGEAFSRQESGVALRKGNEDLLKAVNDAIAEMQKDGTLQALSEKWFGADVT--
FLIY_ECOL6      ALDLVKKTNDTLAVTGEAFSRQESGVALRKGNEDLLKAVNDAIAEMQKDGTLQALSEKWFGADVT--
TCYA_BACSU      VLNYLKTSGNNVKIAFETGEPQSTYFTFRKGSGEVVDQVNKALKEMKEDGTLSKISKKWFGEDVS--
YXEM_BACSU      LIAQIKKTGLPLKLAGDPIVYEQVAFPFAKDDDKLRKKVNKALDELRKDGTLKKLSEKYFNEDITVE
ARGT_SALTY      ASEGFLKQGKEYAFAGPSVKDDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNV---
ARGT_ECOLI      ASEGFLKQGKDFAFAGSSVKDDGTGVGLRKDDAELTAAFNKALGELRQDGTYDKMAKKYFDFNV---
Y1080_HAEIN     VLDYFKQHPNSLKIAYDRGDKTPTAFAFLQGEDALITKFNQVLEALRQDGTLKQISIEWFGYDIT--
HISJ_SALTY      ASEGFLKQGKDYKFGGPAVKDEKLGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDV---
GLNH_ECOLI      ILYFIKTAGNQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTE----
GLNH_ECOL6      ILYFIKTAGNQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTE----
GLNH_ECO57      ILYFIKTAGNQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTE----
HISJ_ECOLI      ASEGFLKQGKDYKFGGPSVKDEKLGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDV---
HISJ_ECOL6      ASEGFLKQGKDYKFGGPSVKDEKLGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDV---
HISJ_ECO57      ASEGFLKQGKDYKFGGPSVKDEKLGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDV---
ARTP_BACSU      AEGYFKSNDDLFVIPDAKAEEAGSAIAFRK-DSELTDKFNKALKEMEDNGELEKLKKKWF-------
ARTI_ECOLI      VTEWL-KDNPKLAAVGDKVTDKDLGIAVRQGNTELQQKLNTALEKVKKDGTYETIYNKWFQK-----
PATH_VIBHA      ALELIKKTGLPLQLAGEPFETIQNAWPFNEKGRKLQAEVNKALAEMRADGTVEKISVKWFGADIT--
ARTJ_ECOLI      VNEWL-KTNPQLGVATEKVTDPQLGIAVRPDXXXXXXXXXXXXXXXXXDGTYQKISDQWF-------
HISJ_CAMJE      AKGFLAENPELVSFYQETDGGEGFSFAFDKNQKDIIEIFNKGIDEAKTDGFYDTLIKKY--------
NOCT_AGRT5      FLKPLTDKPDNKDLFGPRMTXXXXXXXIRKEDADLKALFDKAIDAAIADGTVQKLSQQWFGYDASPK
HISJ_NEIGO      IANYVKNNAKGMDFVTPDFTTEHYGIAVRKGDEATVKMLNDALEKVRESGEYDKIYAKYFAKE----
GLNH_BACST      LLWGMAKQDPNYRVLDETFSKEPYGIGSAKETKNYCKSLTN--------------------------
LAPT_PASHA      VLAEMARKHEGLDFVGEKINNDGLGIATHLKNQVLVDQFNAALKTIKENGEYQKIYDKW--------
OCCT_RHIRD      XXXXIEKP----EMKGAKLVGPVVAVGLRKEDTALKADFDAAIKAASEDGTIKTLSLKWFKVDVT--
OCCT_AGRT4      XXXXIEKP----EMKGAKLVGPVVAVGLRKEDTALKADFDAAIKAASEDGTIKTLSLKWFKVDVT--
GLNH_BACSU      L-YGMADENKNYQLTGKPFTDEPYGIAVKKGQSALAKEINASLKKMKSDGRYDEIYKKWIKED----
OCCT_RHIME      AAFEQPDMKDA-KVVGPLFSGDELAVGLRKEDAALKADFDSSIKAVADEGTIKTLSSKWFKVDVT--
YCKB_BACSU      QTLALAAFPDLNITIHPDIKYMPQALVMKKSNAALQKKMNEALKEMSKDGSLTKLSKQFFNKDVSKK
GLTI_SALTY      GERAKAKKPDNWEIVGKPQSQEAYGCMLRKNDPEFKKLMDDTIAQAQTSGEAEKWFDKWFKNPIPPK
GLTI_ECOLI      GERAKAKKPDNWEIVGKPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPK
PHEC_PSEAE      ARLQSRLHPELCAVHPQQPFDFAEKAYLLPRDEAFKRYVDQWLHIAEQSGLLRQRMEHW--------
GLUB_CORGL      LFGYSQQYEGDFRVVGEPFTDEYYGIGLKKDDQEGTDAINAALERMYADGTFQRLLTENLGEDSVV-
AABA_DICNO      -DAYMLNFADRYKVIDRSTEPESYAIAVRKGDQALKKKIDDALLQLKRDGTIDALTKKWY-------
ARTJ_CHLTR      AQVVLK----DFPALSTATIDLPYGIGVASDRPALALKIEAAVQEIRKEGVLAELEQKW--------
TCYJ_BACSU      VDFQNKTHAFRQKTVGDVLLDTEVYFMFNKGSQTLADDTDQAIKKLEKNGTLKKLSRKWLGAD----
GLUB_COREF      LFGYAQQREGEFRVVGEPFTNEYYGIGITKDDTEATDAINAALERMYADGSFQRFLTENLGEDSQV-
TCYK_BACSU      VDFQNKTSTIKEKTVGNVLSNAKVYFMFNKNEQTLSDDIDKALQEIIDDGTLKRLSLKWLGDD----
MLTF_DESOH      AIALLNRRYPDIRIAFPIEKEQPLAWAVRKGDRGLRTEINRFFDEIKENGTFTRIYNRYY-------
MLTF_PHOPR      VA--LSQRIHPDVAIAMELTDEPIAWFVNKSDDSLYALLIEFFGEIKQSGELAQLEEKYF-------
ARTI_HAEIN      LADMISKEPE-IQFIGEKVTNKKLGIAMHKSNKDLAAQLNKGLAAIKANGEYQKIYDKWITK-----
MLTF_COLP3      LA--INRRYYPEISIGFSINEEPLAMVSENSHDDILASLVEFFGTVHHDGTLLALDDKYY-------
PEB1A_CAMJJ     LLGYVD---DKSEILPDSFEPQSYGIVTKKDDPAFAKYVDDFVKEHKNE--IDALAKKW--------
PEB1A_CAMJE     LLGYVD---DKSEILPDSFEPQSYGIVTKKDDPAFAKYVDDFVKEHKNE--IDALAKKW--------
Y4TE_RHISN      -------------------------------------------------------------------
MLTF_AERHH      QDTVLARTQRYYPELTEGMTNQTVAWAMTKPDDSLYASIIDFFGQRFMDGAIAKLDEKYF-------
AAPJ_RHIL3      SLRLTLKNPDEHIILPEIISKEPLGPAVRQGDDQ---------------------------------
MLTF_PSEF5      ---YFPNVRVAFDLGDARSQSWAVAAG---DDNSLLNEINSFLDKVEKNGTLQRLKDRYY-------
MLTF_SODGM      ASVGLLQRVHPQLAVAFDITEEPVTWYLRRSDSELSAALLDFFSQLNDNGIMARLEEKY--------
MLTF_SACD2      -------------------------------------------------------------------
MLTF_AERS4      ----LARTQRYYPELTEGLTNQTVAWAMTKPDDSLYASIIDFFGQRFMDGAIAKLDEKYF-------
YHDW_ECO57      LYALRIKLSNPAEVLPEVISKEPLGPVVRRGDDE---------------------------------
MLTF_VIBF1      LS--LTQRIHPDLAVAFEVTDQPVAWFLQQTDDSLQALLIEFFGELKESGKLALLEEKYF-------
MLTF_PSEPF      ---YFTNIRVAFDLGDARSQSWAVAAG---EDNSLLNEINSYLDKVQKNGTLQRLKDRYY-------
MLTF_KLEP7      VS--LFQRVHPELAVALDITDEPVTFSARDDDNSLSAAMLDFFNNINEDGTLARLEEKY--------
MLTF_YERE8      IA--LLQRIHPQLAVAFDVTDEPVTWYFQQSDDSLYAAMLDFYSEMVEDGSLARLEEKY--------
GLK1_DROME      -------------------------------------------------------------------
MLTF_ACTP2      AAQHIRPNI----AVGFDLTDEAPVLWYNSSYSELQAAVLDFMNHANETGLISRIEEKYFN------
MLTF_ACTPJ      AAQHIRPNI----AVGFDLTDEAPVLWYNSSYSELQAAVLDFMNHANETGLISRIEEKYFN------
MLTF_ACTP7      AAQHIRPNI----AVGFDLTDEAPVLWYNSSYSELQAAVLDFMNHANETGLISRIEEKYFN------
MLTF_PSEPG      ---YFPNVRVAFDVGDTRDQRWAVAAG---EDNSLLNEINEFLDKAQKNGTLQRLKDRYY-------
YHDW_ECOLI      LYALRIKLSNPAEVLPEVISKEPLGPVVRRGDDE---------------------------------
MLTF_VIBCH      -------------------------------------------------------------------
MLTF_VIBC3      -------------------------------------------------------------------
MLTF_ALCBS      SNSYTLQRALWPDLVADYTVDMPLSWAFNKDDKSLYQEAQRYLTQAKADGTTAKLEDRFY-------
MLTF_PSEMY      -------------------------------------------------------------------
MLTF_PSEP1      ---YFPNVRVAFDLGDTRDQRWAVAAG---EDNSLLNEINEFLDKAQKNGTLQRLKDRYY-------
GRID1_RAT       -------------------------------------------------------------------
GRID1_MOUSE     -------------------------------------------------------------------
GRID1_HUMAN     -------------------------------------------------------------------
MLTF_YERPY      IA--LLQRIHPQLAVAFDVTDEPVTWYFKQSDDDLYAAMLDFYSEMVEDGSLARLEEKY--------
MLTF_YERPS      IA--LLQRIHPQLAVAFDVTDEPVTWYFKQSDDDLYAAMLDFYSEMVEDGSLARLEEKY--------
MLTF_YERPP      IA--LLQRIHPQLAVAFDVTDEPVTWYFKQSDDDLYAAMLDFYSEMVEDGSLARLEEKY--------
MLTF_YERPN      IA--LLQRIHPQLAVAFDVTDEPVTWYFKQSDDDLYAAMLDFYSEMVEDGSLARLEEKY--------
MLTF_YERPG      IA--LLQRIHPQLAVAFDVTDEPVTWYFKQSDDDLYAAMLDFYSEMVEDGSLARLEEKY--------
MLTF_YERPE      IA--LLQRIHPQLAVAFDVTDEPVTWYFKQSDDDLYAAMLDFYSEMVEDGSLARLEEKY--------
MLTF_YERPB      IA--LLQRIHPQLAVAFDVTDEPVTWYFKQSDDDLYAAMLDFYSEMVEDGSLARLEEKY--------
MLTF_YERPA      IA--LLQRIHPQLAVAFDVTDEPVTWYFKQSDDDLYAAMLDFYSEMVEDGSLARLEEKY--------
MLTF_YERP3      IA--LLQRIHPQLAVAFDVTDEPVTWYFKQSDDDLYAAMLDFYSEMVEDGSLARLEEKY--------
MLTF_SHEON      -------------------------------------------------------------------
MLTF_PSEPK      MNQVYFPNVRVAFDLGE-TRDQRWAVAAGEDNSLLNE-INEYLDKAQKNGTLQRLKDRYY-------
MLTF_SHEB9      -------------------------------------------------------------------
MLTF_SHEB8      -------------------------------------------------------------------
MLTF_SHEB5      -------------------------------------------------------------------
MLTF_SERP5      IA--LLQRIHPQLAVAFDVTDEPVTWYLKRTDDSLYAAMLDFYSQMVDDGTLARLEEKY--------
MLTF_SHESM      -------------------------------------------------------------------
MLTF_SHESR      -------------------------------------------------------------------
MLTF_SHESA      -------------------------------------------------------------------
MLTF_IDILO      DSTALDIQRRFHPDLSVAFTDQDIAWALQGKDDSLFAAVIEYFGEIRSSGRLAHIKEQHF-------
MLTF_SHESW      -------------------------------------------------------------------
MLTF_SHEPC      -------------------------------------------------------------------
MLTF_SHEPA      -------------------------------------------------------------------
MLTF_SHEFN      -------------------------------------------------------------------
MLTF_SHIDS      ISLF--QRVHPELAVALDITDEQPVTWFRPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_SALPB      IS--LFQRVHPELAVALDVTDEQPVTWFSRLDDDLSAALLDFFNSINEDGSLARIEEKY--------
MLTF_SHELP      ---YTIADSTTFEIAGPVLREGQAVVWLPNGSDQLMSDLLSFWHQEKRAGTLAHLNEKYF-------
MLTF_PSEE4      ---YFPNVRVAFDLGDTRDQRWAVAAG---DDNSLLNEINEFLDKSQKNGTLQRLKDRYY-------
MLTF_SHEWM      FE--ISRRYMPELRAGLTLKEKQAIVWLQNSDKLMSELLTFWHGE-KLDGTLAHLDEKYF-------
GRIK3_RAT       -------------------------------------------------------------------
GRIK3_MACFA     -------------------------------------------------------------------
GRIK3_HUMAN     -------------------------------------------------------------------
GLRK_RANBE      -------------------------------------------------------------------
MLTF_NITMU      KNFYPNLNANLGDSVGRAWAFSPFA------EQALLEATQKFFTRIQQDGTLTRLLDRYY-------
MLTF_ECOSM      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_SHIF8      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_CELJU      EADYAVIDSNAYELAFDISNPQPLAWAFPHSDTSLFDAAQRYMAQIKRDGSLAQVTKHFFERHI---
MLTF_SHIFL      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_SHIBS      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_SHIB3      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_ECOLI      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_ECOLC      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_ECOHS      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_ECODH      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_ECO57      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_ECO11      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
GLR2_CAEEL      -------------------------------------------------------------------
GLR1_CAEEL      -------------------------------------------------------------------
MLTF_PSEPW      ---YFPNVRVAFDLGETRNQRWAVAPG---EDNSLLNEVNEFLDKSQKNGTLQRLKDRYY-------
MLTF_PSEHT      DGEIDYTLADTHTLIGFSITNDPIAWMLRKSDDSLYALLVPFFGEAKQNNQLYVLEEKYF-------
MLTF_ECOUT      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_ECOL5      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_ECOK1      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_ECO24      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_ECOL6      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
NMDE3_RAT       -------------------------------------------------------------------
NMDE3_MOUSE     -------------------------------------------------------------------
NMDE3_HUMAN     -------------------------------------------------------------------
MLTF_PSESM      ---YFPNVRVAFDLGEAREQRWAVAPG---EDNSLLNEINAYLDKVEKNGTLQRLKDRYY-------
NMDE4_RAT       -------------------------------------------------------------------
NMDE4_MOUSE     -------------------------------------------------------------------
NMDE4_HUMAN     -------------------------------------------------------------------
MLTF_PSE14      ---YFPNVRVAFDLGEAREQRWVVAPG---EDNSLLNEINAYLDKVEKNGTLQRLKDRYY-------
GRID2_DANRE     -------------------------------------------------------------------
BZTA_RHOCA      ASGLASSRATDIVILPEIISKEPLGPVVRHGD-----------------------------------
MLTF_SULDN      -------------------------------------------------------------------
MLTF_SHISS      ISLF--QRVHPELAVALDITDEQPVTWFSPLDGDLSAALLDFFNEMNEDGTLARIEEKY--------
MLTF_PSEU2      ---YFPNVRVAFDLGEARAQRWAVAPG---EDNSLLNEINAYLDKVEKNGTLQRLKDRYY-------
GRIK4_RAT       -------------------------------------------------------------------
GRIK4_PANTR     -------------------------------------------------------------------
GRIK4_MOUSE     -------------------------------------------------------------------
GRIK4_HUMAN     -------------------------------------------------------------------
GRIA4_RAT       -------------------------------------------------------------------
GRIA4_MOUSE     -------------------------------------------------------------------
GRIA4_MACFA     -------------------------------------------------------------------
GRIA4_HUMAN     -------------------------------------------------------------------
MLTF_VIBHB      LS-LAQRLYPDLALAFELTEDQPVSWFTRRSEDELYAMLIEFFGNIKQSGELATLEEKY--------
MLTF_HAES2      VS--VNQQIKPQIAIAFNVTDE-FTVHWYLSDSELQAALLDFMNSAIENGLIARIEEKYFN------
MLTF_HAES1      VS--VNQQIKPQIAIAFNVTDEFTVHWYDKGSSELQAALLDFMNSAIENGLIARIEEKYFN------
MLTF_SHEHH      -------------------------------------------------------------------
MLTF_SHEAM      -------------------------------------------------------------------
MLTF_PASMU      VSAVQQIKPNV--AVAFDVTDESTVHWYLPSNSELQASLLDFMNSAIETGLIARIEEKYFN------
BVGS_BORPE      ASYYVNRYFAGKLRIASALDLPPIALATTRGQTELMSILNKALYSISND-ELASIISRWRGSD----
MLTF_PSEU5      ---YFSNIRAGFD-VGEQ--NSLAWVVAKGEDDSLLKAADAFLEQAQQNGTLQRLRERYY-------
GRIK1_MACFA     -------------------------------------------------------------------
GRIK1_HUMAN     -------------------------------------------------------------------
GRIK5_RAT       -------------------------------------------------------------------
GRIK5_MOUSE     -------------------------------------------------------------------
GRIK5_HUMAN     -------------------------------------------------------------------
GLRK_XENLA      -------------------------------------------------------------------
MLTF_ENT38      ISFF--QRVHPEIAVALDVTDEQPVTWFSPLDDDLSAAILDFFNSMNEEGTLARLEEKY--------
GRIA3_RAT       -------------------------------------------------------------------
GRIA3_MOUSE     -------------------------------------------------------------------
GRIA3_MACFA     -------------------------------------------------------------------
GRIA3_HUMAN     -------------------------------------------------------------------
GRIA2_RAT       -------------------------------------------------------------------
GRIA2_PONAB     -------------------------------------------------------------------
GRIA2_MOUSE     -------------------------------------------------------------------
GRIA2_MACFA     -------------------------------------------------------------------
GRIA2_HUMAN     -------------------------------------------------------------------
NMDE2_RAT       -------------------------------------------------------------------
NMDE2_MOUSE     -------------------------------------------------------------------
NMDE2_HUMAN     -------------------------------------------------------------------
NMDE2_CANFA     -------------------------------------------------------------------
GRIK1_MOUSE     -------------------------------------------------------------------
GLRK_LYMST      -------------------------------------------------------------------
NMDZ1_RAT       -------------------------------------------------------------------
NMDZ1_MOUSE     -------------------------------------------------------------------
NMDZ1_HUMAN     -------------------------------------------------------------------
NMDZ1_CANFA     -------------------------------------------------------------------
GRIK1_RAT       -------------------------------------------------------------------
GRIA1_RAT       -------------------------------------------------------------------
GRIA1_MOUSE     -------------------------------------------------------------------
GRIA1_MACFA     -------------------------------------------------------------------
GRIA1_HUMAN     -------------------------------------------------------------------
NMDA1_DROYA     -------------------------------------------------------------------
NMDA1_DROWI     -------------------------------------------------------------------
NMDA1_DROVI     -------------------------------------------------------------------
NMDA1_DROSI     -------------------------------------------------------------------
NMDA1_DROSE     -------------------------------------------------------------------
NMDA1_DROMO     -------------------------------------------------------------------
NMDA1_DROME     -------------------------------------------------------------------
NMDA1_DROGR     -------------------------------------------------------------------
NMDA1_DROER     -------------------------------------------------------------------
NMDA1_DROAN     -------------------------------------------------------------------
MLTF_MAGSM      -SNVVALNRRYYPELTVKFAEQRLAWTLPKRAVFLHKEVVTWFNEIRSNGQLDELFEKYY-------
EVGS_ECO57      SRYMIDHYYELYHFLIPGVPNASLSFAFPRGEPELKDIINKALNAIPPSEVL-RLTEKW--------
BVGS_BORPA      ASYYVNRYFAGKLRIASALDLPPIALATARGQTELISILNKALYSISND-ELASIVSRWRGSD----
BVGS_BORBR      ASYYVNRYFAGKLRIASALDLPPIALATARGQTELISILNKALYSISND-ELASIVSRWRGSD----
MLTF_VIBPA      LS-LAQRLYPDLALAFELTEDQPVSWFTRRSEDELYAMLIEFFGNIKQSGELASLEEKY--------
NMDE1_RAT       -------------------------------------------------------------------
NMDE1_PANTR     -------------------------------------------------------------------
NMDE1_MOUSE     -------------------------------------------------------------------
NMDE1_HUMAN     -------------------------------------------------------------------
GRID2_RAT       -------------------------------------------------------------------
GRID2_MOUSE     -------------------------------------------------------------------
GRID2_HUMAN     -------------------------------------------------------------------
NMDA1_DROPS     -------------------------------------------------------------------
NMDA1_DROPE     -------------------------------------------------------------------
GRIK2_RAT       -------------------------------------------------------------------
GRIK2_MOUSE     -------------------------------------------------------------------
GRIK2_MACFA     -------------------------------------------------------------------
GRIK2_HUMAN     -------------------------------------------------------------------